Sequence alignment for CL0009

PF01417

EPN2_ARATH/23-146---VPGVEQKVLDATSNE.PW.GP..HGSLLADLAQASRN--Y----.HEYQLIMVVIWKR...................
Q4WHZ5_ASPFU/32-156---YTEMESKVREATNNE.PW.GA..STTLMQEIANGTHS--Y----.QLLNEIMPMIYKR...................
A5DG42_PICGU/26-162---NSSTELQVKSATSSD.PL.GP..YNNDLVQLSMLTYN--S----.KSLSIIESVLEKQLRKYSPS............
Q4S9J6_TETNG/17-136---YSDAEKKVREATSND.PW.GP..SSSLMSEIADLH..--.----..PTTEIMSMIWKRL..................
A5DUV4_LODEL/15-139---YSSAQVLVRNATSND.PT.GP..TKYDMEEIASYSYQ--S----QTEFMEIMDMLDRRL..................
A7RIC8_NEMVE/21-145---YSEVEAKVREATNDD.TW.GP..HGSLMQEIAKYTFT--Y----.EHFPEVMSMLWKRM..................
Q75CI0_ASHGO/12-141---SSPTAAKVRKATDDN.EFVGA..SSALISEITILTYS--C----.KTLLDVTRVLKKRLS.................
A1CU98_ASPCL/15-139---YSSVQVKVRNATSND.PW.GP..TGTEMAEIAGMTFS--S----PTDFYEIMDMLDKRL..................
Q5K8L7_CRYNJ/33-157---ISEMEAKVREATNDD.PW.GA..SSTLMQQIAEGTHN--F----.AQFNEIMPTIYSRF..................
A3ACG9_ORYSJ/23-146---VPGIEQKILDATSNE.PW.GP..HGSLLAEIAQATQN--Y----.HEYQMVMNVVWKRI..................
A7TGV0_VANPO/16-139---YSSTQVMVRNATSND.SG.GP..DIDTLDALAEKTYD--S----.VEFFEIMDMLDKRL..................
A3BVW2_ORYSJ/29-156---VTPAELLVQEATNND.GGVGP..DARTLASIADAAFD--M----.DDYWRIAGVLRRRM..................
Q16IC4_AEDAE/7-131---YTEIEGKVREATNDE.PW.GP..TGPLMQELAHATFT--Y----.EHFPEVMSMLWKRM..................
Q6CWF2_KLULA/29-153---YTEMEAKVREATNNE.PW.GA..SSTLMEHIAQGTYN--Y----.REREEILGMIFRRF..................
Q6FV92_CANGA/12-141---LSPTELKVRQATDDN.ELAGA..TGTLMNEISVLTYS--K----.KTLKDVIQVIRKRLS.................
Q4N8B4_THEPA/21-143---SGELDKCLREALFSD.SV.GC..SDSILYDISQATYH--E----.VFFQKIMKSTWKCI..................
A7TRZ4_VANPO/12-141---QSATEAKVKEATDDN.ETSGA..TGTLMNEISVLTYS--P----.KTLKEIIQVLKKRLT.................
Q5ADS1_CANAL/11-188---TSSTESKIKSATNNE.PL.GP..YNHELTELASLTFS--K----.KHLSIIISIITKRLKPVLDICPTTMNSTGMKR
Q2U6I6_ASPOR/32-147---YTEMEAKNYTYMHAE..W.LS..TAV........AYD--H----.QLLNEIMPMIYRRF..................
A6ZXG7_YEAS7/16-139---YSSTQVLVRNATSND.NH.QV..SKDSLIELAEKSYD--S----.ADFFEIMDMLDKRL..................
Q7KU93_DROME/19-141---YSDAQVKVREATSND.PW.GP..SAAIMSEIAELTYN--V----.VAFSEIMQMIWKRL..................
Q9LW61_ARATH/32-158---VTEAELLVEEVTNGD.PS.SP..DAKTMTKIAEASFD--T----.VEYWRIVDVLHRKIG.................
Q010W1_OSTTA/31-153---VSDDEALVREATNAD.PW.GP..HGEQLRAIARLTLD--.----.GRWDVVWDVLRERM..................
Q9BI72_CAEEL/17-139---FSDAQVKVREATSND.PW.GP..STALMSEIADLTHN--P----.MAFTEIMSIVWKRL..................
Q3UGL3_MOUSE/21-145---YSEIESKVREATNDD.PW.GP..SGQLMGEIAKATFM--Y----.EQFPELMNMLWSRM..................
Q6CSZ1_KLULA/16-140---YSQAQVLVRSATSND.KD.GP..SVDQLEELAERTFD--N----.VEFFEIMDMLDKRL..................
A4S350_OSTLU/31-152---IGDDEALVRDATNSE.PW.GP..HGEQLRAIARLTRD--.----.GKWDVVREVLEKRL..................
A6ZYB3_YEAS7/30-180---YEPYQIDIRRATNTD.AW.GP..TPKHLAKVLRNRYQ--.----.VPLYLMTEYTLKRLVDHIATRP..........
Q6CS48_KLULA/12-143---QSTTQLKVKQATDSN.ESYGA..TGTLMNELSVLTYS--E----.KSANEIYEVIRKRLMN................
Q4SE28_TETNG/17-140---YTEAEIKVREATSND.PW.GP..PSSLMAEISDLTFN--V----.VAFTEVMGMIWKRI..................
EPN_DICDI/19-141---TPEIERKVRDATSND.KW.GP..SGTQMQEISRASYN--Y----.ECFPIIMGVIWKRI..................
Q8LFS0_ARATH/43-167---VTPLQLMTEEATDGE.SC.GP..NTQTLGSISKAAFE--F----.EDYLAIVEVLHKRL..................
B1AT70_MOUSE/17-140---YSEAEIKVREATSND.PW.GP..PSSLMSEIADLTFN--T----.VAFAEVMGMVWRRL..................
Q5C2A9_SCHJA/33-157---YTDVELKVREATNDEICF..P..HGHLLQKLADYTYA--H----.ETCLEVMSNLLKRM..................
Q750B1_ASHGO/30-180---YEPYQVDVRRATNTD.SW.GP..TPKQMLKVMRHKNH--.----.VPMYLITEYTMKRLVDHMAKRP..........
A7A0M0_YEAS7/12-142---QSPTESKVKQATNED.ETSGA..TGTLMNEISILTYS--P----.KTVREIIQVIRKRLLL................
Q6CQJ4_KLULA/30-180---YEPYQIDIRRATNTD.SW.GP..TPKHLAKVMRHRYE--.----.VSMFLMTEYTLKRLVDHMAKRP..........
Q9FRR8_ARATH/35-159---VTAEELLTEEVTGSD.HS.SI..DSRSMAAITRVSFE--V----.DQFQRIVKILRQRM..................
PICA_CAEEL/34-157---GSQLGKTICKATTEE.VM.AP..KKKHLDYLLHCTNE--P----NVSIPSMANLLIER...................
Q4QA28_LEIMA/20-142---RSEYVQIVHDATNDE.KW.GP..TGPQMDAVCNA.YP--.----.RGGPEILNELRTRL..................
Q7SEF2_NEUCR/32-149---YTEMESKVC.......PY..P..RATLAPFSCALRHI--L----.DPRQETMERELTAN..................
ENTD1_HUMAN/14-137---YSDAEIKVREATSND.PW.GP..SSSLMLDISDLTFN--T----.ISLSEIMNMLWHRL..................
Q4E4P1_TRYCC/20-142---GNEFVVLVHEATNED.PW.GP..TGAQMDEVCRA.FA--.----.RGSFDIMEEIKLRL..................
ENT1_SCHPO/19-142---YTDTQIKVRNATTND.SW.GP..SGTAMAEIAELTYD--Q----.NEMLEVMDIIDRRL..................
Q5CW24_CRYPI/28-150---LTQLEKWLKEATSNT.NW.GC..SSTILNEIARSMTD--Y----.HDYVLVQKCIGDCL..................
Q6MFM0_NEUCS/15-151---YSAAQVKVRDATSND.PW.GP..TGTQMGQIAQMTYG--T----STEFYEIMDMLDKRL..................
P92917_AVEFA/25-148---VPELEQKVLDATSDE.PW.GP..HGSALSDVAQATKK--Y----.SECQMVMGVLWARL..................
YCTB_SCHPO/30-154---YTSMEARVREATNNE.PW.GA..STSLMMEIAQGTHN--Y----.SQLNEILPMIYRRF..................
Q6C7P2_YARLI/16-139---YTSAQVKVRNATSND.AW.GP..STFDLEEIARLTHS--N----.QELFEVMDMIDRRL..................
A0E2V0_PARTE/386-510---YTPEEQALKLFDQAY.HYDSSILPINLLDQIAELSFQ--M----.EHYPKIINQIVLQL..................
A3LUL4_PICST/30-154---LTEMEAKVREATNNE.PW.GA..PTTLMAQIAAGTYN--Y----.REREEIIGFIFRRF..................
Q387I4_TRYB2/20-142---GNEYARLVHEATNED.PW.GP..TGEQMDNVCRV.FQ--.----.AGTVKIMEEIKLRL..................
Q6C975_YARLI/30-154---FTPIEAKVREATNNE.PW.GA..SSTAMQEIADATHN--Y----.NEFHDIMSMIYRRF..................
A0CFU3_PARTE/19-141---KSPLEQTLSEATSNE.NW.NT..PTKLLQEVAEASYG--Y----.TSCDTIMKFIWKRL..................
Q5C631_SCHJA/22-144---YTDSERKVREATSND.PW.GP..SSTLMAEIADKTHN--V----.MAFTEIMQMIWRRL..................
Q54WR0_DICDI/15-139---VNSVLSIVGKATVDT.PEPTP...GYLFLDIQNETNK--S----FEKCMDILKKLQER...................
Q4T3Y5_TETNG/3-125---NSCFCWQVREATSND.PW.GP..SSSQMADISDLTYN--V----.VACNEIMTMLWKRL..................
ENT3_YEAST/29-153---YTEMEGKVREATNNE.PW.GA..SSTLMDQISQGTYN--F----.REREEILSMIFRRF..................
A4QMU9_HUMAN/36-156---ATHLQVSSHDDLRTP....AP..GEEHRAQLLRGR.N--Q----.VAFTEVMGMLWRRL..................
Q99PW9_RAT/40-159---DKTQAISISKAINSQ....EAPVKEKHARRIILGTHH--E----.KGAFTFWSYAIGL...................
Q7R6W4_PLAYO/24-155---SNQFEKNLKEALNNK.NY.GV..SNSLLYDLSISTYD--A----.TYYKRVISEVFKAI..................
A8BIK9_GIAIC/21-146---QSEEEYRVNQITSPKVSW.GP..SPEDMDDIVRYCEH--H----.SARTNVMKTIWSLL..................
Q5KGK6_CRYNJ/23-146---YTDTQTKVREATSND.PW.GP..SGTMMNEIAQLTYN--Q----.NDFVEVMEMLDKRL..................
A7TEM3_VANPO/30-180---YEPYQIDIRTATNTD.SW.GP..TSKHLQKVIRHKYH--.----.VPVYLMTEYILKRLIDHIASKP..........
Q6FYA1_CANGA/16-140---YSSTQVMVRDATAND.ST.SP..SVGVLEDLADKTYD--T----.VEFFEIMDMLDKRL..................
Q2HEQ3_CHAGB/32-156---FTEMEAKVREATNNE.PW.GA..SSTQMQEIADGTFN--Y----.QTLNEIMPMIYRRF..................
A2FJT4_TRIVA/21-144---KSEAEKLVYEATNDD.PW.GP..ANTQMQEIARISYN--Y----.NECENVKKALWDQM..................
A7TSS4_VANPO/30-180---YEPYQIDIRRATNTD.AW.GP..TTKHLQKVIRNKYS--.----.VPLYLMTEYVLKRIVDHLAKRP..........
Q75CS6_ASHGO/16-140---YSPAQILVRNATSNE.EY.GP..SMDQMEELAERSYS--A----.VEFFEIVVMLDKRL..................
Q559G0_DICDI/942-1056---GTDFEVSIESAKETLFEFLKGVIKNGWLRIIQHLFYD--Q----.....QYRRVLTKK...................
A7AWE1_BABBO/16-138---MGEINQRIRQALYTS.DV.GC..PETVYYELSQATHD--P----.IYRERILKAAWRCL..................
Q6DJC6_XENTR/17-140---YSEAEVKVREATSND.PW.GP..STSLMSEISLMTHH--A----.EAFPEVMIMIWKRL..................

PF07651

SLA2_SCHPO/14-281---DASLMTSVRKATSI.-DETAP--KRKHVRSCIIFTWD...----.HHTARPFWTAIKVQ------------------
HIP1_HUMAN/37-309---ERTQTVSINKAINT.-QEVAV--KEKHARTCILGTHH...----.EKGAQTFWSVVNRL------------------
PICA_DROME/21-299---GQGLAKSVCKATTEE-CIGPK--KKHLDYLVHCTNEP...----NVSIPHLANLLIERS------------------
CAP14_ARATH/26-275---DEKFTAAVIKATSH.-NDVSM--DIENVQFIYRYIQS..N----PSSFKPIIRAVSLRV------------------
CAP3_ARATH/31-330---LTELEIAVVKATRH.-DDYPA--EDKYIREILCLTSY..S----RNYVSACVATLSRRL------------------
Q8LJJ6_ORYSJ/31-337---AADLAVAIVKATAHG-ESVPG--DERHVQEILTLTCY..S----RARVAACVSAVSRRL------------------
Q8MQJ8_DROME/9-281---FYHLNVSVSKALNG.-LEAPL--KTKHARSIIIMIHK...----.AKEAKTFWMIISRQ------------------
PICA_RAT/19-285---GSAVSKTVCKATTHE-IMGPK--KKHLDYLIQCTNEM...----NVNIPQLADSLFERT------------------
YHC3_SCHPO/7-271---LLTYERAVKKATKVK-LAAPK--YKHVEIILEATTED...----PETLENVIQALCERL------------------
O62142_CAEEL/7-278---FRGQFQAVQKAITK.-DETPL--KPKHLETILLGTHT...----.EKSSAIFWSSVKKI------------------
HIP1R_HUMAN/28-300---DKTQAISISKAINT.-QEAPV--KEKHARRIILGTHH...----.EKGAFTFWSYAIGL------------------
CAP6_ARATH/29-317---FKDLDVAIVKATNH.-VESAP--KERHIRRIFSATSVVQP----RADVAYCIHALAKRL------------------
O93959_CANAX/5-271---EVDLQTSVKKACNA.-DEVPP--KRKHVRACIVYTWD...----.HKNSRAFWNAVKIQ------------------
O94097_YARLL/7-273---EVDLNVNIKKATNT.-DESAP--KRKHVRACIVYTHD...----.HRSSKAFWNGIRIQ------------------
E7KHE4_YEASA/5-275---DSDLQKALKKACSV.-EETAP--KRKHVRACIVYTWD...----.HQSSKAVFTTLKTL------------------
AP18A_YEAST/1-272---MTTYFKLVKGATKIK-SAPPK--QKYLDPILLGTSNE...----.EDFYEIVKGLDSRI------------------
AP18B_YEAST/2-266---SSLYTKLVKGATKI.-KMAPP--KQKYVDPILSGTSS...----ARGLQEITHALDIRL------------------
CAP11_ARATH/35-306---FFDIEVAVVRATSH.-DDCPV--DDKTMHEILFLVSN..T----PGSIPFLAEQISRRL------------------
CAP12_ARATH/31-295---NADLEAAIIKATSH.-DDSSV--DYSNAHRVYKWIRS..S----PLNLKTLVYAISSRV------------------
SLAP2_CAEEL/12-284---VRAQLEAVQKAITK.-NEVPL--KPKHARTIIVGTHK...----.EKSSGIFWHTVGRI------------------
CAP13_ARATH/30-291---NPDLDSAIIHATSH.-DDSSV--DYHNAHRVYKWIRS..S----PANLKPLVHALSSRV------------------
CAP10_ARATH/33-303---YKELDIAIVKATNH.-VERPS--KERYIRAIFMAISATRP----RADVAYCIHALARRL------------------
CAP15_ARATH/21-281---DDILTAAVVKATSH.-DELSI--DTESAQFIYRHVLS..S----PSSLKPLVSLISSRV------------------
Q7SDY1_NEUCR/13-280---EAELAINIRKATSA.-EESAP--KRKHVRSCIVYTWD...----.HKSSQSFWAGMKVQ------------------
Q7SHN2_NEUCR/2-263---ASSFEKSVKGATKI.-KAAPP--KTKYIEHILIATHS..G----EAGVGEVFRVLQTRL------------------
Q9PTK7_XENLA/19-285---GSAVARAVCKATTHE-VMGPK--KKHLDFLIQATNET...----NVNIPQMADTLFERA------------------
CAP4_ARATH/31-325---LSELDVAIVKATRH.-EEFPA--EEKYIREILSLTSY..S----RSYINACVSTLSRRL------------------
CAP9_ARATH/29-310---YAELDVAIVKATNH.-VECPP--KDRHLRKIFLATSAIRP----RADVAYCIHALSRRL------------------
AP180_ARATH/33-329---LTTLEVAILKATSHD-EEVPI--DDRLVTEILGIISS..K----KSHAASCAAAIGRRI------------------

PF00790

VPS27_YEAST/3-145VSTPSELDALIEQATSESIPNGDL--DLPIALEISDVLRS--R....RVNPKDSMRCIKKRI------------------
GGA2_HUMAN/20-159PGPAASLELWLNKATDPSMSEQ..--DWSAIQNFCEQVNT--D....PNGPTHAPWLLAHKI------------------
STAM1_MOUSE/7-139NPFDQ....DVEKATSELNTAE..--DWGLILDICDKVGQ--S....RTGPKDCLRSIMRRV------------------
Q17796_CAEEL/3-136TKFQR....VLDQATDSTLVEP..--NWEGIILCTDMIRS--G....EVPAKPSLQAIRKRM------------------
GGA3_HUMAN/3-142EAEGESLESWLNKATNPSNRQE..--DWEYIIGFCDQINK--E....LEGPQIAVRLLAHKI------------------
GGA1_YEAST/16-161RSTESSLLRKIQRACRSTLPEP..--DLGLNLDVADYINS--K...QGATPREAVLAIEKLV------------------
HSE1_YEAST/2-141SSSAIKIRNALLKATDPKLRSD..--NWQYILDVCDLVKE--D...PEDNGQEVMSLIEKRL------------------
GGA2_YEAST/20-165QALGNPLLRKIQRACRMSLAEP..--DLALNLDIADYINE--K...QGAAPRDAAIALAKLI------------------
HGS_HUMAN/3-139RGSGT.FERLLDKATSQLLLET..--DWESILQICDLIRQ--G....DTQAKYAVNSIKKKV------------------
VPS27_SCHPO/9-146SQFAS....DIEKATSETLPAGSE--EISLYLEISDQIRS--K....SVDPKFAMRILKSRI------------------
Q23165_CAEEL/3-146EEPVRPIDYWVCRATDRFIGDE..--...ERIKALDFIIE--SIYKQPASALLAVDLFSHKL------------------
LSB5_SCHPO/7-145TVPITAVTTYIDRLTSRDTDDE..--DLSGIVQLSEAVNL--T....VTGPREASRTLRKKL------------------
YB0G_SCHPO/3-147SAKRRLYS.LIQNATEPYAFEP..--DLAVNLDIADLINQ--T...GGNLPREAAFAIVRKV------------------
TOM1_CHICK/7-148NPFSSPVGQRIERATDGSLRGE..--DWSLNMEICDIINE--T....EEGPKDAFRAIKKRI------------------
YD85_SCHPO/1-146MRSSQTLSKYIDKATDQFNLEP..--NLALNIEIADLINE--K...KGNTPREAALLILKRV------------------

PF01417

EPN2_ARATH/23-146........................................LS.DT-GKNWRHVYK.........ALTVLEYMVGHGSE..
Q4WHZ5_ASPFU/32-156........................................FTDKS-AEEWRQIYK.........SLQLLEFLIKNGSE..
A5DG42_PICGU/26-162................................SIASSKFS...NN-EKGWLILLK.........SLTVVMYLLQNGSP..
Q4S9J6_TETNG/17-136.......................................N...DH-GKNWRHVYK.........ALTLLDYLIKTGSE..
A5DUV4_LODEL/15-139.......................................N...DK-GKNWRHIAK.........SLTVLDYLVRFGSE..
A7RIC8_NEMVE/21-145......................................LQ...EP-KKYWRRIYK.........SLLLLGYLLKNGSD..
Q75CI0_ASHGO/12-141.....................................GNANK.SS-HKNAVHILK.........ALTLTNYLIANGSE..
A1CU98_ASPCL/15-139.......................................N...DK-GKNWRHVLK.........SLKVLDYCLHEGSE..
Q5K8L7_CRYNJ/33-157......................................ME...KE-AREWRQIYK.........ALTLLEFLVKNGSE..
A3ACG9_ORYSJ/23-146.......................................N...DT-GKNWRHVYK.........GLIVLDYLVAHGTE..
A7TGV0_VANPO/16-139.......................................N...DK-GKYWKHIAK.........SLTVLDYLVRFGSE..
A3BVW2_ORYSJ/29-156......................................AR.A.GD-WKEWRPVYK.........ALVVLEFLLTHGPR..
Q16IC4_AEDAE/7-131......................................LQ...DN-KTNWRRTYK.........SLLLLNYLVRNGSE..
Q6CWF2_KLULA/29-153......................................TE...KT-ASEWRQIYK.........ALQLLEYLVKHGSE..
Q6FV92_CANGA/12-141.....................................GVNKR.NS-HRTCLHVLK.........TLTLVSYLLNNGSN..
Q4N8B4_THEPA/21-143.......................................S...SS-PRRVKRIQK.........ALNLLNYLIINGSD..
A7TRZ4_VANPO/12-141.....................................GSSKK.SS-HRNCVHILK.........TMTLISYLINNGSN..
Q5ADS1_CANAL/11-188SNTSKLSSTIHRTHSFPRRSKTLPSPDTPSDVNTLKYKQV...LD-DKVYLSLLK.........ALTVILYLLQNGSV..
Q2U6I6_ASPOR/32-147......................................TD...KT-AEEWRQIYK.........GLQLLEFLVKNGSE..
A6ZXG7_YEAS7/16-139.......................................N...DK-GKYWRHIAK.........ALTVIDYLIRFGSE..
Q7KU93_DROME/19-141.......................................N...DH-GKNWRHVYK.........ALILLEYLIKTGSE..
Q9LW61_ARATH/32-158......................................KD.E.RE-IKNWREAYK.........AMVLLEFLLMHGPI..
Q010W1_OSTTA/31-153......................................EV...CR-GEKWRQTYK.........ALSVVEYLIANGAE..
Q9BI72_CAEEL/17-139.......................................N...DS-GKNWRHVYK.........SLVLLDFLIKCGHE..
Q3UGL3_MOUSE/21-145......................................LK...DN-KKNWRRVYK.........SLLLLAYLIRNGSE..
Q6CSZ1_KLULA/16-140.......................................N...DK-GRNWRHVAK.........SLTCLDFLVRCGSE..
A4S350_OSTLU/31-152.......................................K...SA-PEEWRRAYK.........ALTVVEYLVANGDR..
A6ZYB3_YEAS7/30-180..............................KNLYEKARKDYV.NY-GSEWRVVLK.........CLVVIEFLLLNVDTGD
Q6CS48_KLULA/12-143....................................GSSRLK.NS-HDSVVQVLK.........TLTLIEYLLYNGSE..
Q4SE28_TETNG/17-140.......................................N...DH-GKNWRHVYK.........ALILLDYLIKTGSE..
EPN_DICDI/19-141.......................................N...DP-GKFWRHVYK.........SLLLIDYLVRNGSP..
Q8LFS0_ARATH/43-167......................................AK...FD-KRNWRMAYN.........SLIVVEHLLTHGPE..
B1AT70_MOUSE/17-140.......................................N...DS-GKNWRHVYK.........ALTLLDYLLKTGSE..
Q5C2A9_SCHJA/33-157......................................HS...DN-RCSWRRVYK.........SLIVLAFLLRNGSD..
Q750B1_ASHGO/30-180..............................KNLYEKARKQYV.NY-GHEWRVVLK.........CLVVLEFLILNSSSGQ
A7A0M0_YEAS7/12-142.....................................GQNRR.NS-HRNCIQVMK.........TLTLVSYLMNNGSN..
Q6CQJ4_KLULA/30-180..............................KNMYEKARKQYV.NY-GNEWRVVLK.........CLVLLEYLLMRSDRGK
Q9FRR8_ARATH/35-159......................................VV...FD-RKEWRGMCN.........TLSMLNHLLLNGPL..
PICA_CAEEL/34-157...........................................TQ-NPNWTVVYK.........ALITIHNIMCYGNE..
Q4QA28_LEIMA/20-142.......................................N...NR-DKSWRPCYK.........SLLVIDYLARNVDD..
Q7SEF2_NEUCR/32-149......................................PE...KS-AEEWRQIYK.........ALQLLEYLIKHGSE..
ENTD1_HUMAN/14-137.......................................N...DH-GKNWRHVYK.........SLTLMDYLIKNGSK..
Q4E4P1_TRYCC/20-142.......................................K...HR-EKAWRPCYK.........SLLLLDHLARNVPE..
ENT1_SCHPO/19-142.......................................N...DK-GKNWRHVFK.........SLSLLEYCLHNGSE..
Q5CW24_CRYPI/28-150.......................................S...EK-AIKWRRIFK.........TLVLVEYLLKNGID..
Q6MFM0_NEUCS/15-151.......................................N...DK-GKNWRHVLK.........ALKVMDYILHEGSE..
P92917_AVEFA/25-148.......................................A...ER-DSNWRHVYK.........ALTIIEYLIANGSE..
YCTB_SCHPO/30-154......................................TE...KT-AEEWRQIYK.........ALQLLEFLVKNGSE..
Q6C7P2_YARLI/16-139.......................................N...DK-GKNWRHVIK.........ALNLLDYCIHCGSE..
A0E2V0_PARTE/386-510.......................................S...TI-GISSNVILK.........TLIITDYLLKYGCS..
A3LUL4_PICST/30-154......................................TE...KA-ANEWRQIYK.........SLQLLDYLIKNGSE..
Q387I4_TRYB2/20-142.......................................K...NR-DKSWRPCYK.........ALLLLDHLARNVPE..
Q6C975_YARLI/30-154......................................TD...KT-SEEWRQIYK.........ALQLLDYLVKHGSE..
A0CFU3_PARTE/19-141.......................................D...SD-NREWRRILK.........TLNMIEYLTKNGAP..
Q5C631_SCHJA/22-144.......................................N...DK-SKNWRHVYK.........ALVLLDYLTKTGSE..
Q54WR0_DICDI/15-139...........................................LK-NNSSHVKLK.........TLKIIKHLILKGNA..
Q4T3Y5_TETNG/3-125.......................................K...DD-.RNWRHIHK.........SLTLLEYLLKTGDD..
ENT3_YEAST/29-153......................................TE...KA-GSEWRQIYK.........ALQLLDYLIKHGSE..
A4QMU9_HUMAN/36-156.......................................N...DS-GKNWRHVYK.........ALTLLDYLLKTGSE..
Q99PW9_RAT/40-159...........................................PL-PSSSILSWK.........FCHVLHKVLRDGHP..
Q7R6W4_PLAYO/24-155.......................................Q...EK-PSKWRRIYKVGLKIKTKNGLRLCEYVMKNGCE..
A8BIK9_GIAIC/21-146......................................SS...TN-SKSWKQIYK.........TLLLIEHLLINASP..
Q5KGK6_CRYNJ/23-146.......................................N...DK-GKNWRHVFK.........ALTLLDYCLHAGSE..
A7TEM3_VANPO/30-180..............................KNFYEKARKEYV.NY-GNEWRVVMK.........CLILIEFLLMNVSDGD
Q6FYA1_CANGA/16-140.......................................N...DK-GKYWRHVAK.........SLTVLDYLVRFGSE..
Q2HEQ3_CHAGB/32-156......................................TE...KS-AEEWRQIYK.........ALQLLEYLIKHGSE..
A2FJT4_TRIVA/21-144.......................................G...DI-.KEIRHVQK.........SLLLLEYLLRNGPE..
A7TSS4_VANPO/30-180..............................KNLYEKARKEYV.NY-GSEWRIILK.........CLIVIEYLLLNVSEPE
Q75CS6_ASHGO/16-140.......................................S...DK-PKHWRHVAK.........SLTVTDFLVRTGAE..
Q559G0_DICDI/942-1056...........................................LS-NNNSIYTQK.........ELSL...LLEHAIS..
A7AWE1_BABBO/16-138.......................................N...SH-VSRYKRIKK.........ALCLLTYLALNGHE..
Q6DJC6_XENTR/17-140.......................................N...DS-GKNWRHVYK.........ALTLLDYLIKNGSK..

PF07651

SLA2_SCHPO/14-281-------------------------------------------PL-LANEVQTFK---------ALITIHRVLQEGHK--
HIP1_HUMAN/37-309-------------------------------------------PL-SSNAVLCWK---------FCHVFHKLLRDGHP--
PICA_DROME/21-299-------------------------------------------QN-A.NWVVVYK---------SLITTHHLMAYGNE--
CAP14_ARATH/26-275-------------------------------------------EH-TRNWTVALK---------CLMLLHGLFFSGIM--
CAP3_ARATH/31-330-------------------------------------------NK-TKNWSVALK---------TLILIQRLLTDGDR--
Q8LJJ6_ORYSJ/31-337-------------------------------------------GR-TRAWAVAVK---------ALALVHRLLADGDP--
Q8MQJ8_DROME/9-281-------------------------------------------PL-MQSRFTAWK---------FSHLLHKVLREGHE--
PICA_RAT/19-285-------------------------------------------TN-S.SWVVVFK---------SLITTHHLMVYGNE--
YHC3_SCHPO/7-271-------------------------------------------KE-Q.SWTIVFK---------TLIVFHVMLKEGAP--
O62142_CAEEL/7-278-------------------------------------------KL-ENHPVLTWK---------FCLLVHKLLRDGHP--
HIP1R_HUMAN/28-300-------------------------------------------PL-PSSSILSWK---------FCHVLHKVLRDGHP--
CAP6_ARATH/29-317-------------------------------------------SK-TRNWVVAIK---------VLIVIHRTLREGDP--
O93959_CANAX/5-271-------------------------------------------PL-QSNEVQLFK---------ALIMIHKVLQEGHP--
O94097_YARLL/7-273-------------------------------------------PL-QTDDVMVFK---------ALITIHKVLQEGHP--
E7KHE4_YEASA/5-275-------------------------------------------PL-ANDEVQLFK---------MLIVLHKIIQEGHP--
AP18A_YEAST/1-272-------------------------------------------ND-T.AWTIVYK---------SLLVVHLMIREGSK--
AP18B_YEAST/2-266-------------------------------------------SD-T.AWTIVYK---------ALIVLHLMIQQGEK--
CAP11_ARATH/35-306-------------------------------------------AK-TRDCLVAGK---------TLLLFHRLLRGSSR--
CAP12_ARATH/31-295-------------------------------------------NH-TRSWIVALK---------SLMLLHGVLCCKVP--
SLAP2_CAEEL/12-284-------------------------------------------QL-EKHPVLTWK---------FCHLVHKLLRDGHR--
CAP13_ARATH/30-291-------------------------------------------NR-TRSWIVALK---------ALMLVHGVLCCKVT--
CAP10_ARATH/33-303-------------------------------------------SR-THNWAVALK---------TLIVIHRALREVDQ--
CAP15_ARATH/21-281-------------------------------------------KR-TRSWAVALK---------GLMLMHGFFLCKST--
Q7SDY1_NEUCR/13-280-------------------------------------------PI-MADEVQTFK---------ALITIHKVLQEGHP--
Q7SHN2_NEUCR/2-263-------------------------------------------RD-S.TWTVVFK---------SLITVHLMIREGSP--
Q9PTK7_XENLA/19-285-------------------------------------------TS-T.SWVVVFK---------ALVTTHHLMVHGNE--
CAP4_ARATH/31-325-------------------------------------------NK-TKCWTVALK---------TLILIQRLLGEGDQ--
CAP9_ARATH/29-310-------------------------------------------HK-TRNWTVALK---------ALLVIHRLLRDGDP--
AP180_ARATH/33-329-------------------------------------------GR-TRNWIVALK---------SLVLVLRIFQDGDP--

PF00790

VPS27_YEAST/3-145-------------------------------------------LNTADNPNTQLS---------SWKLTNICVKNGGT--
GGA2_HUMAN/20-159-------------------------------------------QS..PQEKEALY---------ALTVLEMCMNHCGE--
STAM1_MOUSE/7-139-------------------------------------------NH..KDPHVAMQ---------ALTLLGACVSNCGK--
Q17796_CAEEL/3-136-------------------------------------------QH..ENPHVVNH---------TLLVLDACVKNCGH--
GGA3_HUMAN/3-142-------------------------------------------QS..PQEWEALQ---------ALTVLEACMKNCGR--
GGA1_YEAST/16-161-------------------------------------------NN..GDTQAAVF---------ALSLLDVLVKNCGY--
HSE1_YEAST/2-141-------------------------------------------EQ..QDANVILR---------TLSLTVSLAENCGS--
GGA2_YEAST/20-165-------------------------------------------NN..RESHVAIF---------ALSLLDVLVKNCGY--
HGS_HUMAN/3-139-------------------------------------------ND..KNPHVALY---------ALEVMESVVKNCGQ--
VPS27_SCHPO/9-146-------------------------------------------DH..SNPNVQIM---------ALKLTDTCVKNGGS--
Q23165_CAEEL/3-146-------------------------------------------SS..PSQEEAML---------TIRALDYLVRNGGE--
LSB5_SCHPO/7-145-------------------------------------------KY..STPHEQVR---------ALVILQALIENAGS--
YB0G_SCHPO/3-147-------------------------------------------ND..RNPTVAYL---------ALNLLDICVKNCGY--
TOM1_CHICK/7-148-------------------------------------------VG.NKNFHEVML---------ALTVLETCVKNCGH--
YD85_SCHPO/1-146-------------------------------------------NS..ANPTVSYL---------ALHLLDICVKNCGY--

PF01417

EPN2_ARATH/23-146...RVIDEI.RERAYQISTL.SDFQY------------------------------------------------------
Q4WHZ5_ASPFU/32-156...RVVDDA.RSHLSLIRML.RQFHY------------------------------------------------------
A5DG42_PICGU/26-162...EFVYWLKSCTASVIAPL.HRAKL------------------------------------------------------
Q4S9J6_TETNG/17-136...RVALQC.KENIFAIQTL.KDFQY------------------------------------------------------
A5DUV4_LODEL/15-139...KCVLWA.KDNIYIVKTL.REFIH------------------------------------------------------
A7RIC8_NEMVE/21-145...RVVTNA.RDHIYDMRQL.ENFHH------------------------------------------------------
Q75CI0_ASHGO/12-141...DFVQWL.QGCAVLLRRL.KDFTT------------------------------------------------------
A1CU98_ASPCL/15-139...LVVTWA.RKNVYIIKTL.REFQY------------------------------------------------------
Q5K8L7_CRYNJ/33-157...RVVDDA.RAHVSTIKML.RSFHY------------------------------------------------------
A3ACG9_ORYSJ/23-146...RVIDDI.REHSYQISTL.ADFQY------------------------------------------------------
A7TGV0_VANPO/16-139...NCVLWC.KENLYIIQTL.KEFSY------------------------------------------------------
A3BVW2_ORYSJ/29-156...RGSHETSCPDVAALRDL.RGFTH------------------------------------------------------
Q16IC4_AEDAE/7-131...RVVTSS.REHIYDLRSL.ENYTF------------------------------------------------------
Q6CWF2_KLULA/29-153...RFIDDV.RTNLNLVKML.ESFHY------------------------------------------------------
Q6FV92_CANGA/12-141...DFIAWL.KSSKYVIEYL.SSFEA------------------------------------------------------
Q4N8B4_THEPA/21-143...RCIYDV.MNNLHILSSV.GKLKF------------------------------------------------------
A7TRZ4_VANPO/12-141...DFIAWA.RSNIMIFEVL.KDFEV------------------------------------------------------
Q5ADS1_CANAL/11-188...QFIDWLLKDYKSIISPL.SRI..------------------------------------------------------
Q2U6I6_ASPOR/32-147...RVVDDA.RSHMSLLRML.RQFHY------------------------------------------------------
A6ZXG7_YEAS7/16-139...NCVLWC.RENLYIIKTL.KEFRH------------------------------------------------------
Q7KU93_DROME/19-141...KVAQQC.KENIFAIQTL.REFVY------------------------------------------------------
Q9LW61_ARATH/32-158...HLPHDF.LYDLDHFRFL.STFQY------------------------------------------------------
Q010W1_OSTTA/31-153...RIPEDV.RRS.RVLEDL.VRFEH------------------------------------------------------
Q9BI72_CAEEL/17-139...KVAQQC.RENVFTIETL.KDFQH------------------------------------------------------
Q3UGL3_MOUSE/21-145...RVVTSA.REHIYDLRSL.ENYHF------------------------------------------------------
Q6CSZ1_KLULA/16-140...NCVFWC.KENLYIIKTL.REFTH------------------------------------------------------
A4S350_OSTLU/31-152...AIAEDV.RRRRMMDGAL..RFEY------------------------------------------------------
A6ZYB3_YEAS7/30-180ELNQIRSCL.LTHKHILTREIAQFKV------------------------------------------------------
Q6CS48_KLULA/12-143...EFVLWM.RRHLAYIEAL.KDYHC------------------------------------------------------
Q4SE28_TETNG/17-140...RVTQDC.RENMPIIQTL.RDFQY------------------------------------------------------
EPN_DICDI/19-141...QVIRDC.RHHTMEIKTL.VEFQY------------------------------------------------------
Q8LFS0_ARATH/43-167...SVSDEF.QGDIDVISQM.QTFQQ------------------------------------------------------
B1AT70_MOUSE/17-140...RVAHQC.RENLYTIQTL.KDFQY------------------------------------------------------
Q5C2A9_SCHJA/33-157...YLVQGA.RDHIYDIRTL.ESFRF------------------------------------------------------
Q750B1_ASHGO/30-180ELDQVLSCI.NTHKHILARDTMQFKV------------------------------------------------------
A7A0M0_YEAS7/12-142...EFIKWL.KGNMILIEIL.EDFQV------------------------------------------------------
Q6CQJ4_KLULA/30-180ETDQVLSCL.QAHKHILTKETMQYRV------------------------------------------------------
Q9FRR8_ARATH/35-159...SVFSEF.QHERAIIEDA.IKMEW------------------------------------------------------
PICA_CAEEL/34-157...RFSQYL..ASCNTTFNL.TAFVD------------------------------------------------------
Q4QA28_LEIMA/20-142...RYLPEI.SALVPIIRTISTSFYY------------------------------------------------------
Q7SEF2_NEUCR/32-149...RVVDDA.RSHLTLLKML.RQFHF------------------------------------------------------
ENTD1_HUMAN/14-137...KVIQHC.REGFCNLQTL.KDFQH------------------------------------------------------
Q4E4P1_TRYCC/20-142...SGLPAI.CTVIPTLRTISQSFYY------------------------------------------------------
ENT1_SCHPO/19-142...NVVRWA.KDNIYIITTL.REFVY------------------------------------------------------
Q5CW24_CRYPI/28-150...RFVDDF.KEYMYKVRHL.QDFYY------------------------------------------------------
Q6MFM0_NEUCS/15-151...MVVTWA.KQNIFIIKTL.REFQY------------------------------------------------------
P92917_AVEFA/25-148...RAVDNI.LDHFSKISVL.SSFEF------------------------------------------------------
YCTB_SCHPO/30-154...RVVDDA.RAHQATIKML.RNFHY------------------------------------------------------
Q6C7P2_YARLI/16-139...NVVLWC.KDNLYVVKTL.REFHY------------------------------------------------------
A0E2V0_PARTE/386-510...GIIDDL.KVRIYMFRNY.QDFKI------------------------------------------------------
A3LUL4_PICST/30-154...RLIDDV.RANLSLIQML.KSFHY------------------------------------------------------
Q387I4_TRYB2/20-142...VGLPPL.CSILPTLQHISQTFYY------------------------------------------------------
Q6C975_YARLI/30-154...RVIDYA.RSHVGVIQML.KNFHF------------------------------------------------------
A0CFU3_PARTE/19-141...RCVGEF.RDNIYKIRSF.SDFFL------------------------------------------------------
Q5C631_SCHJA/22-144...KVATQC.RENIHSIETL.RDFEY------------------------------------------------------
Q54WR0_DICDI/15-139...AFKQEL.ILNLAEVRNC.TNFSG------------------------------------------------------
Q4T3Y5_TETNG/3-125...RVLLKM.KDNIYIVKAL.TEYRF------------------------------------------------------
ENT3_YEAST/29-153...RFIDDT.RNSINLIRIL.ETFHY------------------------------------------------------
A4QMU9_HUMAN/36-156...RVAHQC.RENLYTIQTL.KDFQY------------------------------------------------------
Q99PW9_RAT/40-159...NVLHDC.QRYRSNIREI.GDLWG------------------------------------------------------
Q7R6W4_PLAYO/24-155...YFISDV.KEKEELIKKL.AHFTY------------------------------------------------------
A8BIK9_GIAIC/21-146...DTVRDI.QSHLNVIQTL.EDFRY------------------------------------------------------
Q5KGK6_CRYNJ/23-146...NVVIYF.KDNIYIIKTL.KEFVY------------------------------------------------------
A7TEM3_VANPO/30-180ELHQVLTCL.KKHIHILSRETTTYRI------------------------------------------------------
Q6FYA1_CANGA/16-140...NCVLWC.KENLYIIKTL.REFRH------------------------------------------------------
Q2HEQ3_CHAGB/32-156...RVIDDA.RSHITLLKML.RQFHF------------------------------------------------------
A2FJT4_TRIVA/21-144...AFRSDT.RTMLGQLQQL.TTLHM------------------------------------------------------
A7TSS4_VANPO/30-180ELNQVKSCL.ENHKQIFNSNILNYKI------------------------------------------------------
Q75CS6_ASHGO/16-140...TCVDWA.RENLYLFRRL.TEFYH------------------------------------------------------
Q559G0_DICDI/942-1056..........WDQFYIVEFFINQMGF------------------------------------------------------
A7AWE1_BABBO/16-138...ACITEI.INHIDDITAL.HDLEY------------------------------------------------------
Q6DJC6_XENTR/17-140...KVVEEC.NENIHSVQTL.KDFQF------------------------------------------------------

PF07651

SLA2_SCHPO/14-281---SALVDS-QSEKGWLKTC-ER...Q....YDGE.....SSPKGYSDLIRDYVDYLLDKLSFHAQHPEFN........G
HIP1_HUMAN/37-309---NVLKDS-LRYRNELSDM-SRMWG..............HLSEGYGQLCSIYLKLLRTKMEYHTKNPRFP........G
PICA_DROME/21-299---RFMQYL-ASSNSTFNLS-SFLDKGT.VQDGGMGVPGGRMGYDMSPFIRRYAKYLNEKSLSYRAMAFD..........
CAP14_ARATH/26-275---TVD.SI-GRLPFDLSGF-GRRKSR....F........SRTGRFNIFVRAYFMFLDERSILYYNKNMI..........
CAP3_ARATH/31-330---AYEQEI-FFATRRGTRL-LNMSDF...RDASQ.....SDSWDYSAFVRTYALYLDERLDYRMQGRRGKKKSGGGGGG
Q8LJJ6_ORYSJ/31-337---AYEQEV-FLATRRGRRM-LDVSHRFPHRSSRS.....RATWDFHGFVRAYAAYLDDRLKHRMKGRVASQGK.WCSDG
Q8MQJ8_DROME/9-281---SAIRHS-QSHKKMILEV-GKMWG..............LLQDDIGCCIQAYSKLLATKLNFHDKNRMFP........G
PICA_RAT/19-285---RFIQYL-ASRNTLFNLS-NFLDKS...GLQG.........YDMSTFIRRYSRYLNEKAVSYRQVAFD..........
YHC3_SCHPO/7-271---NTTIVA-LSQRPRILEV-LKASS................LLAQGKNIYNYSRFLSERAKQYGRLGVD..........
O62142_CAEEL/7-278---VVPKEA-YRNEKRFTQL-ALHWK...............DKRDYGPCIDAYCKLLHDRVIFHHKRPYFP........G
HIP1R_HUMAN/28-300---NVLHDC-QRYRSNIREI-GDLWG..............HLHDRYGQLVNVYTKLLLTKISFHLKHPQFP........A
CAP6_ARATH/29-317---TFREEL-LNYSH.RGHI-LRISNF...KDDTS.....PLAWDCSAWIRTYALFLEERLECYRVLKYD.........I
O93959_CANAX/5-271---NTLKDG-YRNRDFIASL-AT...VF..PSHG.........SAYGRLINQYDKYILQKLDFHRNNPGFN........G
O94097_YARLL/7-273---SALRDA-QANVNFIQSL-ARGNNY....TGPN.....QGNHGYGKLISEYVRFLMQKLTFHKYHPAFN........G
E7KHE4_YEASA/5-275---SALAEA-IRDRDWIRSL-GRVHS...............GGSSYSKLIREYVRYLVLKLDFHAHHRGFN.......NG
AP18A_YEAST/1-272---DVALRY-YSRNLEFFDI-ENIRGSN..GSAS.........GDMRALDR.YDNYLKVRCREFGKIKKD..........
AP18B_YEAST/2-266---DVTLRH-YSHNLDVFQL-RKISHTT..KWSS.........NDMRALQR.YDEYLKTRCEEYGRLGMD..........
CAP11_ARATH/35-306---SIEQQL-HIAHTSGHLQ-IGCSW......FMM.....SLDSRSFVFLQNYVAYLQERVGWIINQAGK..........
CAP12_ARATH/31-295---SVVGEF-RRLPFDLSDF-SDGHS.....C..L.....SKTWGFNVFVRTYFAFLHHYSSFLSDQIHRL.......RG
SLAP2_CAEEL/12-284---KVPEET-YRYVNRFTQL-SQFWK........H.....LNTSGYGPCIESYCKLLHDRVTFHNKYPVVP........G
CAP13_ARATH/30-291---SLQ.EI-RRLPFDLSDF-SDGHS.....R..P.....SKTWGFNAFIRAYFSFLDQYSFFLSDQIRR..........
CAP10_ARATH/33-303---TFHEEV-INYSRSRSHM-LNMSHF...KDDSG.....PNAWAYSAWVRFYALFLEERLECFRVLKYD..........
CAP15_ARATH/21-281---VAE.SI-GRLPFDLSSF-GEGNSR....I..M.....SKSGGFNLFVRAYFAFLDRRSILFHDGNRH..........
Q7SDY1_NEUCR/13-280---ATLREA-MANRGWIDSL-NRGMG........G.....EGMRGYGPLIKEYVYYLLAKLSFHQQHPEFN........G
Q7SHN2_NEUCR/2-263---DVTLAY-LAKHRSMLGL-GMISD................VQTQGRNIRHYYDYLTERVRAYRDTKID..........
Q9PTK7_XENLA/19-285---RFIQYL-ASRNTLFNLS-NFSDKS...GSHG.........YDMSTFIRRYSRYLNEKAFSYRQMAFD..........
CAP4_ARATH/31-325---AYEQEI-FFATRRGTRL-LNMSDF...RDVSR.....SNSWDYSAFVRTYALYLDERLDFRMQARHGKRGV.YCVGG
CAP9_ARATH/29-310---TFREEL-LNFSQ.KGRI-MQISNF...KDDSS.....PVAWDCSGWVRTYALFLEERLECFRVLKYD.........I
AP180_ARATH/33-329---YFPREV-LHAMKRGAKI-LNLSSF...RDDSN.....SCPWDFTAFVRTFALYLDERLDCFLTGKLQRRY...TNRE

PF00790

VPS27_YEAST/3-145---PFIKEI-CSREFMDTME-HVILR------------------------------------------------------
GGA2_HUMAN/20-159---KFHSEV-AKFRFLNELI-KVLSP------------------------------------------------------
STAM1_MOUSE/7-139---IFHLEV-CSRDFASEVS-N.VLN------------------------------------------------------
Q17796_CAEEL/3-136---KVHAEV-ATREFMEDFK-NLVTE------------------------------------------------------
GGA3_HUMAN/3-142---RFHNEV-GKFRFLNELI-KVVSP------------------------------------------------------
GGA1_YEAST/16-161---SIHLQI-SRKEFLNDLV-KRFPE------------------------------------------------------
HSE1_YEAST/2-141---RLRQEI-SSKNFTSLLY-ALIES------------------------------------------------------
GGA2_YEAST/20-165---PFHLQI-SRKEFLNELV-KRFPG------------------------------------------------------
HGS_HUMAN/3-139---TVHDEV-ANKQTMEELK-DLLKR------------------------------------------------------
VPS27_SCHPO/9-146---GFLLEI-ASREFMDNLV-S.ILR------------------------------------------------------
Q23165_CAEEL/3-146---KVHERC-GRYKFLNELV-RLIAP------------------------------------------------------
LSB5_SCHPO/7-145---HFLQNF-SDEKLEDRML-QCATN------------------------------------------------------
YB0G_SCHPO/3-147---AFRLQI-ASKEFLNELV-RRFPE------------------------------------------------------
TOM1_CHICK/7-148---RFHILV-ASQDFVESVL-VRTIL------------------------------------------------------
YD85_SCHPO/1-146---PFHFQI-ASEEFLNGFV-SRFPN------------------------------------------------------

PF01417

EPN2_ARATH/23-146--------------------------------------------------------------------------------
Q4WHZ5_ASPFU/32-156--------------------------------------------------------------------------------
A5DG42_PICGU/26-162--------------------------------------------------------------------------------
Q4S9J6_TETNG/17-136--------------------------------------------------------------------------------
A5DUV4_LODEL/15-139--------------------------------------------------------------------------------
A7RIC8_NEMVE/21-145--------------------------------------------------------------------------------
Q75CI0_ASHGO/12-141--------------------------------------------------------------------------------
A1CU98_ASPCL/15-139--------------------------------------------------------------------------------
Q5K8L7_CRYNJ/33-157--------------------------------------------------------------------------------
A3ACG9_ORYSJ/23-146--------------------------------------------------------------------------------
A7TGV0_VANPO/16-139--------------------------------------------------------------------------------
A3BVW2_ORYSJ/29-156--------------------------------------------------------------------------------
Q16IC4_AEDAE/7-131--------------------------------------------------------------------------------
Q6CWF2_KLULA/29-153--------------------------------------------------------------------------------
Q6FV92_CANGA/12-141--------------------------------------------------------------------------------
Q4N8B4_THEPA/21-143--------------------------------------------------------------------------------
A7TRZ4_VANPO/12-141--------------------------------------------------------------------------------
Q5ADS1_CANAL/11-188--------------------------------------------------------------------------------
Q2U6I6_ASPOR/32-147--------------------------------------------------------------------------------
A6ZXG7_YEAS7/16-139--------------------------------------------------------------------------------
Q7KU93_DROME/19-141--------------------------------------------------------------------------------
Q9LW61_ARATH/32-158--------------------------------------------------------------------------------
Q010W1_OSTTA/31-153--------------------------------------------------------------------------------
Q9BI72_CAEEL/17-139--------------------------------------------------------------------------------
Q3UGL3_MOUSE/21-145--------------------------------------------------------------------------------
Q6CSZ1_KLULA/16-140--------------------------------------------------------------------------------
A4S350_OSTLU/31-152--------------------------------------------------------------------------------
A6ZYB3_YEAS7/30-180--------------------------------------------------------------------------------
Q6CS48_KLULA/12-143--------------------------------------------------------------------------------
Q4SE28_TETNG/17-140--------------------------------------------------------------------------------
EPN_DICDI/19-141--------------------------------------------------------------------------------
Q8LFS0_ARATH/43-167--------------------------------------------------------------------------------
B1AT70_MOUSE/17-140--------------------------------------------------------------------------------
Q5C2A9_SCHJA/33-157--------------------------------------------------------------------------------
Q750B1_ASHGO/30-180--------------------------------------------------------------------------------
A7A0M0_YEAS7/12-142--------------------------------------------------------------------------------
Q6CQJ4_KLULA/30-180--------------------------------------------------------------------------------
Q9FRR8_ARATH/35-159--------------------------------------------------------------------------------
PICA_CAEEL/34-157--------------------------------------------------------------------------------
Q4QA28_LEIMA/20-142--------------------------------------------------------------------------------
Q7SEF2_NEUCR/32-149--------------------------------------------------------------------------------
ENTD1_HUMAN/14-137--------------------------------------------------------------------------------
Q4E4P1_TRYCC/20-142--------------------------------------------------------------------------------
ENT1_SCHPO/19-142--------------------------------------------------------------------------------
Q5CW24_CRYPI/28-150--------------------------------------------------------------------------------
Q6MFM0_NEUCS/15-151--------------------------------------------------------------------------------
P92917_AVEFA/25-148--------------------------------------------------------------------------------
YCTB_SCHPO/30-154--------------------------------------------------------------------------------
Q6C7P2_YARLI/16-139--------------------------------------------------------------------------------
A0E2V0_PARTE/386-510--------------------------------------------------------------------------------
A3LUL4_PICST/30-154--------------------------------------------------------------------------------
Q387I4_TRYB2/20-142--------------------------------------------------------------------------------
Q6C975_YARLI/30-154--------------------------------------------------------------------------------
A0CFU3_PARTE/19-141--------------------------------------------------------------------------------
Q5C631_SCHJA/22-144--------------------------------------------------------------------------------
Q54WR0_DICDI/15-139--------------------------------------------------------------------------------
Q4T3Y5_TETNG/3-125--------------------------------------------------------------------------------
ENT3_YEAST/29-153--------------------------------------------------------------------------------
A4QMU9_HUMAN/36-156--------------------------------------------------------------------------------
Q99PW9_RAT/40-159--------------------------------------------------------------------------------
Q7R6W4_PLAYO/24-155--------------------------------------------------------------------------------
A8BIK9_GIAIC/21-146--------------------------------------------------------------------------------
Q5KGK6_CRYNJ/23-146--------------------------------------------------------------------------------
A7TEM3_VANPO/30-180--------------------------------------------------------------------------------
Q6FYA1_CANGA/16-140--------------------------------------------------------------------------------
Q2HEQ3_CHAGB/32-156--------------------------------------------------------------------------------
A2FJT4_TRIVA/21-144--------------------------------------------------------------------------------
A7TSS4_VANPO/30-180--------------------------------------------------------------------------------
Q75CS6_ASHGO/16-140--------------------------------------------------------------------------------
Q559G0_DICDI/942-1056--------------------------------------------------------------------------------
A7AWE1_BABBO/16-138--------------------------------------------------------------------------------
Q6DJC6_XENTR/17-140--------------------------------------------------------------------------------

PF07651

SLA2_SCHPO/14-281TFEYKEYI...............SLRQVDDPNEGY.....ETVYDMMNLQDHIDEFQKQLFSNFK.....RSNK..NECR
HIP1_HUMAN/37-309NLQMSDRQ...............LDEAGESDVNNFF....QLTVEMFDYLECELNLFQTVFNSLDMSRSVSVTA.AGQCR
PICA_DROME/21-299.FCKVKRG..............K.....EEGSLR........SMNAEKLLKTLPVLQAQLDALLEFDCQSNDLS..NGVI
CAP14_ARATH/26-275.................................R...............LEIIVKMQRIVDSLMRIKPIGETP.....LV
CAP3_ARATH/31-330DGDSGEEDDHRGTS...NDIRSKAIVVKSKPVA.........EMKTEKIFNRVQHLQQLLDRFLACRPTGNAKN..NRVV
Q8LJJ6_ORYSJ/31-337RRDGFPDITDGSYEVGEAVAEVWALVPRDTPATG........TTTTEELVSKAQHLKHILQRFIGCRPTGKART..NKVV
Q8MQJ8_DROME/9-281TLNISFTE...............LFIAVDRDL..NYC..FQLCVEIFDYLEDIIALQLTIFSSME.KYRMSSMTPQGQCR
PICA_RAT/19-285.FTKVKRG....................ADGVMR........TMNTEKLLKTVPIIQNQMDALLDFNVNSNELT..NGVI
YHC3_SCHPO/7-271.YAQVGDA....................PKKKIR.......EMKLENGLLRNVEGIQAQLRRLIKCQFVAEEID..NDIA
O62142_CAEEL/7-278NLFVSPLQ...............LDTMGRDLSRML.....RLTGDMMHQMDSLLAFQEKVYLLSNSSPRWDPNTPQGQCL
HIP1R_HUMAN/28-300GLEVTDEV..............LEKAAGTDVNNIF.....QLTVEMFDYMDCELKLSESVFRQLNTAIAVSQMS.SGQCR
CAP6_ARATH/29-317EAERLPKGSGAS.......SKNVDFNASQTYRTR........MLSDEELLEQLPALQQLLYRLIGCQPEGSAYS..NYLI
O93959_CANAX/5-271TFEYEEYI...............SLRAVNDPNEGY.....EALLNLMDLQDSINDLQKLIFATIN...QSHSN....LCK
O94097_YARLL/7-273MFEYEDYI...............SLRTVNDPNEGY.....EAIMNLMTLQDGVDDFQRLVFSSLQ...RSRSN....ECK
E7KHE4_YEASA/5-275TFEYEEYV...............SLVSVSDPDEGY.....ETILDLMSLQDSLDEFSQIIFASIQ....SERRN..TECK
AP18A_YEAST/1-272.YVRDGYR..............T.....LKLNSGNYGSSRNKQHSINIALDHVESLEVQIQALIKNKYTQYDLS..NELI
AP18B_YEAST/2-266.HLRDNYS..............S.....LKLGSK.......NQLSMDEELDHVESLEIQINALIRNKYSVSDLE..NHLL
CAP11_ARATH/35-306.LEPVMSG....................GTKFSRY......KEKSMDLVFHILPKCQEFIAQVLKCSPVDAWPI..DNLV
CAP12_ARATH/31-295NNRRSLEK..............T...................SDSVIQELERIQKLQSLLDMILQIRPVADNMK..KTLI
SLAP2_CAEEL/12-284KLDLNDSQ...............LKTLEGDLDNMF.....EMTIDMLDQMDALLVLQDRVYEMMN.SLRWNSLIPQGQCM
CAP13_ARATH/30-291...RHKKP.......................Q..........LDSVNQELERIEKLQSLLHMLLQIRPMADNMK..KTLI
CAP10_ARATH/33-303.VEVDPPR........................TK........DLDTPDLLEQLPALQELLFRVLDCQPEGAAVQ..NHII
CAP15_ARATH/21-281.................................RY.....NEESSVLIRLVIIRKMQIIVDSLIRIKPIGENMM..IPVI
Q7SDY1_NEUCR/13-280TFEYEEYI...............SLKAINDPNEGY.....ETITDLMTLQDKIDQFQKLIFSHFR...NVGNN....ECR
Q7SHN2_NEUCR/2-263.WVRGREN.........................RL.....EKLSVEKGLLRETESVQKQLTALLKCDVMDNEPE..NEIT
Q9PTK7_XENLA/19-285.FARVKKG....................AEGVMR........TMLPEKLLKGMPILQGQIDALLEFDVHPNELT..NGVI
CAP4_ARATH/31-325EADEEEQDQAAA.......DLSTAIVVRSQPIA.........EMKTEQIFIRIQHLQQLLDRFLACRPTGNARN..NRVV
CAP9_ARATH/29-310EAERLPKVSPG.........QEK.....GYSKTR........DLDGEKLLEQLPALQQLLHRLIGCKPEGAAKH..NHII
AP180_ARATH/33-329QTGRISTNSTTRS.....RFNPKAGIKSHEPAVR........DMKPVMLLDKITYWQKLLDRAIATRPTGDAKA..NRLV

PF00790

VPS27_YEAST/3-145--------------------------------------------------------------------------------
GGA2_HUMAN/20-159--------------------------------------------------------------------------------
STAM1_MOUSE/7-139--------------------------------------------------------------------------------
Q17796_CAEEL/3-136--------------------------------------------------------------------------------
GGA3_HUMAN/3-142--------------------------------------------------------------------------------
GGA1_YEAST/16-161--------------------------------------------------------------------------------
HSE1_YEAST/2-141--------------------------------------------------------------------------------
GGA2_YEAST/20-165--------------------------------------------------------------------------------
HGS_HUMAN/3-139--------------------------------------------------------------------------------
VPS27_SCHPO/9-146--------------------------------------------------------------------------------
Q23165_CAEEL/3-146--------------------------------------------------------------------------------
LSB5_SCHPO/7-145--------------------------------------------------------------------------------
YB0G_SCHPO/3-147--------------------------------------------------------------------------------
TOM1_CHICK/7-148--------------------------------------------------------------------------------
YD85_SCHPO/1-146--------------------------------------------------------------------------------

PF01417

EPN2_ARATH/23-146-------------------------------.IDS-------------------------.GGRDQGSN...........
Q4WHZ5_ASPFU/32-156-------------------------------.IDQ-------------------------.NGKDQGVN...........
A5DG42_PICGU/26-162-------------------------------..HS-------------------------.NTTMYKDA...........
Q4S9J6_TETNG/17-136-------------------------------.IDR-------------------------.DGKDQGIN...........
A5DUV4_LODEL/15-139-------------------------------.FDE-------------------------.ADKDQGAI...........
A7RIC8_NEMVE/21-145-------------------------------.TDE-------------------------.NGKDQGIN...........
Q75CI0_ASHGO/12-141-------------------------------.GNE-------------------------.RDSHMASQ...........
A1CU98_ASPCL/15-139-------------------------------.VDE-------------------------.DGRDVGQN...........
Q5K8L7_CRYNJ/33-157-------------------------------.IDE-------------------------.KGKDQGIN...........
A3ACG9_ORYSJ/23-146-------------------------------.IDS-------------------------.SGRDQGSN...........
A7TGV0_VANPO/16-139-------------------------------.IDD-------------------------.SDHDQGQI...........
A3BVW2_ORYSJ/29-156-------------------------------.VDD-------------------------.RGFDWGAC...........
Q16IC4_AEDAE/7-131-------------------------------.VDE-------------------------.NGKDQGIN...........
Q6CWF2_KLULA/29-153-------------------------------.IDS-------------------------.QGRDQGIN...........
Q6FV92_CANGA/12-141-------------------------------.QSS-------------------------.SDEPMVNQ...........
Q4N8B4_THEPA/21-143-------------------------------...S-------------------------PANRALGHL...........
A7TRZ4_VANPO/12-141-------------------------------.IHE-------------------------.DDEKMAEQ...........
Q5ADS1_CANAL/11-188-------------------------------.SYP-------------------------STYKEP..............
Q2U6I6_ASPOR/32-147-------------------------------.IDQ-------------------------.NGKDQGIN...........
A6ZXG7_YEAS7/16-139-------------------------------.EDD-------------------------.EGIDQGQI...........
Q7KU93_DROME/19-141-------------------------------.FE.-------------------------.EGKDQGTH...........
Q9LW61_ARATH/32-158-------------------------------.VDN-------------------------.NGFDWGAQ...........
Q010W1_OSTTA/31-153-------------------------------.RDA-------------------------.RGKDEGVN...........
Q9BI72_CAEEL/17-139-------------------------------.VE.-------------------------.DNRDQGLN...........
Q3UGL3_MOUSE/21-145-------------------------------.VDE-------------------------.HGKDQGIN...........
Q6CSZ1_KLULA/16-140-------------------------------.TDE-------------------------FTEIDNGEI...........
A4S350_OSTLU/31-152-------------------------------.KDA-------------------------.RGKDEGVN...........
A6ZYB3_YEAS7/30-180-------------------------------KFSN-------------------------.DGKMEIHER..........
Q6CS48_KLULA/12-143-------------------------------.SND-------------------------.KDKSKVKQ...........
Q4SE28_TETNG/17-140-------------------------------.VDR-------------------------.EGRDQGIH...........
EPN_DICDI/19-141-------------------------------.IEE-------------------------..EKDVGLS...........
Q8LFS0_ARATH/43-167-------------------------------.IDE-------------------------.KGFNWGLA...........
B1AT70_MOUSE/17-140-------------------------------.IDR-------------------------.DGKDQGVN...........
Q5C2A9_SCHJA/33-157-------------------------------.FDE-------------------------.NGKDQGMN...........
Q750B1_ASHGO/30-180-------------------------------EFSS-------------------------.DGKMEVHER..........
A7A0M0_YEAS7/12-142-------------------------------.QDP-------------------------.RDERKAED...........
Q6CQJ4_KLULA/30-180-------------------------------DFSS-------------------------.DGKMELHER..........
Q9FRR8_ARATH/35-159-------------------------------.IDE-------------------------.RGFDCGLK...........
PICA_CAEEL/34-157-------------------------------KVGG-------------------------AGGYDMSTH...........
Q4QA28_LEIMA/20-142-------------------------------.TNP-------------------------.KGVDHGVS...........
Q7SEF2_NEUCR/32-149-------------------------------.IDQ-------------------------.NGKDQGIN...........
ENTD1_HUMAN/14-137-------------------------------.IDE-------------------------.AGKDQGYY...........
Q4E4P1_TRYCC/20-142-------------------------------.TGS-------------------------.KGTDHGLS...........
ENT1_SCHPO/19-142-------------------------------.VDD-------------------------.NGHDQGQN...........
Q5CW24_CRYPI/28-150-------------------------------.TEE-------------------------..GKDKGAG...........
Q6MFM0_NEUCS/15-151-------------------------------.IDE-------------------------.EGKDVGNNGREHTPIGGLV
P92917_AVEFA/25-148-------------------------------.VEP-------------------------.NGKDAGIN...........
YCTB_SCHPO/30-154-------------------------------.IDH-------------------------.RQKDQGLN...........
Q6C7P2_YARLI/16-139-------------------------------.IDE-------------------------.NGRDQGAS...........
A0E2V0_PARTE/386-510-------------------------------DFQE-------------------------....PIYIT...........
A3LUL4_PICST/30-154-------------------------------.IDS-------------------------.KGRDQGIN...........
Q387I4_TRYB2/20-142-------------------------------.TGK-------------------------.QGADHGLS...........
Q6C975_YARLI/30-154-------------------------------.IDA-------------------------.NGKDQGIN...........
A0CFU3_PARTE/19-141-------------------------------.VEQ-------------------------..GSDKGLS...........
Q5C631_SCHJA/22-144-------------------------------.VE.-------------------------.DGKDRGQT...........
Q54WR0_DICDI/15-139-------------------------------RSDS-------------------------LHGDNPFML...........
Q4T3Y5_TETNG/3-125-------------------------------.VEK-------------------------.DGKDQGAN...........
ENT3_YEAST/29-153-------------------------------.IDS-------------------------.QGRDQGIN...........
A4QMU9_HUMAN/36-156-------------------------------.IDR-------------------------.DGKDQGVN...........
Q99PW9_RAT/40-159-------------------------------HLRD-------------------------QYGHL...............
Q7R6W4_PLAYO/24-155-------------------------------.LEN-------------------------..LRDKGVG...........
A8BIK9_GIAIC/21-146-------------------------------.KDE-------------------------.EGVDRGIN...........
Q5KGK6_CRYNJ/23-146-------------------------------.VDD-------------------------.NGKDVGSN...........
A7TEM3_VANPO/30-180-------------------------------PFSN-------------------------.DGKMEIHER..........
Q6FYA1_CANGA/16-140-------------------------------.EDE-------------------------VSGSDEGQI...........
Q2HEQ3_CHAGB/32-156-------------------------------.IDQ-------------------------.NGKDQGVN...........
A2FJT4_TRIVA/21-144-------------------------------.YEV-------------------------..GEEAALEA..........
A7TSS4_VANPO/30-180-------------------------------EFCN-------------------------.DGKMEVHER..........
Q75CS6_ASHGO/16-140-------------------------------.VDE-------------------------STGVDHGQI...........
Q559G0_DICDI/942-1056-------------------------------KISE-------------------------.AQIVKAIE...........
A7AWE1_BABBO/16-138-------------------------------...P-------------------------AHGMETASI...........
Q6DJC6_XENTR/17-140-------------------------------.LDR-------------------------.DGKDQGIN...........

PF07651

SLA2_SCHPO/14-281IAALVPLVQESYGIYRFLTSMLRALYS....TVDA..P.....ETLEPLKHRYKSQHHRLRQFYADCSNLRYLTSLISVP
HIP1_HUMAN/37-309LAPLIQVILDCSHLYDYTVKLLFKLHS....CLPA........DTLQGHRDRFMEQFTKLKDLFYRSSNLQYFKRLIQIP
PICA_DROME/21-299NMSFMLLFRDLIRLFACYNDGIINLLE....KYFD..MNKKHARDALDLYKKFLVRMDRVGEFLKVAENVGIDKGD..IP
CAP14_ARATH/26-275IEAMEYVISEVVLINGHICRGFAGFLSDVQSNMLE..ISSAEADLAMNIVAKSLSQREKLFKYFEFCRGFGVTNAQE.TS
CAP3_ARATH/31-330IVAMYPIVKESFQLYYNITEIMGVLIE....RFME..LDIHDSIKVYEIFCRVSKQFDELDPFYGWCKNMAVARSSE.YP
Q8LJJ6_ORYSJ/31-337AAALHRLVKESAVMYRELTEVMAMLAD....RFAE..LETPCCVRVHSIFTSIAKLFDELDEFYSWCRSATICRPSE.IP
Q8MQJ8_DROME/9-281LAPIVCLIQDSNALYDLSVRLMFKLHD....GVPY........DVVSGHRDRFHGLFLKLKSFYNNVRPLQYFKDLITIP
PICA_RAT/19-285NAAFMLLFKDAIRLFAAYNEGIINLLE....KYFD..MKKNQCKEGLDIYKKFLTRMTRISEFLKVAEQVGIDRGD..IP
YHC3_SCHPO/7-271ITAFRLLVGDLLVLFKAVNIGVINVLE....HYFE..MGHHDAAQSLRIYKTFVNQTEDIINYLSTARSLEFVTKFP.VP
O62142_CAEEL/7-278MLPLISVIMDTWPFFIYIVRMMYNLHS....NVSP........HELEGYRSRFQTIFEKTKQFYEECSKHQYFRCFVQIP
HIP1R_HUMAN/28-300LAPLIQVIQDCSHLYHYTVKLLFKLHS....CLPA........DTLQGHRDRFHEQFHSLRNFFRRASDMLYFKRLIQIP
CAP6_ARATH/29-317QYALALVLKESFKIYCAINDGIINLVD....MFFE..MSRHDAVKALNIYKRAGQQAENLADFYEYCKGLELARNFQ.FP
O93959_CANAX/5-271VSALVPLIAESYGIYKFCISMLRAMYQ....QLGE.D......DALSGLVERFDSQHFMLRDFYTDCHAIKFLTSLITIP
O94097_YARLL/7-273ISSLVPMIAESYGIYRFVISMLRAMHV....STGN.D......EALESLRQRFYSQHDRLRDFYYDCSTLKYLRSIVTIP
E7KHE4_YEASA/5-275ISALIPLIAESYGIYKFITSMLRAMHR....QLNDAE....GDAALQPLKERYELQHARLFEFYADCSSVKYLTTLVTIP
AP18A_YEAST/1-272IFGFKLLIQDLLALYNALNEGIITLLE....SFFE..LSHHNAERTLDLYKTFVDLTEHVVRYLKSGKTAGLK.....IP
AP18B_YEAST/2-266LYAFQLLVQDLLGLYNALNEGVITLLE....SFFE..LSIEHAKRTLDLYKDFVDMTEYVVRYLKIGKAVGLK.....IP
CAP11_ARATH/35-306QAATGNILKESFQVYMTYSDGMTALVS....MLFD..LSRPARDLACGMLRKASQQIQDLRILYDKCRGFAGMKSLD.YP
CAP12_ARATH/31-295LEAMDCLVIESINIYGRICGAVMKVL........P.LAGKSEAATVLKIVNKTTSQGEDLIVYFEFCKGFGVSNARE.IP
SLAP2_CAEEL/12-284LSPLIIAILDTSKFYDYLVKMIFKLHS....QVPP........DALEGHRSRFRTIFERTKKFYEESSNLQYFKYLVSIP
CAP13_ARATH/30-291LEAMDCVVIEIFDIYGRICSAIAKLLI....KIHP.AAGKAEAVIALKIVKKATSQGEDLALYFEFCKEFGVSNAHD.IP
CAP10_ARATH/33-303QLALSMVISESTKIYQALTDGIDNLVD....KFFD..MQRNDAVKALDMYRRAVKQAGRLSEFFEVCKSVNVGRGER.FI
CAP15_ARATH/21-281NEAMENVVSEIMEIYGWICRRIAEVLP....NVHS.KIGKTEADLALKIVAKSMKQGGELKKYFEFCKDLGVSNAQE.IP
Q7SDY1_NEUCR/13-280ISALVPLVTESYGIYKFITSMLRAMHS....STGD.......AEALEPLRGRYDAQHYRLVKFYYECSNLRYLTSLITIP
Q7SHN2_NEUCR/2-263VTVFRLLVLDLLALFQALNQAMINILG....HFFE..MSKPDAERAMDIYRNFARQTDFVVQYLSVARQYEHHTRVE.VP
Q9PTK7_XENLA/19-285NAAFMLLFKDLIKLFACYNDGIINLLE....KFFE..MKKGQCKDALEIYKRFLTRMTRVSEFMKVAEQVGIDKGD..IP
CAP4_ARATH/31-325IVALYPIVKESFQIYYDVTEIMGILIE....RFME..LDIPDSIKVYDIFCRVSKQFEELDQFYSWCKNMGIARSSE.YP
CAP9_ARATH/29-310QYALSLVLKESFKVYCAINEGIINLVE....KFFE..MPRHEAIKALEIYKRAGLQAGNLSAFYEVCKGLELARNFQ.FP
AP180_ARATH/33-329KMSLYAVMQESFDLYRDISDGLALLLD....SFFH..LQYQSCINAFQACVRASKQFEELNAFYDLSKSIGIGRTSE.YP

PF00790

VPS27_YEAST/3-145-------------------------------EDSN-------------------EE....LSELVKTILYELYVAF....
GGA2_HUMAN/20-159-------------------------------KYLG-------------------SWATGKVKGRVIEILFSWTVWF....
STAM1_MOUSE/7-139-------------------------------KGHP-------------------K.....VCEKLKALMVEWTDEF....
Q17796_CAEEL/3-136-------------------------------NKYD-------------------E.....VKNKSLEMLQCWATAF....
GGA3_HUMAN/3-142-------------------------------KYLG-------------------DRVSEKVKTKVIELLYSWTMAL....
GGA1_YEAST/16-161-------------------------------QPPL-------------------RYSK..VQQMILEAIEEWYQTICKHA
HSE1_YEAST/2-141-------------------------------HSVH-------------------IT....LKKAVTDVVKQLSDSF....
GGA2_YEAST/20-165-------------------------------HPPL-------------------RYSK..IQRLILTAIEEWYQTICKHS
HGS_HUMAN/3-139-------------------------------QVEV-------------------N.....VRNKILYLIQAWAHAF....
VPS27_SCHPO/9-146-------------------------------SPAG-------------------IDED..VKMVILRYIQSWALAV...P
Q23165_CAEEL/3-146-------------------------------KYNG-------------------KLTSDALKTEIIKLLFIWQLSI....
LSB5_SCHPO/7-145-------------------------------SEYS-------------------KP....VRKRAIHMIKLWHNDY....
YB0G_SCHPO/3-147-------------------------------RPPS-------------------RLNK..IQVMILSLIEEWRKTICRVD
TOM1_CHICK/7-148-------------------------------PKNN-------------------PPAI..VHDKVLTLIQSWADAF....
YD85_SCHPO/1-146-------------------------------HPIS-------------------RMNK..IQSKMLEMLEEWNYMLCKNN

PF01417

EPN2_ARATH/23-146.VRKKSQSLVALVNDKERI-
Q4WHZ5_ASPFU/32-156.VRNRSSELVKLLSDVDLI-
A5DG42_PICGU/26-162.IKFKIDSIYKFCTNDNEL-
Q4S9J6_TETNG/17-136.VREKSKQLVVLLKDEDRL-
A5DUV4_LODEL/15-139.IRVKAKELVSLLRDDERL-
A7RIC8_NEMVE/21-145.VRHKVKELIELVQDDDRI-
Q75CI0_ASHGO/12-141.IRSFSLSLLELMQNPALL-
A1CU98_ASPCL/15-139.VRVAAKELTTLILDEDRL-
Q5K8L7_CRYNJ/33-157.VRNRASEIALLLGDVDKI-
A3ACG9_ORYSJ/23-146.VRRKSQSLVSLVNDKERI-
A7TGV0_VANPO/16-139.IRVKAKELTSLLNDEERL-
A3BVW2_ORYSJ/29-156.MQRRCDSVLSLLTDAERL-
Q16IC4_AEDAE/7-131.VRHKVRELIDFIQDDDKL-
Q6CWF2_KLULA/29-153.VRNRASQLVKLLESDEQI-
Q6FV92_CANGA/12-141.IRFLCNDIITLLEDEELL-
Q4N8B4_THEPA/21-143.VSDKAAQIAALVLDNRTL-
A7TRZ4_VANPO/12-141.IRYIAGDLCILINDDELL-
Q5ADS1_CANAL/11-188.IRHKVNKIISLLEAPEDL-
Q2U6I6_ASPOR/32-147.VRNRSSELVKLLGDVDQI-
A6ZXG7_YEAS7/16-139.VRVKAKELTALLSDDERL-
Q7KU93_DROME/19-141.VREKAKQLVTLLKDDERL-
Q9LW61_ARATH/32-158.VQKKADQIQTLLLGKEEL-
Q010W1_OSTTA/31-153.VRHRAEKIKSLIEDPESI-
Q9BI72_CAEEL/17-139.IREKAKQITSLLSDDERL-
Q3UGL3_MOUSE/21-145.IRQKVKELVEFAQDDDRL-
Q6CSZ1_KLULA/16-140.VRVKAKELTALLRDEERL-
A4S350_OSTLU/31-152.VRHRAEKIKALVEDPRSV-
A6ZYB3_YEAS7/30-180GIRKKGELILQYLEDPQFL-
Q6CS48_KLULA/12-143.IKSLSEDISKNLKEDDFL-
Q4SE28_TETNG/17-140.IREKAKNLVALLRDEEKL-
EPN_DICDI/19-141.VRERAKQVIDLLQDDQRI-
Q8LFS0_ARATH/43-167.VRKKAAKVLKLLEKGELL-
B1AT70_MOUSE/17-140.VREKVKQVMALLKDEERL-
Q5C2A9_SCHJA/33-157.VRIKVQEVIDLLQDPDKL-
Q750B1_ASHGO/30-180GIRKKCEQVLQYTEDAGYL-
A7A0M0_YEAS7/12-142.IQKLSRNVLGLVQDDGLL-
Q6CQJ4_KLULA/30-180GIKKKCEHIIQLIEDTSYL-
Q9FRR8_ARATH/35-159.VRNIAEKVLRLLEDDMFL-
PICA_CAEEL/34-157.VRRYAKYIGEKINTYRMC-
Q4QA28_LEIMA/20-142.VRERAKKVADLLSDGLQL-
Q7SEF2_NEUCR/32-149.VRNRAKELAELLSDVERI-
ENTD1_HUMAN/14-137.IREKSKQVITLLMDEPLL-
Q4E4P1_TRYCC/20-142.VRERAKKLCDLLSDGTLL-
ENT1_SCHPO/19-142.VRTKAKEITSLLEDEHAL-
Q5CW24_CRYPI/28-150.IREKSKCILNLINDPMLL-
Q6MFM0_NEUCS/15-151FIRVAAKDLTALLLDEERL-
P92917_AVEFA/25-148.VRKKVETLVGIINDKDRI-
YCTB_SCHPO/30-154.VRTRAKELVELLNDSERI-
Q6C7P2_YARLI/16-139.IRSRAKEITSLLLDDERL-
A0E2V0_PARTE/386-510.IRQKAGNIANQLSNRKLL-
A3LUL4_PICST/30-154.VRNRAKNLIGLLNDDALI-
Q387I4_TRYB2/20-142.VRERAKKLFDLLSDPATL-
Q6C975_YARLI/30-154.VRNRAKELNELLKDVARI-
A0CFU3_PARTE/19-141.IRDKTKQLVDLLSNEKLI-
Q5C631_SCHJA/22-144.VREKARNLSMLLRDEERL-
Q54WR0_DICDI/15-139.VRKESQDILNILYQYSSN-
Q4T3Y5_TETNG/3-125.VRDKAKVVLVLMEDDEKL-
ENT3_YEAST/29-153.VRTRVKALIELLSDDNKI-
A4QMU9_HUMAN/36-156.VREKVKQVMALLKDEERL-
Q99PW9_RAT/40-159.VNIYTKLLLTKISFHLKH-
Q7R6W4_PLAYO/24-155.IREISNNILNLLRDNKYL-
A8BIK9_GIAIC/21-146.VRKRAETVRELAMSDDID-
Q5KGK6_CRYNJ/23-146.VRQKAKDITNLLQDESRL-
A7TEM3_VANPO/30-180GIHKKSELIVQLIEDPDFL-
Q6FYA1_CANGA/16-140.IRVKAKELTSLLTDDERL-
Q2HEQ3_CHAGB/32-156.VRHRAKELAELLGDVERI-
A2FJT4_TRIVA/21-144VVRKKAQDIINLVNDSDLY-
A7TSS4_VANPO/30-180GIQKKCEVIINLVDDPEFL-
Q75CS6_ASHGO/16-140.IRVKARELVALLRDEERL-
Q559G0_DICDI/942-1056.IRERAKQVIDLLQDDQRI-
A7AWE1_BABBO/16-138.IKDKAIDLINLVCNPPIL-
Q6DJC6_XENTR/17-140.VREKAKQIVSLLKDEERL-

PF07651

SLA2_SCHPO/14-281RLPHDPPD.LEGDDNIPDLP
HIP1_HUMAN/37-309QLPENPPNFLRASALSEHIS
PICA_DROME/21-299DLTKAPSSLLDALEQHLATL
CAP14_ARATH/26-275NILRITESQMIVLDKLLHIA
CAP3_ARATH/31-330ELEKITQKKLDLMDEFIRDK
Q8LJJ6_ORYSJ/31-337EVERVAQKKLDLMDEFIRDR
Q8MQJ8_DROME/9-281ELPDSSPNFKSQNDFTSYVP
PICA_RAT/19-285DLSQAPSSLLDALEQHLASL
YHC3_SCHPO/7-271NIKHAPISLTASLEEYLNDP
O62142_CAEEL/7-278TFPLHAPNFFTQSDLESYQT
HIP1R_HUMAN/28-300RLPEGPPNFLRASALAEHIK
CAP6_ARATH/29-317TLRQPPPSFLATMEDYIKEA
O93959_CANAX/5-271RLPNSAPNLKVTDDGQPISR
O94097_YARLL/7-273QLGKNPPNLLEEE.....DG
E7KHE4_YEASA/5-275KLPVDAPDVFLINDVDESKE
AP18A_YEAST/1-272VIKHITTKLVRSLEEHLIED
AP18B_YEAST/2-266VIKHITTKLINSLEEHLREE
CAP11_ARATH/35-306SVQAISMDHIVALEECSSYG
CAP12_ARATH/31-295QFVRIPEEEVEAIEKMIDTV
SLAP2_CAEEL/12-284TLPSHAPNFLQQSDLESYRT
CAP13_ARATH/30-291KFVTIPEEDIKAIEKVINGV
CAP10_ARATH/33-303KIEQPPTSFLQAMEEYVKEA
CAP15_ARATH/21-281NFVRIPEADVIHLDELVRTA
Q7SDY1_NEUCR/13-280KLPQDPPNLLAEDENAPALP
Q7SHN2_NEUCR/2-263KLKHAPVNLGRQLEDYLKDP
Q9PTK7_XENLA/19-285DLTQAPSSLLETLEQHLNTL
CAP4_ARATH/31-325EIEKITQKKLDLMDEFIRDK
CAP9_ARATH/29-310VLREPPQSFLTTMEEYMRDA
AP180_ARATH/33-329SIQKISLELLETLQEFLKDQ

PF00790

VPS27_YEAST/3-145KNDSQLNYVAKVYDKLISRG
GGA2_HUMAN/20-159...PEDIKIRDAYQMLKKQG
STAM1_MOUSE/7-139KNDPQLSLISAMIKNLKEQG
Q17796_CAEEL/3-136ANKPEYKMVVDTHNLMKLAG
GGA3_HUMAN/3-142...PEEAKIKDAYHMLKRQG
GGA1_YEAST/16-161SYKDDLQYINDMHKLLKYKG
HSE1_YEAST/2-141KDDPSLRAMGDLYDKIKRKA
GGA2_YEAST/20-165SYKNDMGYIRDMHRLLKYKG
HGS_HUMAN/3-139RNEPKYKVVQDTYQIMKVEG
VPS27_SCHPO/9-146DTNSPLSYIIHVYQNLK.DG
Q23165_CAEEL/3-146KHIPKYKQVYESLKLSKIIT
LSB5_SCHPO/7-145SNVRGMESMSSLVSRLPQRQ
YB0G_SCHPO/3-147RYKEDLGFIRDMHRLLSYKG
TOM1_CHICK/7-148RSSPDLTGVVAVYEDLRRKG
YD85_SCHPO/1-146RHREDFSRIHDIRELMAFRG

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window