Sequence alignment for CL0003

PF00536

EPHA8_MOUSE/927-991-----------------------------------------------------------------SGNGD-----LTVGD
LIPA2_HUMAN/1018-1082-----------------------------------------------------------------DMNHE-----WIGNE
EPHA6_MOUSE/958-1022-----------------------------------------------------------------EYPLF-----VTVGD
ANS1B_HUMAN/808-874-----------------------------------------------------------------PRCPV-----QTVGQ
ANS1B_HUMAN/882-947-----------------------------------------------------------------DGYHP-----TSVAE
EPHA1_HUMAN/911-975-----------------------------------------------------------------DGIPY-----RTVSE
CSKI2_HUMAN/487-550-----------------------------------------------------------------EGKDA-----QAIHN
CSKI2_HUMAN/557-620-----------------------------------------------------------------SY.IP-----TDLLE
EPHA2_HUMAN/902-966-----------------------------------------------------------------EGVPF-----RTVSE
SPKA_DICDI/238-301-----------------------------------------------------------------RIKKY-----KDLFD
Q9U2L2_CAEEL/244-306-----------------------------------------------------------------GNRGP-----RRLSE
SCML1_HUMAN/256-322-----------------------------------------------------------------STWSV-----EAVVL
SMAG1_HUMAN/327-381-----------------------------------------------------------------DV...-----...PA
Q9VD37_DROME/3-64-----------------------------------------------------------------HH...-----NIVCE
LIPB2_MOUSE/562-626-----------------------------------------------------------------AQWST-----ERVCT
LIPB2_MOUSE/637-697-----------------------------------------------------------------DH...-----IWVTR
Q9W263_DROME/667-731-----------------------------------------------------------------QLGHT-----WVATE
ANS1A_HUMAN/697-760-----------------------------------------------------------------LE...-----QSVGE
ANS1A_HUMAN/768-832-----------------------------------------------------------------DGNSP-----PSVPS
PHC2_MOUSE/784-848-----------------------------------------------------------------TKWNV-----EDVYE
LIPB_CAEEL/612-676-----------------------------------------------------------------VDWRS-----EQLAD
SARM1_CAEEL/612-676-----------------------------------------------------------------PGWTC-----ADVQY
SCMH1_HUMAN/591-656-----------------------------------------------------------------SSWTV-----EDVMQ
CNKR2_HUMAN/9-73-----------------------------------------------------------------SKWSP-----SQVVD
EPHA7_CHICK/916-980-----------------------------------------------------------------DFTTF-----CSVGE
O57458_XENLA/740-804-----------------------------------------------------------------AYTSL-----SRGDE
O62258_CAEEL/2-65-----------------------------------------------------------------EAWTQ-----FFVRA
O64649_ARATH/237-300-----------------------------------------------------------------LVTDL-----SPVLK
O73875_DANRE/912-976-----------------------------------------------------------------TPSSC-----GTVGD
O73876_DANRE/591-655-----------------------------------------------------------------DGAPF-----RSVDE
O73878_DANRE/904-968-----------------------------------------------------------------PLSHC-----SSVAD
EPHB2_CHICK/929-993-----------------------------------------------------------------DYTSF-----NTVDE
EPHA3_CHICK/909-973-----------------------------------------------------------------DISAF-----RTAGD
EPHB3_HUMAN/923-987-----------------------------------------------------------------DYTTF-----TTVGD
EPHA5_CHICK/939-1003-----------------------------------------------------------------GSGAY-----RSVGE
EPHB4_HUMAN/905-969-----------------------------------------------------------------HYSAF-----GSVGE
Q09493_CAEEL/1046-1109-----------------------------------------------------------------DVWSV-----DDVIG
Q18662_CAEEL/331-394-----------------------------------------------------------------GVPHA-----EVLAN
Q18662_CAEEL/401-465-----------------------------------------------------------------SVVPN-----NSLRE
SMSR1_CAEEL/12-78-----------------------------------------------------------------NEWRC-----EDVGN
SMG_DROME/594-654-----------------------------------------------------------------RNVGM-----SGIGL
BICC_DROME/803-866-----------------------------------------------------------------QLAKH-----KDIQT
Q27937_LOLFO/455-515-----------------------------------------------------------------TE...-----NTIAQ
LIPB1_HUMAN/645-709-----------------------------------------------------------------AKWTK-----EQVCN
LIPB1_HUMAN/720-780-----------------------------------------------------------------DF...-----NWVTR
Q91734_XENLA/246-310-----------------------------------------------------------------HYSSF-----SSVSE
Q93203_CAEEL/904-967-----------------------------------------------------------------SAGRF-----FYVSE
SHAN3_RAT/1750-1813-----------------------------------------------------------------QLWSK-----FDVGD
Q9PVV1_LAMRE/277-341-----------------------------------------------------------------EYTMF-----CSVGE
Q9PVV2_LAMRE/278-342-----------------------------------------------------------------DFASF-----GSVDE
Q9PWR5_XENLA/903-967-----------------------------------------------------------------EGMPF-----RTIAE
SHAN2_RAT/1409-1472-----------------------------------------------------------------HLWTK-----PDVAD
Q9SFU7_ARATH/141-202-----------------------------------------------------------------SQQAD-----SSVDS
Q9U8V8_BRABE/270-334-----------------------------------------------------------------SSDLY-----SSVPE
Q9U8V9_EPTBU/276-340-----------------------------------------------------------------DNPAV-----RTVPE
Q9U8W0_EPTBU/277-341-----------------------------------------------------------------EYTTF-----YSVAE
SCML2_HUMAN/629-695-----------------------------------------------------------------STWSV-----DEVIQ
SMBT_DROME/1138-1201-----------------------------------------------------------------DTWNV-----YDVSQ
Q9VMJ4_DROME/41-102-----------------------------------------------------------------VHNSR-----MSISE
Q9VR43_DROME/77-140-----------------------------------------------------------------FEWDD-----MDIRR
Q9W6S2_DANRE/4-68-----------------------------------------------------------------ASWSI-----DEVIQ
SHAN1_RAT/2102-2165-----------------------------------------------------------------GFWTK-----FDVAD
Q9XZL6_DROME/968-1032-----------------------------------------------------------------GQNIF-----ISTDL
Q9Y1Y3_9METZ/818-882-----------------------------------------------------------------TPLDY-----QSIEA
S23IP_HUMAN/642-703-----------------------------------------------------------------ENKEV-----LTLQE

PF07647

EPHB4_MOUSE/904-969----------------------------------------------------------------PHYSAF-----GSVGE
EPHA4_MOUSE/908-973----------------------------------------------------------------PEFSAV-----VSVGD
EPHA5_MOUSE/801-866----------------------------------------------------------------LGSGAY-----RSVGE
LCP2_MOUSE/12-76----------------------------------------------------------------VLAWNS-----DNLAD
ASZ1_MOUSE/271-334----------------------------------------------------------------SPYTAF-----GDLEI
RHG07_HUMAN/451-513----------------------------------------------------------------IEAKEA-----...CD
EPHB6_MOUSE/938-1003----------------------------------------------------------------LDFPCL-----DSPQA
TNKS1_HUMAN/1024-1087----------------------------------------------------------------VAGLDM-----.NISQ
SPLA_DICDI/1731-1796----------------------------------------------------------------FKNWAP-----NDVAI
STE11_YEAST/17-82----------------------------------------------------------------EKTNDL-----PFVQL
SMAG1_MACFA/320-381----------------------------------------------------------------EEGSGM-----KDVPA
LIPB2_MOUSE/721-791----------------------------------------------------------------VVQWSN-----HRVME
EPHA7_HUMAN/920-985----------------------------------------------------------------PDFTTF-----CSVGE
Q9W263_DROME/754-824----------------------------------------------------------------PIVWTN-----QRFIR
SARM1_DROME/757-824----------------------------------------------------------------YSSKDT-----AKMHQ
LIPB_CAEEL/774-844----------------------------------------------------------------VVRWTH-----SATCE
DGKD_HUMAN/1142-1206----------------------------------------------------------------VHLWGT-----EEVAA
SARM1_HUMAN/479-546----------------------------------------------------------------YSTCDR-----SNLAD
EPHA3_DANRE/907-972----------------------------------------------------------------TPEAAV-----NTVED
NEB1_RAT/986-1050----------------------------------------------------------------VHEWSV-----QQVSH
POB1_SCHPO/247-311----------------------------------------------------------------VPNWST-----EEVVE
BYR2_SCHPO/1-65----------------------------------------------------------------MEYYTS-----KEVAE
EPHA3_MOUSE/908-973----------------------------------------------------------------VDIATF-----HTTGD
STE4_SCHPO/8-71----------------------------------------------------------------YWNWNN-----EAVCN
BOB1_YEAST/225-290----------------------------------------------------------------AKSWSP-----EEVTD
PHP_DROME/1510-1575----------------------------------------------------------------ISSWSV-----DDVSN
BOI2_YEAST/263-328----------------------------------------------------------------AEFWSP-----EEITA
STIM_DROME/210-279----------------------------------------------------------------VHNWTI-----EQTTD
EPHB5_CHICK/926-991----------------------------------------------------------------PDFPSL-----SNAHE
VTS1_YEAST/448-510----------------------------------------------------------------TDPKLL-----KNIPM
SAMH1_MOUSE/43-109----------------------------------------------------------------LRTWEP-----EDVCS
Q8T2V8_TRYCR/325-389----------------------------------------------------------------TVVAPT-----DPLTT
Q8X0U9_NEUCS/219-286----------------------------------------------------------------VESWSA-----DQVAE
EPHB2_COTJA/911-976----------------------------------------------------------------PDYTSF-----NTVDE
EPB1A_XENLA/909-974----------------------------------------------------------------PDISAF-----TSVDD
EPA4B_XENLA/907-972----------------------------------------------------------------PEWSQV-----ASVLD
EPHB3_XENLA/898-963----------------------------------------------------------------PDYTTF-----PTVSD
Q95YL0_CIOSA/925-990----------------------------------------------------------------PEMLDL-----SSLGQ
SAM10_HUMAN/115-182----------------------------------------------------------------VVLWSQ-----QDVCK
Q9DG07_CHICK/12-76----------------------------------------------------------------VITWNP-----DDLAE
TNKS2_HUMAN/871-934----------------------------------------------------------------VPGVDF-----.SITQ
SAMN1_HUMAN/238-303----------------------------------------------------------------SNSKKS-----KTLQE
STIM2_HUMAN/133-202----------------------------------------------------------------VHNWTL-----EDTLQ
Q9SF10_ARATH/452-517----------------------------------------------------------------KKVEKA-----GGLNE
P63_HUMAN/541-605----------------------------------------------------------------PPYPTD-----CSIVS
Q9VM93_DROME/1115-1185----------------------------------------------------------------VLVWSN-----ERVIR
Q9VU88_DROME/530-600----------------------------------------------------------------VELWTA-----HRIMG
Q9VUI0_DROME/173-237----------------------------------------------------------------EHPTLS-----PRVKS
P73_CHLAE/485-549----------------------------------------------------------------PPYHAD-----PSLVS

PF09235

Q6CUY2_KLULA/2-76--------------------------------------------------------------SGTNEWST-----EEVCK
Q6FX88_CANGA/16-90--------------------------------------------------------------DNFDKWTT-----DEVVQ
STE50_YEAST/30-104--------------------------------------------------------------EDFSQWSV-----DDVIT

PF13543

Q7PXM5_ANOGA/57-187LDVIQSMIDISADRLEGLRTQCAT.SAELTQQEIRTLETKLVKLFSDLLITKSKLPERLP...AQGLPAT....GNELKQ
A8PE62_BRUMA/19-136..QSLHAIDIIGRKLIIGRSTCRNPGSELIL...IQLEAKLIRHASQVCYLNQRYRGT..........KY.....PSLNE
B4JHV4_DROGR/35-171LIIIQDMIDLSANHLDDLRTQCAT.SATLTQQQIRGLESKLVRYFSELLLTKSRLNERIP...ANGLLPHHQATGNELRQ
B4PVA7_DROYA/33-166LVIIQDMIELSANHLEGLRTQCAI.SSTLTQQEIRCLESKLVRYFSELLLAKMRLNERIP...ANGLVPHA..TGNELRQ
D3Z852_RAT/41-168CGQLQKLIDISIGSLRGLRTKCSV.SNDLTQQEIRTLEAKLVRYICKQRQSKLSVTPSDR...TAELNSY.....PRFSD
B3S691_TRIAD/17-148LGDLQILIDTTVTQLIRTRAQCDV.TFDFIQQQLRALEGKVIKYISQQLLEIANGIPPNSPSIADKFYQY.....PKLNQ
A8E5P2_DANRE/44-171CELIQRLIEISISSLKGLRTKCAA.SNDLTQHEIRALEEKLVKYISKQLDWKRSVAERDR...PLALDSY.....PNLTD
B4NB95_DROWI/21-157LDIIQDMIDLSANHLEGLRTQCAT.SSMLTQQEIRCLESKLVRFFSELLITKSRLNERIP...ANGLLPHHDATGNELRQ
B7P9M2_IXOSC/21-149CVTAQAMIDINSEHLDGLRTQCAT.SVELTQNEIRALETKLIKLFSRQVVAKKKYAGTEN...ANELQHY.....PKLVL
C3ZV30_BRAFL/17-145CKTLQSMIDISASNLNGLRTMCET.SHDLTQTEIRTLEGKLVKLFSKQLQAKNKVPEDQR...TSELQRY.....PSVKQ

PF02198

ELF3_HUMAN/48-132-------------------------------------------QMSLEGTEKASWLGE.....QPQFWSK-----TQVLD
ELG_DROME/186-269-------------------------------------------DSKFKREQIRLKIPE.....AANEWTH-----AHVTY
O96416_DROVI/31-117-------------------------------------------PPSSQLAELKTQLPPSL.PSDPRLWSR-----DDVLD
ETS1_RAT/53-136-------------------------------------------FSGFTKEQQRLGIPK.....DPRQWTE-----THVRD
ETV6_HUMAN/38-124-------------------------------------------PRALRMEEDSIRLPAHL.RLQPIYWSR-----DDVAQ
PNT2_DROME/166-250-------------------------------------------FASWEKEVQKCNITK.....DPREWTE-----EHVIY
Q26645_STRPU/122-205-------------------------------------------FSSFKKEQERLGIPK.....DPSRWSE-----CQVVA
SPDEF_HUMAN/131-213-------------------------------------------LKDIETACKLLNITA.....DPMDWSP-----SNVQK
ETS2A_XENLA/87-170-------------------------------------------FNGFAKKRFRLGILS.....NPWLWDE-----NNVFQ
EHF_MOUSE/31-115-------------------------------------------CNVSSGFFGSQWHEI.....HPQYWTK-----YQVWE
ETS2_CHICK/90-173-------------------------------------------FSGFTKEQCRLGIPN.....NPWLWTE-----QHVCQ
ELF5_HUMAN/45-129-------------------------------------------AFEHQTACDSYWTSV.....HPEYWTK-----RHVWE
O76931_DROME/1278-1367-------------------------------------------LPNYRLWQLNSAFKLDDVRTNPLHWTS-----WDVCE
FLI1_HUMAN/114-198-------------------------------------------PPNMTTNERRVIVPA.....DPTLWTQ-----EHVRQ
GABPA_HUMAN/170-251-------------------------------------------LEGYRKEQERLGIPY.....DPIQWST-----DQVLH

PF00536

EPHA8_MOUSE/927-991WLDS...I.RM--....GRYRDHFAAGGYSSLGMV--LRMNAQD..V---RA.---LGITLMGHQKKILGSIQTMR----
LIPA2_HUMAN/1018-1082WLPS...L.GL--....PQYRSYF.MECLVDARML--DHLTKKD..L---RVH---LKMVDSFHRTSLQYGIMCLK----
EPHA6_MOUSE/958-1022WLDS...I.KM--....GQYKSNFMAAGFTTFDLI--SRMSIDD..I---RR.---IGVILIGHQRRIVSSIQTLR----
ANS1B_HUMAN/808-874WLES...I.GL--....PQYENHLMANGFDNVQFM--GSNVMEDQDL---LE.---IGILNSGHRQRILQAIQLLP----
ANS1B_HUMAN/882-947WLDS...I.EL--....GDYTKAFLINGYTSMDLL--KKIWEVE..L---INV---LKINLIGHRKRILASLGDRL----
EPHA1_HUMAN/911-975WLES...I.RM--....KRYILHFHSAGLDTMECV--LELTAED..L---TQ.---MGITLPGHQKRILCSIQGFK----
CSKI2_HUMAN/487-550WLSE...F.QL--....EGYTAHFLQAGY.DVPTI--SRMTPED..L---TA.---IGVTKPGHRKKIASEIAQLS----
CSKI2_HUMAN/557-620WLCA...L.GL--....PQYHKQLVSSGYDSMGLV--ADLTWEE..L---QE.---IGVNKLGHQKKLMLGVKRLA----
EPHA2_HUMAN/902-966WLES...I.KM--....QQYTEHFMAAGYTAIEKV--VQMTNDD..I---KR.---IGVRLPGHQKRIAYSLLGLK----
SPKA_DICDI/238-301WLQK...H.GF--....EQYKDAF.LKEEMFLDEL--GEMSEDI..L---NK.---MGITSTGTRLRILKETSNLA----
Q9U2L2_CAEEL/244-306LLEE...M.DL--....SRYIDQF.KHENVDLEVF--FELKEQD..F---VD.---MNIAY.GPKKRMLDVIERYK----
SCML1_HUMAN/256-322FLKQTDPL.AL--....CPLVDLF.RSHEIDGKAL--LLLTSDV..L---LKH---LGVKL.GTAVKLCYYIDRLK----
SMAG1_HUMAN/327-381WLKS...L.RL--....HKYAALF...SQMTYEEM--MALTECQ..L---EA.---QNVTK.GARHKIVISIQKLK----
Q9VD37_DROME/3-64WLRT...I.GL--....AHYGESFLENGYDELEIC--KQIGEID..L---DA.---IGVDNPSHRGKLLKSVRMLR----
LIPB2_MOUSE/562-626WMED...F.GL--....GQYVIFA.RQWVTSGHTL--LTATPQD..M---EKE---LGIKHPLHRKKLVLAVKAIN----
LIPB2_MOUSE/637-697WLDD...I.GL--....PQYKDQF.HESRVDGRML--QYLTVND..L---LF.---LKVTSQLHHLSIKCAIHVLH----
Q9W263_DROME/667-731WLPD...I.GL--....PQYAEPF.VQSLVDARML--DTLSKKE..L---EKF---LGVTRKFHQASIVHGIHVLR----
ANS1A_HUMAN/697-760WLES...I.GL--....QQYESKLLLNGFDDVHFL--GSNVMEEQDL---RD.---IGISDPQHRRKLLQAARSLP----
ANS1A_HUMAN/768-832WLDS...L.GL--....QDYVHSFLSSGYSSIDTV--KNLWELE..L---VNV---LKVQLLGHRKRIIASLAD.R----
PHC2_MOUSE/784-848FIRS...LPGC--....QEIAEEF.RAQEIDGQAL--LLLKEDH..L---MSA---MNIKL.GPALKIYARISMLK----
LIPB_CAEEL/612-676WIAE...I.GY--....PQYMNEV.SRHVRSGRHF--LNMSMNE..Y---EGV---LNIKNPVHRKRVAILLRRIE----
SARM1_CAEEL/612-676WVKK...I.GF--....EEYVEKF.AKQMVDGDLL--LQLTEND..L---KHD---VGMISGLHRKRFLRELQTLK----
SCMH1_HUMAN/591-656FVRE...A.DP--Q..LGPHADLF.RKHEIDGKAL--LLLRSDM..M---MK.---YMGLKLGPALKLSYHIDRLK----
CNKR2_HUMAN/9-73WMK......GL--DDCLQQYIKNF.EREKISGDQL--LRITHQE..L---ED.---LGVSRIGHQELILEAV.DLL----
EPHA7_CHICK/916-980WLQA...I.KM--....ERYKDNFTAAGYNSLESV--ARMTIED..V---MS.---LGITLVGHQKKIMSSIQTMR----
O57458_XENLA/740-804WLDA...I.KM--....AQYKESFANAGFTSFDVI--SQMCMED..I---LR.---VGVTLAGHQKKILNSLQVMR----
O62258_CAEEL/2-65GIPS...E.IA--....KKYAKSF.ATNRITKEML--PELDKST..L---SE.---LGVSAIGDQLCILRRIKAAK----
O64649_ARATH/237-300WLRS...L.GL--....AKYEDVF.IREEIDWDTL--QSLTEED..L---LS.---IGITSLGPRKKIVNALSGVR----
O73875_DANRE/912-976WLRA...I.KM--....ERYEETFLQAGYTSMQLV--THINTED..L---LR.---LGITLAGHQKKILSSIEALG----
O73876_DANRE/591-655WLES...I.KM--....AQYRETFALAGIKSIDQV--LRLKIED..I---GN.---IGVRLAGHQKRIAYSILGLQ----
O73878_DANRE/904-968WLRA...I.KM--....ERYEDAFMQAGFTAIQHI--THISTED..L---LR.---IGVTLAGHQKKILSSVQTLR----
EPHB2_CHICK/929-993WLDA...I.KM--....SQYKESFASAGFTTFDIV--SQMTVED..I---LR.---VGVTLAGHQKKILNSIQVMR----
EPHA3_CHICK/909-973WLNG...F.RT--....GQCKGIFTGVEYSSCDTI--AKISTDD..M---KK.---VGVTVVGPQKKIVSSIKTLE----
EPHB3_HUMAN/923-987WLDA...I.KM--....GRYKESFVSAGFASFDLV--AQMTAED..L---LR.---IGVTLAGHQKKILSSIQDMR----
EPHA5_CHICK/939-1003WLEA...I.KM--....GRYTEIFMENGYSSMDSV--AQVTLED..L---RR.---LGVTLVGHQKKIMNSLQEMK----
EPHB4_HUMAN/905-969WLRA...I.KM--....GRYEESFAAAGFGSFELV--SQISAED..L---LR.---IGVTLAGHQKKILASVQHMK----
Q09493_CAEEL/1046-1109WLSS...L.HL--....SEYTPAF.RSQRINGRCL--RQCDRSR..F---TQ.---LGVTRIAHRQIIESALRGLL----
Q18662_CAEEL/331-394WLDS...I.NM--....SNYLAVFLKQGY.DLQTI--ARCTPAD..L---LS.---LGIKNPDHRKKLMSDIHSWK----
Q18662_CAEEL/401-465WLHA...I.AL--....AEYIPMFESQRYTSVSDV--LDLQWED..F---ED.---IGVKRLGHLKRFGLTIKKLK----
SMSR1_CAEEL/12-78WLKK...I.GM--....AKYADLIAMKHKVDGKCL--LALTDTDLKD---PP.---VSINCLGDIKKILFAIEFLS----
SMG_DROME/594-654WLKS...L.RL--....HKYIELF..KNM.TYEEM--LLITEDF..L---QS.---VGVTK.GASHKLALCIDKLK----
BICC_DROME/803-866LLTS...L.GL--....EHYIKIF.VLNEIDLEVF--TTLTEEN..L---ME.---LGIAAFGARKKLLTAIHTLL----
Q27937_LOLFO/455-515WLTK...L.GL--....QAYIDNFQQKGLHNMFQL--DEFTLED..L---QS.---MRIGT.GHRNKIWKSLLDYR----
LIPB1_HUMAN/645-709WLME...Q.GL--....GSYLNSG.KHWIASGQTL--LQASQQD..L---EKE---LGIKHSLHRKKLQLALQALG----
LIPB1_HUMAN/720-780WLDD...I.GL--....PQYKTQF.DEGRVDGRML--HYMTVDD..L---LS.---LKVVSVLHHLSIKRAIQVLR----
Q91734_XENLA/246-310WLHA...I.KM--....GRYEDGFRNAGFTTFSRV--QNISTED..L---LR.---MGVTLAGHQKKILSSLQQIL----
Q93203_CAEEL/904-967WLNF...I.GL--....QDYISNFVGAGYKHMAKL--TEIDWDTARL---MQ.---LGVTRPGHIARMLHS...FK----
SHAN3_RAT/1750-1813WLES...I.HL--....GEHRDRF.EDHEIEGAHL--PALTKED..F---VE.---LGVTRVGHRMNIERALRQLD----
Q9PVV1_LAMRE/277-341WLDD...I.KM--....GRYKENFTNAGLVSWPAV--AQMTPED..L---QK.---VNVTLAGHQKRIMTSIQTLR----
Q9PVV2_LAMRE/278-342WLDA...I.KM--....GRYKDNFASAGFTSFDLV--SRMTAED..I---LR.---IGVTLAGHQKKILNSIQTMR----
Q9PWR5_XENLA/903-967WLDS...I.KM--....QQYTEFFMASPYNSMDKI--ILMNQED..I---KH.---LGIRQTGHQKRIAFSILGLK----
SHAN2_RAT/1409-1472WLES...L.NL--....GEHKETF.MDNEIDGSHL--PNLQKED..L---ID.---LGVTRVGHRMNIERALKQLL----
Q9SFU7_ARATH/141-202FLES...L.GL--....EKYSTAF.QVEEVDMDAL--MHMTDDD..L---KA.---M.LIPMGPRKKILLAL.GSK----
Q9U8V8_BRABE/270-334WLDS...L.SL--....GRYTENFLKAGFTNLDCV--AKITLRE..L---QS.---IGVTMIGHQKKIMNSVQMLR----
Q9U8V9_EPTBU/276-340WLEA...I.KM--....GRYADNFAAAGYTTLDSV--AQLDADG..L---VR.---IGITLIGHQKKILSNIQTMK----
Q9U8W0_EPTBU/277-341WLEA...I.KM--....GEYKENFINAGYVSWSSV--AHMTLED..L---RR.---VGVTLAGHQKRIMTSIQALR----
SCML2_HUMAN/629-695FMKH...T.DP--Q.ISGPLADLF.RQHEIDGKAL--FLLKSDV..M---MK.---YMGLKLGPALKLCYYIEKLK----
SMBT_DROME/1138-1201FLRV...N.DC--....TAHCDTF.SRNKIDGKRL--LQLTKDD..I---MP.---LLGMKVGPALKISDLIAQLK----
Q9VMJ4_DROME/41-102WLDL...L.EL--....QQYEGNL..QEFSTVDDV--VDITDKE..L---KQ.---FGVRG.AHRQRMVNSLLGVR----
Q9VR43_DROME/77-140WING...Y.GY--....PQYMNTF.RVNMITGRKL--LLLDASA..L---CA.---MNIKNFDHIRHISYGIRMLF----
Q9W6S2_DANRE/4-68FIQ......GL--P.GCKEQVRTF.RDEQIDGEAF--LLLTQVD..L---VK.---ILSIKLGPALKIYNSILMFK----
SHAN1_RAT/2102-2165WLEW...L.GL--....SEHRAQF.LDHEIDGSHL--PALTKED..Y---VD.---LGVTRVGHRMNIDRALKFFL----
Q9XZL6_DROME/968-1032WLEH...I.KM--....SRYCHHFKEANLINAQQI--SRLTAQQ..L---SD.---MGITLVGHQKKILHQARQLD----
Q9Y1Y3_9METZ/818-882WLEA...I.KM--....DRYVQNFHSQGLKSIQDV--LLLAEED..L---RG.---MGVAIPGHVNKIMSSVRGAH----
S23IP_HUMAN/642-703TLEA...L.SL--....SEYFSTF.EKEKIDMESL--LMCTVDD..L---KE.---MGI.PLGPRKKIANFVEH.K----

PF07647

EPHB4_MOUSE/904-969WLR.---..AI..KM..GRYEESFAAAGFGSFEVV..SQISAED--L...L.R---IGVTLAGHQKKILASVQHMK----
EPHA4_MOUSE/908-973WLQ.---..AI..KM..DRYKDNFTAAGYTTLEAV..VHMSQDD--L...A.R---IGITAITHQNKILSSVQAMR----
EPHA5_MOUSE/801-866WLE.---..AI..KM..GRYTEIFMENGYSSMDAV..AQVTLED--L...R.R---LGVTLVGHQKKIMSSLQEMK----
LCP2_MOUSE/12-76YFR.---..KL..NY..RDCEKAVKKYHIDG.ARF..LNLTEND--I...Q.K---FPKLRMPLLSKLSQDINKNE----
ASZ1_MOUSE/271-334FLH.---..GL..GL..EHMTDSLKEKDITL.RHL..LTMKKDE--L...T.K---NGIASKDQ.QKILAALKELE----
RHG07_HUMAN/451-513WLR.---..AT..GF..PQYAQLYEDFLFPIDISL..VKREHDF--L...D.R---DAIEALCRRLNTLNKCAVMK----
EPHB6_MOUSE/938-1003WLS.---..AI..GL..ECYQDNFSKFGLSTFSDV..AQLSLED--L...P.G---LGITLAGHQKKLLHNIQLLQ----
TNKS1_HUMAN/1024-1087FLK.---..SL..GL..EHLRDIFETEQITL.DVL..ADMGHEE--L...K.E---IGINAYGHRHKLIKGVERLL----
SPLA_DICDI/1731-1796WLE.---..SF..NY..GQYRKNFRDNNISG.RHL..EGITHAM--L...KND---LGIEPYGHREDIINRLNRMI----
STE11_YEAST/17-82FLE.---..EI..GC..TQYLDSFIQCNLVTEEEI..KYLDKDI--L...I.A---LGVNKIGDRLKILRKSKSFQ----
SMAG1_MACFA/320-381WLK.---..SL..RL..HKYAALFSQMTYEE...M..MALTECQ--L...E.A---QNV.TKGARHKIVISIQKLK----
LIPB2_MOUSE/721-791WLR.---..SV..DL..AEYAPNLRGSGVHGGLIILEPRFTGDT--LAML.LN---IPPQKTLLRRHLTTKFNALI----
EPHA7_HUMAN/920-985WLQ.---..AI..KM..ERYKDNFTAAGYNSLESV..ARMTIED--V..M..S---LGITLVGHQKKIMSSIQTMR----
Q9W263_DROME/754-824WVR.---..SI..DL..GEYADNLKDSGVHGGLVVLEPSFSGDT--MATA.LG---IPPSKNIIRRHLNTEFDALI----
SARM1_DROME/757-824FLS.---..EIGTDY..CTYTYAMLNAGIDK.CAL..PHVNEDM--L...MTE---CGIHNSIHRLRILNAVKNLE----
LIPB_CAEEL/774-844WLR.---..KI..DL..AEFTQNLLFAGVPGALMIYEPSFTAES--LA.EILQ---MPPHKTLLRRHLTSHFNQLL----
DGKD_HUMAN/1142-1206WLE.---..HL..SL..CEYKDIFTRHDIRG.SEL..LHLERRD--L...K.D---LGVTKVGHMKRILCGIKELS----
SARM1_HUMAN/479-546WLG.---..SLDPRF..RQYTYGLVSCGLDR.SLL..HRVSEQQ--L...LED---CGIHLGVHRARILTAAREML----
EPHA3_DANRE/907-972WLD.---..LI..KM..GQYKEHFSSAGYVTLDSV..LYVSSSE--L...D.K---MGVELAGHQKKILSSIQCLQ----
NEB1_RAT/986-1050WLV.---..GL..SL..DQYVSEFSAQNISG.EQL..LQLDGNK--L...K.A---LGMTSSQDRALVKKKLKEMK----
POB1_SCHPO/247-311WLM.---..NA..GL..GSVAPNFAENEITG.EIL..LGLDSNV--L...K.E---LNITSFGKRFEVLRKIQQLK----
BYR2_SCHPO/1-65WLK.---..SI..GL..EKYIEQFSQNNIEG.RHL..NHLTLPL--L...K.D---LGIENTAKGKQFLKQRDYLR----
EPHA3_MOUSE/908-973WLN.---..GM..RT..AHCKEIFTGVEYSSCDTI..AKISTDD--M...K.K---VGVTVVGPQKKIISTIKALE----
STE4_SCHPO/8-71WIE.---..QL..GF...PHKEAFEDYHILG.KDI..DLLSSND--L...R.D---MGIESVGHRIDILSAIQSMK----
BOB1_YEAST/225-290YFS.---..LV..GF.DQSTCNKFKEHQVSG.KIL..LELELEH--L...K.E---LEINSFGIRFQIFKEIRNIK----
PHP_DROME/1510-1575FIR.---..EL..PG.CQDYVDDFIQQEIDG.QAL..LLLKEKH--L...VNA---MGM.KLGPALKIVAKVESIK----
BOI2_YEAST/263-328YFI.---..ME..GY.DVQSASRFQKHKISG.KIL..LELELVH--L...K.E---LDINSFGTRFEIFKEIEKIK----
STIM_DROME/210-279WLA.---.QSV..QL..PQYVDLFKLHKVTGAALPRLAVNNLQY--V...GNV---LGIKDPIHKQKISLKAMDVV----
EPHB5_CHICK/926-991WLD.---..AI..KM..GRYKENFDQAGLITFDVI..SRMTLED--L...Q.R---IGITLVGHQKKILNSIQLMK----
VTS1_YEAST/448-510WLK.---..SL..RL..HKYSDALSGTPWIE...L..IYLDDET--L...E.K---KGVLALGARRKLLKAFGIVI----
SAMH1_MOUSE/43-109FLE.---..NR..GFREKKVLDIFRDNKIAG.SFL..PFLDEDR--L...E.D---LGVSSLEERKKMIECIQQLS----
Q8T2V8_TRYCR/325-389LLH.---..KI..GL..PEYAPKLLSQHVDL.DVL..QCMDVSD--L...M.T---FGVSNKSHCQMILDAALRSD----
Q8X0U9_NEUCS/219-286YLF.---..TV..GV.EKHHCEVFRDQEITG.EVI..LGMDQTS--LF.IK.A---FDLGSVGRRLKTWQKIKNLQ----
EPHB2_COTJA/911-976WLD.---..AI..KM..SQYKESYASAGFTTFDIV..SQMTVED--I...L.R---VGVTLAGHQKKILNSIQVMR----
EPB1A_XENLA/909-974WLS.---..AI..KM..GQYRDNFLSSGFTSLQLV..AQMTSED--L...L.R---IGITLAGHQKKILNSIQSMR----
EPA4B_XENLA/907-972WLQ.---..AS..KW..KRYKDNFTAAGYTSLEAV..VHVNQDD--L...T.R---IGISSPSHQNKILSSVQGMR----
EPHB3_XENLA/898-963WLE.---..AI..KM..GQYQENFLSAGFTSFHLV..AQMTAED--L...L.R---IGVTLAGHQKKLLNSVQDMR----
Q95YL0_CIOSA/925-990WLD.---..QM..NM..LKYKPMMMRHGCVTAEQI..MRLNPSE--L...T.H---MGFIDTNDVNTVLRQADLLR----
SAM10_HUMAN/115-182WLKK---HCPH..NY..LVYVEAFSQHAITG.RAL..LRLNAEK--L...Q.R---MGLAQEAQRQEVLQQVLRLQ----
Q9DG07_CHICK/12-76YFK.---..TL..KY..KDC.EKVVRKHSINGQRF..LNMSEND--I...Q.K---FPKLRVPIVSKLSQEINRNE----
TNKS2_HUMAN/871-934FVR.---..NL..GL..EHLMDIFEREQITLDVLV...EMGHKE--L...K.E---IGINAYGHRHKLIKGVERLI----
SAMN1_HUMAN/238-303FLE.---..RI..HL..QEYTSTLLLNGYETLEDL..KDIKESH--L...I.E---LNIENPDDRRRLLSAAENFL----
STIM2_HUMAN/133-202WLI.---.EFV..EL..PQYEKNFRDNNVKGTTLPRIAVHEPSF--M...ISQ---LKISDRSHRQKLQLKALDVV----
Q9SF10_ARATH/452-517WVG.---..SI..GL.GREFERMLRGQRMSK.FQM..ANLTMEK--L...K.Q---MGALAVGPRRKLIHAIGCVY----
P63_HUMAN/541-605FLA.---..RL..GC..SSCLDYFTTQGLTTIYQI..EHYSMDD--L...A.S---LKIPEQFR.HAIWKGILDHR----
Q9VM93_DROME/1115-1185WVG.---..SI..GL..KEYANNLLESGVHGGLMALDEGFDANA--MG.LALQ---IPTQNAQARQILDTEFNNLL----
Q9VU88_DROME/530-600WLQ.---..TI..DL..SEYTPNLRGAGVHGALMLYEPRFNADL--LA.DLLS---IPPSKSLLRRHLAMHFKELV----
Q9VUI0_DROME/173-237LLD.---..RT..GN..AHLTELFTRQEIDIEVLI...QMTLED--L...A.A---LGVRGAREIRLAMNIIQLAK----
P73_CHLAE/485-549FLT.---..GL..GC..PNCIEYFTSQGLQSIYHL..QNLTIED--L...G.A---LKIPEQYR.MTIWRGLQDLK----

PF09235

Q6CUY2_KLULA/2-76KVKAELGLTDG------DTFILDRIRENKITGSTL--SEITLAD------CKE---LCPDSIS.AVRLKTCINKFVDTEE
Q6FX88_CANGA/16-90WCGTVLGKDEQ------EPLFTR.IRDNNIDGSVL--QELTLQD------CKE---LTDNDLKEAIKLKLWLNKLIDSQL
STE50_YEAST/30-104WCISTLEVEET------DPLCQR.LRENDIVGDLL--PELCLQD------CQD---LCDGDLNKAIKFKILINKMRDSKL

PF13543

Q7PXM5_ANOGA/57-187WLR----VVGL------SCASLNAVIQQVSTLEGL--LEKDEKE--LRTIMGN..NVYVR.EEEMKRLTRACGNLR----
A8PE62_BRUMA/19-136WLT----YVNL------LPTEIVAILKCLQTFCVL--ITMNDKE--LLDICEK...LRFT.SDGRRRLRKSSYSLR----
B4JHV4_DROGR/35-171WLR----VVGL------SQESLNVCLGRLKTLEQT--LQLSDDE--LKQLLAHNTSSS.QLDEELRRLTKAMHNLR----
B4PVA7_DROYA/33-166WLR----VVGL------SQETLTACLARLNTLEQS--LRLSDDE--IRQILAGS.PSQRE.EEELRRLTRAMQNLR----
D3Z852_RAT/41-168WLY----IFNV------RPEVVQEI.PQELTLDAL--LEMDEAK--AKEMLRR...WGAS.AEECSRLQQALTCLR----
B3S691_TRIAD/17-148WLE----VVGM------ESSTAKAICGLQLPLSTM--LNMQEED--MRQMLND...VQCN.EGDSCRFIAAMKNLR----
A8E5P2_DANRE/44-171WLY----TINL------RPEIIEAV.PVKLSLDAL--LQMSSGQ--VEENMKR...LGSS.SEECSRITAALSCLK----
B4NB95_DROWI/21-157WLR----VVGL------GQETLNIILSKVKSLEET--LKMSDEE--LKDILIEHSENQHR.EEEMRRLTRAMQNLR----
B7P9M2_IXOSC/21-149WLK----VVGL------SAKSIEGLSNKLTTFDDM--LEKPEQE--VKGFLSA...VNAR.EEEKRRFLIAMRNLK----
C3ZV30_BRAFL/17-145WLE----VVDI------QPVAIRGIENKKISLEDL--LKMTKVE--IVSLMSY...YGAE.EGETIRLLSAVNHLR----

PF02198

ELF3_HUMAN/48-132WISYQVEKNKY------DASAIDFSRC.DMDGATL--CNCALEE--LRLVFG...PLGDQLHAQLRDLTSSS--------
ELG_DROME/186-269WLEWAVKQ..F------ELVGINMSDW.QMNGQEL--CAMTHEE--FNQKLPR..DPGNIFWTHLQLLKECN--------
O96416_DROVI/31-117FLRFCVRE..F------DLPKLDFDLF.QMNGKAL--CLLTRAD--FGHRCP...GAGDVLHNVLQMLIIES--------
ETS1_RAT/53-136WVMWAVNE..F------SLKGVDFQKF.CMNGAAL--CALGKEC--FLELAPD..FVGDILWEHLEILQKED--------
ETV6_HUMAN/38-124WLKWAENE..F------SLRPIDSNTF.EMNGKAL--LLLTKED--FRYRSP...HSGDVLYELLQHILKQR--------
PNT2_DROME/166-250WLNWAKNE..F------SLVSMNLDPFYKMKGRAM--VDLGKEK--FLAITPP..FTGDILWEHLDILQKDC--------
Q26645_STRPU/122-205WVHWSIKE..F------SLEGVSINNF.RISGRDL--CTLPKTD--FLSRAPP..FMGDILWEHIDMLRKEC--------
SPDEF_HUMAN/131-213WLLWTEHQ..Y------RLPPMGKAFQ.ELAGKEL--CAMSEEQ--FRQRSP...LGGDVLHAHLDIWKSAA--------
ETS2A_XENLA/87-170WLWWAAKE..F------SLQNVNFQKF.LMNGHEL--CSLGKER--FLALAPD..FVGDILWEHLEEMMKEH--------
EHF_MOUSE/31-115WLQHLLDTNQL------DASCIPFQEF.DISGEHL--CSMSLQE--FTRAAG...SAGQLLYSNLQHLKWNG--------
ETS2_CHICK/90-173WLAWATNE..F------SLANVNIHQF.LMSGQDL--CNLGKER--FLELAPD..YVGDILWEHLEQMIKDS--------
ELF5_HUMAN/45-129WLQFCCDQYKL------DTNCISFCNF.NISGLQL--CSMTQEE--FVEAAG...LCGEYLYFILQNIRTQG--------
O76931_DROME/1278-1367YIERALDS..T------DIAKVIFEQ..DIDGRAL--LMLGRKE--LDTYLKLKVGPAVKLYSLILNLRIAV--------
FLI1_HUMAN/114-198WLEWAIKE..Y------SLMEIDTSFFQNMDGKEL--CKMNKED--FLRATTL..YNTEVLLSHLSYLRESS--------
GABPA_HUMAN/170-251WVVWVMKE..F------SMTDIDLTTL.NISGREL--CSLNQED--FFQRVP....RGEILWSHLELLRKYV--------

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window