Sequence alignment for CL0012

PF02291

TAF9_YEAST/19-152--------------------------------------------------------------------------------
TAF9_HUMAN/2-130--------------------------------------------------------------------------------
TAF9_DROME/8-136--------------------------------------------------------------------------------
O45784_CAEEL/13-136--------------------------------------------------------------------------------
TAF9_SCHPO/3-133--------------------------------------------------------------------------------

PF15510

B2RVH1_MOUSE/1-86--------------------------------------------------------------------------------
F1S2W8_PIG/1-102--------------------------------------------------------------------------------
G7P379_MACFA/1-103--------------------------------------------------------------------------------
H0VLK4_CAVPO/1-103--------------------------------------------------------------------------------
D3Z8J2_RAT/1-86--------------------------------------------------------------------------------
G1P8B1_MYOLU/1-88--------------------------------------------------------------------------------

PF02969

TAF6_XENLA/9-74--------------------------------------------------------------------------------
TAF6L_HUMAN/9-73--------------------------------------------------------------------------------
TAF6_SCHPO/3-68--------------------------------------------------------------------------------
Q8LRG9_ORYSJ/1-68--------------------------------------------------------------------------------
TAF6_YEAST/9-74--------------------------------------------------------------------------------
Q9MAU3_ARATH/1-68--------------------------------------------------------------------------------
Q9DDC0_PLEWA/11-76--------------------------------------------------------------------------------
TAF6_DROME/18-83--------------------------------------------------------------------------------
TAF6_HUMAN/11-76--------------------------------------------------------------------------------
Q9GZI6_CAEEL/24-85--------------------------------------------------------------------------------

PF07524

SPT7_SCHPO/707-783--------------------------------------------------------------------------------
TAF8_DANRE/32-108--------------------------------------------------------------------------------
TAF3_SCHPO/7-83--------------------------------------------------------------------------------
ST65G_HUMAN/151-230--------------------------------------------------------------------------------
Q8LFR3_ARATH/24-100--------------------------------------------------------------------------------
Q9VP40_DROME/6-77--------------------------------------------------------------------------------
Q9SA19_ARATH/24-100--------------------------------------------------------------------------------
TAF8_HUMAN/29-106--------------------------------------------------------------------------------
Q9NAZ5_DROHY/4-80--------------------------------------------------------------------------------
Q8MSB9_DROME/4-80--------------------------------------------------------------------------------
Q7S5N4_NEUCR/125-200--------------------------------------------------------------------------------
Q7YTH5_CAEEL/66-142--------------------------------------------------------------------------------

PF15630

A3GI04_PICST/11-91--------------------------------------------------------------------------------
A6RJU4_BOTFB/10-85--------------------------------------------------------------------------------
A7RMQ5_NEMVE/23-98--------------------------------------------------------------------------------
A7TEH2_VANPO/17-91--------------------------------------------------------------------------------
B2W5N7_PYRTR/12-87--------------------------------------------------------------------------------
B3DJV8_DANRE/9-84--------------------------------------------------------------------------------
B3RZC1_TRIAD/15-90--------------------------------------------------------------------------------
B6JX09_SCHJY/4-85--------------------------------------------------------------------------------
B6QUS3_PENMQ/14-92--------------------------------------------------------------------------------
B7PXV9_IXOSC/11-86--------------------------------------------------------------------------------
C4Y931_CLAL4/26-101--------------------------------------------------------------------------------
C5DNB5_LACTC/22-96--------------------------------------------------------------------------------
C5G144_ARTOC/13-88--------------------------------------------------------------------------------
C5PFL7_COCP7/14-89--------------------------------------------------------------------------------
C7YTU2_NECH7/15-94--------------------------------------------------------------------------------
D3B378_POLPA/165-243--------------------------------------------------------------------------------
D5GA13_TUBMM/32-107--------------------------------------------------------------------------------
D7FWQ8_ECTSI/32-105--------------------------------------------------------------------------------
E4ZQ21_LEPMJ/13-88--------------------------------------------------------------------------------
E9CD47_CAPO3/14-89--------------------------------------------------------------------------------
E9ECA7_METAQ/10-85--------------------------------------------------------------------------------
F0XLX6_GROCL/7-82--------------------------------------------------------------------------------
F4PRK1_DICFS/235-311--------------------------------------------------------------------------------
F4RWE9_MELLP/40-115--------------------------------------------------------------------------------
F6Y3J5_MONDO/1-76--------------------------------------------------------------------------------
F7DQN4_XENTR/13-88--------------------------------------------------------------------------------
F7VU88_SORMK/11-86--------------------------------------------------------------------------------
F9WY71_MYCGM/13-88--------------------------------------------------------------------------------
G0V9K8_NAUCC/14-94--------------------------------------------------------------------------------
G3BEG3_CANTC/8-83--------------------------------------------------------------------------------
G3MSD4_9ACAR/15-89--------------------------------------------------------------------------------
G3PEU4_GASAC/26-101--------------------------------------------------------------------------------
G3VT77_SARHA/17-92--------------------------------------------------------------------------------
G4LYK5_SCHMA/9-84--------------------------------------------------------------------------------
G4MZ92_MAGO7/9-84--------------------------------------------------------------------------------
G6DRA0_DANPL/11-86--------------------------------------------------------------------------------
G8YL18_PICSO/12-89--------------------------------------------------------------------------------
H1VQ95_COLHI/11-86--------------------------------------------------------------------------------
H2LES2_ORYLA/10-85--------------------------------------------------------------------------------
H2N958_PONAB/17-92--------------------------------------------------------------------------------
H6C6E0_EXODN/12-87--------------------------------------------------------------------------------
H9J6V9_BOMMO/11-84--------------------------------------------------------------------------------
H9KVI3_CHICK/15-90--------------------------------------------------------------------------------
I1FQJ7_AMPQE/21-96--------------------------------------------------------------------------------
Q54PV0_DICDI/238-315--------------------------------------------------------------------------------
Q6BIJ2_DEBHA/13-90--------------------------------------------------------------------------------

PF00125

Q8IL74_PLAF7/27-103--------------------------------------------------------------------------------
H2BWT_HUMAN/75-145--------------------------------------------------------------------------------
Q7PVU9_ANOGA/105-178--------------------------------------------------------------------------------
H4_CAEEL/25-94--------------------------------------------------------------------------------
H2A2_XENLA/18-91--------------------------------------------------------------------------------
H2AB2_HUMAN/22-95--------------------------------------------------------------------------------
O00912_LEIIN/23-92--------------------------------------------------------------------------------
O02612_LEIIN/19-89--------------------------------------------------------------------------------
O02613_CRIFA/18-93--------------------------------------------------------------------------------
O02648_DROSI/58-132--------------------------------------------------------------------------------
O15582_ENTHI/30-100--------------------------------------------------------------------------------
O18643_CHAVR/29-99--------------------------------------------------------------------------------
CENPA_MOUSE/51-127--------------------------------------------------------------------------------
O44009_LEIBR/52-126--------------------------------------------------------------------------------
H2B_CAPAN/52-122--------------------------------------------------------------------------------
O96761_9TRYP/19-89--------------------------------------------------------------------------------
O96955_PLAVI/25-95--------------------------------------------------------------------------------
H2B_EUPCR/20-90--------------------------------------------------------------------------------
HCP3L_CAEEL/180-257--------------------------------------------------------------------------------
HAP5_YEAST/152-225--------------------------------------------------------------------------------
Q19649_CAEEL/40-114--------------------------------------------------------------------------------
Q23429_CAEEL/30-104--------------------------------------------------------------------------------
E2RTQ0_GIAIN/25-101--------------------------------------------------------------------------------
E2RU60_GIAIN/21-90--------------------------------------------------------------------------------
E2RU15_GIAIN/15-88--------------------------------------------------------------------------------
A8BYH2_GIAIC/69-146--------------------------------------------------------------------------------
A8B678_GIAIC/68-148--------------------------------------------------------------------------------
A8B471_GIAIC/102-178--------------------------------------------------------------------------------
Q7RRA6_PLAYO/27-103--------------------------------------------------------------------------------
Q7XV46_ORYSJ/214-290--------------------------------------------------------------------------------
Q7XYY4_PYRLU/77-151--------------------------------------------------------------------------------
Q7Z106_PARTE/51-125--------------------------------------------------------------------------------
CENPA_DANRE/65-140--------------------------------------------------------------------------------
H2AV3_ORYSJ/32-106--------------------------------------------------------------------------------
H2A3_ORYSJ/19-92--------------------------------------------------------------------------------
Q867G5_TRYBB/61-135--------------------------------------------------------------------------------
Q867U7_TRYBB/41-111--------------------------------------------------------------------------------
Q86EU0_SCHJA/18-91--------------------------------------------------------------------------------
CENPA_CANGA/159-236--------------------------------------------------------------------------------
Q8BP16_MOUSE/15-88--------------------------------------------------------------------------------
Q8IDZ1_PLAF7/90-167--------------------------------------------------------------------------------
Q8LK76_MAIZE/76-152--------------------------------------------------------------------------------
Q8NIA3_HUMAN/97-169--------------------------------------------------------------------------------
H3L_ENCCU/57-130--------------------------------------------------------------------------------
H4_ENCCU/27-96--------------------------------------------------------------------------------
H31_ENCCU/59-135--------------------------------------------------------------------------------
Q8T9Z4_DROOR/130-206--------------------------------------------------------------------------------
Q8TA36_HETGL/23-92--------------------------------------------------------------------------------
Q8VEE3_MOUSE/32-99--------------------------------------------------------------------------------
H2BV_BOVIN/29-99--------------------------------------------------------------------------------
Q92646_HUMAN/13-84--------------------------------------------------------------------------------
Q98SC6_GUITH/26-100--------------------------------------------------------------------------------
Q9CQ70_MOUSE/15-88--------------------------------------------------------------------------------
H2BV_MOUSE/30-100--------------------------------------------------------------------------------
Q9DAB5_MOUSE/130-200--------------------------------------------------------------------------------
Q9DAD9_MOUSE/13-86--------------------------------------------------------------------------------
Q9GRH3_STYLE/100-174--------------------------------------------------------------------------------
H3L1_LILLO/70-144--------------------------------------------------------------------------------
H2B_LILLO/48-118--------------------------------------------------------------------------------
H2B2_ARATH/145-215--------------------------------------------------------------------------------
H2A8_ARATH/23-97--------------------------------------------------------------------------------
Q9XG41_GUITH/8-78--------------------------------------------------------------------------------
H2A1_LILLO/18-91--------------------------------------------------------------------------------
CENPA_SCHPO/38-118--------------------------------------------------------------------------------

PF04719

Q20563_CAEEL/236-327--------------------------------------------------------------------------------
Q9M565_ARATH/105-194--------------------------------------------------------------------------------
Q9AW46_GUITH/30-124--------------------------------------------------------------------------------
TAF11_DROME/89-177--------------------------------------------------------------------------------
TAF11_MOUSE/106-194--------------------------------------------------------------------------------
Q9C2R5_NEUCS/200-281--------------------------------------------------------------------------------
TAF11_YEAST/124-213--------------------------------------------------------------------------------
Q9LNS8_ARATH/128-217--------------------------------------------------------------------------------
TAF11_SCHPO/93-181--------------------------------------------------------------------------------
Q21417_CAEEL/221-312--------------------------------------------------------------------------------

PF02269

SUPT3_HUMAN/106-198--------------------------------------------------------------------------------
Q17957_CAEEL/27-116--------------------------------------------------------------------------------
SPT3_YEAST/5-96--------------------------------------------------------------------------------
SPT3_SCHPO/8-99--------------------------------------------------------------------------------
TAF13_YEAST/9-101--------------------------------------------------------------------------------
TAF13_HUMAN/30-119--------------------------------------------------------------------------------

PF03847

TAF12_YEAST/416-488--------------------------------------------------------------------------------
TAF12_SCHPO/344-411--------------------------------------------------------------------------------
TAF12_DROME/93-160--------------------------------------------------------------------------------
Q9VR21_DROME/67-133--------------------------------------------------------------------------------
Q9SR71_ARATH/401-468--------------------------------------------------------------------------------
TAF12_HUMAN/59-126--------------------------------------------------------------------------------
Q9U226_CAEEL/233-297--------------------------------------------------------------------------------
Q9LNR1_ARATH/526-593--------------------------------------------------------------------------------

PF00808

NFYB9_ARATH/62-127--------------------------------------------------------------------------------
HARB_PYRSG/2-65--------------------------------------------------------------------------------
HFO2_METFO/2-65--------------------------------------------------------------------------------
HJA2_METJA/2-65--------------------------------------------------------------------------------
NFYB4_ARATH/6-71--------------------------------------------------------------------------------
Q20237_CAEEL/64-128--------------------------------------------------------------------------------
HMFB_METFE/1-64--------------------------------------------------------------------------------
Q9V452_DROME/18-83--------------------------------------------------------------------------------
NFYB5_ARATH/54-119--------------------------------------------------------------------------------
HAF2_ARCFU/2-65--------------------------------------------------------------------------------
Q9GSP1_DROME/10-74--------------------------------------------------------------------------------
Q9FHS0_ARATH/10-74--------------------------------------------------------------------------------
NC2B_HUMAN/11-75--------------------------------------------------------------------------------
HAP3_KLULA/25-90--------------------------------------------------------------------------------
HAF1_ARCFU/6-69--------------------------------------------------------------------------------
HFOB_METFO/1-64--------------------------------------------------------------------------------
Q9LN09_ARATH/108-172--------------------------------------------------------------------------------
HAP3_SCHPO/10-75--------------------------------------------------------------------------------
O59848_ASPOZ/46-111--------------------------------------------------------------------------------
O93641_9EURY/3-67--------------------------------------------------------------------------------
O76256_SCHMA/27-92--------------------------------------------------------------------------------
NC2B_SCHPO/10-75--------------------------------------------------------------------------------
Q9LHG0_ARATH/7-71--------------------------------------------------------------------------------
O17072_CAEEL/108-174--------------------------------------------------------------------------------
O73745_XENLA/39-103--------------------------------------------------------------------------------
O45550_CAEEL/20-84--------------------------------------------------------------------------------
NC2B_ARATH/14-79--------------------------------------------------------------------------------
O17286_CAEEL/64-129--------------------------------------------------------------------------------

PF15511

H2QBC7_PANTR/25-514PRTPRRPRS...ARAG.ARRALLETA...SSRRLSGQTRTIARGRSHGARSIGRS...AHIQASGHLEEQTPRTLLKNIL
G3SYD4_LOXAF/26-492PRTPLRPRS...ARTS.AKRALLETP...SSRSLSSQRKVTARRQSHGARAIGRW...AHVQARGHLEEQTPRTLLKNIL
E2RJV5_CANFA/26-460TRTPRRRRS...ARIG.VQKARLEMP.......LSSPTKMNVSRRSQRARSIERL...ARVQTSGHLDEQTPRTLLKNIL
F6PKQ6_HORSE/26-517PSTPRRPRS...ARAG.AQRALLETP...SSRRLSSQTKTTARRRSQRIRSIGKL...AHVQASGYLEEQTPRTLLKNIL
F1S2K5_PIG/26-517PRTPRRPRS...ARIG.AQISPLETS...SSRRLRSQTKMSARRRSHRIRSIDRL...AHIQASGHLEEQTPRTLLKNIL
G1PFK4_MYOLU/26-518PRTPRRRQS...TRAG.VQRTPLGTP...FSMRLRSQTKTTAGRQPHRARSIGRL...AHIQTRGQLKEQTPRTLLENIL
H0XDJ1_OTOGA/25-517PRTPRRPRS...AGAG.AQRSLLETP...SSRRLSSQRKTTARWHSSGAKSVSRL...PHAPTSGHLEEQTPRTLLNNIL
G1SQR3_RABIT/26-502SRSPRRPRS...IRAG.TQRTLLETP...SPRRRSSQRKSTARRHSHGTRSVSRL...AHTQASRHLDEQTPRTLLKNIL
H0UV87_CAVPO/26-506FCTPRRRRS...ARIS.AQRALLETP...SSRRQSTQTKVTARQHFHGARSTGRL...VPGQASGHLEEQTPRTLLKNIL
CENPT_RAT/26-471SHTPRRRQS...TQTN.PQRRRSQTP...YSKRQGSQRKTSTRKHSHGTGSVGRL...ARVQGHGHLEEQTPRTLLQNIL
F7C6J3_ORNAN/50-507PRASHRRI....IRASSSRPPESQASSRPAPPRRDKM..............................DEETPRTILRNIM
B2WAR3_PYRTR/18-424QMTPRNDAPLQLITPFRRAISAGPTPG........................................SRRTPI....ART
Q0V6N5_PHANO/18-452IATPDARIE........PKRHHFFAPQAQAGRHAEDQQLDHYHRDEWRRPPHMRFEPSENEPM....PQEHQETIGDEVG
E4ZUA3_LEPMJ/75-488PTTPHA......IKALRERANAARTPG..NNRRRSGRM.............................QRETPRDLLRGLS
H1V6T6_COLHI/84-483NTTPHARAA...YRTIDARRAAALTPG..KNKRRESFRP............................RRESLHDVLRGLS
G2WXZ9_VERDV/71-445APTPHARAA...SQYLDQRRAAM.TPG...RRRQSVGVR............................RRESLFDNLRALS
F0XUM0_GROCL/71-509ARTPHARAA...LLALDTRRAAMFTPGGRQSRRKSGRY.............................LRESPRDLLRNLS
G2Q011_THIHA/56-448TATPHARAA...FRAIDSRRAAILTPH..RARRKSLRE.............................VRDSPRDFLLSLG
G2R3Q2_THITE/60-455TATPHARAA...FRAIDSRRAAIFTPH..RARRKSLRE.............................VRDSPRDFLLSLG
Q2H4H2_CHAGB/63-448PPTPHARAA...FRTIDSRRAAIFTPH..RTRRKSVRE.............................VRDSPRDFLLSLG
B2AUG9_PODAN/52-455TATPHARAA...FRTIDSRRAAIFTPH..RARRKSVRE.............................ARDSPRDLLLGLG
F7VUV4_SORMK/70-543NLTPHVRAA...YRAIDSRRAAILTPH..HARRRSLRE.............................ARETPRNFLLQLG
G5EH18_MAGO7/96-512TATPHARRA...IEVFKGRRTAIFNTP..GGRRKTLGAN..............KR...RASQGGPDPQKDGPFDALRHLS
C7YN20_NECH7/70-475APTPHAKAA...RRALDQRRTAIFTPG..KNRRRSLMQ.............................QRETPLDILRTLG
I1RX16_GIBZE/59-455APTPHAKAA...RRLLDQRRTAMFTPG..KNRRQSMMQ.............................QRETPLDVLRHLG
E9EUR1_METAR/77-484APTPHAKAA...RQALDQRRNALLTPG..KIRRQSLVD.............................QRETPMGLLGRLA
G3JMA4_CORMM/68-522APTPHATAA...RRALEQRRTAMFTPG..KNRRRSLRE.............................QHQTPMNILNQLA
H6BTF1_EXODN/11-447PSTPHA......IRALQQRSGANKTRSARRPRALSDTV.............................RPDSARGILRQLA
A6SS64_BOTFB/43-483TLTPHGRAA...LREVEARRAGL.TPG..KDRRRSGRQ.............................QRETPRDVLRLLS
Q5B3X8_EMENI/64-438PSTPYGVRA........MQRRAANTPG..RERRKSGRV.............................QRETVFDVLRNLS
G7XFC4_ASPKW/68-429PSTPYRVQA........LQRRAANTPG..RDRRRSGRI.............................QRETTFDILRNLG
Q4WWL8_ASPFU/76-441PSTPYGLRA........MQRRAANTPG..RDRRKSGRI.............................QRETTFDILRNLG
B6HEI8_PENCW/70-421PATPYGLRA........RQQRAANTPG..RDRRRSGRM.............................QRETTFDILRNLG
B8MMW5_TALSN/60-429PLTPFALRA........IQRRTANTPG..RDRRRSTRGP............................QRETAFDILRNLG
C5FZG9_ARTOC/82-443PVTPHTIRA.......FQRRAATYTPG..RDRRKSQRF.............................KRETPMDILKNLG
C5PIR4_COCP7/46-397PATPHALKA.......FQRRAAVYTPG..RDRRKSGRV.............................QRETPLDILRNLG
C1H556_PARBA/152-504PATPHALRA.......LQRRAATYTPG..RDRRKSGRV.............................QRETPMDILRNLG
D5G8P1_TUBMM/86-466KRTARSPHV...VRAFEQRRAV..TPG..RERRKSGRYPA...........................ARETPRDLLRALS
G1XD77_ARTOA/125-537LTTPHAIRG..........YSNRPTPHKNQGKRRNSRFAA...........................EDDDIFQALKQFS
B6K2P7_SCHJY/48-429GITPYKQRA.............LILQNSVKKRRTLSSSAGKA.........................FTKTPRDNLRLLS

PF02291

TAF9_YEAST/19-152--------------------------------------------------------------------------------
TAF9_HUMAN/2-130--------------------------------------------------------------------------------
TAF9_DROME/8-136--------------------------------------------------------------------------------
O45784_CAEEL/13-136--------------------------------------------------------------------------------
TAF9_SCHPO/3-133--------------------------------------------------------------------------------

PF15510

B2RVH1_MOUSE/1-86--------------------------------------------------------------------------------
F1S2W8_PIG/1-102--------------------------------------------------------------------------------
G7P379_MACFA/1-103--------------------------------------------------------------------------------
H0VLK4_CAVPO/1-103--------------------------------------------------------------------------------
D3Z8J2_RAT/1-86--------------------------------------------------------------------------------
G1P8B1_MYOLU/1-88--------------------------------------------------------------------------------

PF02969

TAF6_XENLA/9-74--------------------------------------------------------------------------------
TAF6L_HUMAN/9-73--------------------------------------------------------------------------------
TAF6_SCHPO/3-68--------------------------------------------------------------------------------
Q8LRG9_ORYSJ/1-68--------------------------------------------------------------------------------
TAF6_YEAST/9-74--------------------------------------------------------------------------------
Q9MAU3_ARATH/1-68--------------------------------------------------------------------------------
Q9DDC0_PLEWA/11-76--------------------------------------------------------------------------------
TAF6_DROME/18-83--------------------------------------------------------------------------------
TAF6_HUMAN/11-76--------------------------------------------------------------------------------
Q9GZI6_CAEEL/24-85--------------------------------------------------------------------------------

PF07524

SPT7_SCHPO/707-783--------------------------------------------------------------------------------
TAF8_DANRE/32-108--------------------------------------------------------------------------------
TAF3_SCHPO/7-83--------------------------------------------------------------------------------
ST65G_HUMAN/151-230--------------------------------------------------------------------------------
Q8LFR3_ARATH/24-100--------------------------------------------------------------------------------
Q9VP40_DROME/6-77--------------------------------------------------------------------------------
Q9SA19_ARATH/24-100--------------------------------------------------------------------------------
TAF8_HUMAN/29-106--------------------------------------------------------------------------------
Q9NAZ5_DROHY/4-80--------------------------------------------------------------------------------
Q8MSB9_DROME/4-80--------------------------------------------------------------------------------
Q7S5N4_NEUCR/125-200--------------------------------------------------------------------------------
Q7YTH5_CAEEL/66-142--------------------------------------------------------------------------------

PF15630

A3GI04_PICST/11-91--------------------------------------------------------------------------------
A6RJU4_BOTFB/10-85--------------------------------------------------------------------------------
A7RMQ5_NEMVE/23-98--------------------------------------------------------------------------------
A7TEH2_VANPO/17-91--------------------------------------------------------------------------------
B2W5N7_PYRTR/12-87--------------------------------------------------------------------------------
B3DJV8_DANRE/9-84--------------------------------------------------------------------------------
B3RZC1_TRIAD/15-90--------------------------------------------------------------------------------
B6JX09_SCHJY/4-85--------------------------------------------------------------------------------
B6QUS3_PENMQ/14-92--------------------------------------------------------------------------------
B7PXV9_IXOSC/11-86--------------------------------------------------------------------------------
C4Y931_CLAL4/26-101--------------------------------------------------------------------------------
C5DNB5_LACTC/22-96--------------------------------------------------------------------------------
C5G144_ARTOC/13-88--------------------------------------------------------------------------------
C5PFL7_COCP7/14-89--------------------------------------------------------------------------------
C7YTU2_NECH7/15-94--------------------------------------------------------------------------------
D3B378_POLPA/165-243--------------------------------------------------------------------------------
D5GA13_TUBMM/32-107--------------------------------------------------------------------------------
D7FWQ8_ECTSI/32-105--------------------------------------------------------------------------------
E4ZQ21_LEPMJ/13-88--------------------------------------------------------------------------------
E9CD47_CAPO3/14-89--------------------------------------------------------------------------------
E9ECA7_METAQ/10-85--------------------------------------------------------------------------------
F0XLX6_GROCL/7-82--------------------------------------------------------------------------------
F4PRK1_DICFS/235-311--------------------------------------------------------------------------------
F4RWE9_MELLP/40-115--------------------------------------------------------------------------------
F6Y3J5_MONDO/1-76--------------------------------------------------------------------------------
F7DQN4_XENTR/13-88--------------------------------------------------------------------------------
F7VU88_SORMK/11-86--------------------------------------------------------------------------------
F9WY71_MYCGM/13-88--------------------------------------------------------------------------------
G0V9K8_NAUCC/14-94--------------------------------------------------------------------------------
G3BEG3_CANTC/8-83--------------------------------------------------------------------------------
G3MSD4_9ACAR/15-89--------------------------------------------------------------------------------
G3PEU4_GASAC/26-101--------------------------------------------------------------------------------
G3VT77_SARHA/17-92--------------------------------------------------------------------------------
G4LYK5_SCHMA/9-84--------------------------------------------------------------------------------
G4MZ92_MAGO7/9-84--------------------------------------------------------------------------------
G6DRA0_DANPL/11-86--------------------------------------------------------------------------------
G8YL18_PICSO/12-89--------------------------------------------------------------------------------
H1VQ95_COLHI/11-86--------------------------------------------------------------------------------
H2LES2_ORYLA/10-85--------------------------------------------------------------------------------
H2N958_PONAB/17-92--------------------------------------------------------------------------------
H6C6E0_EXODN/12-87--------------------------------------------------------------------------------
H9J6V9_BOMMO/11-84--------------------------------------------------------------------------------
H9KVI3_CHICK/15-90--------------------------------------------------------------------------------
I1FQJ7_AMPQE/21-96--------------------------------------------------------------------------------
Q54PV0_DICDI/238-315--------------------------------------------------------------------------------
Q6BIJ2_DEBHA/13-90--------------------------------------------------------------------------------

PF00125

Q8IL74_PLAF7/27-103--------------------------------------------------------------------------------
H2BWT_HUMAN/75-145--------------------------------------------------------------------------------
Q7PVU9_ANOGA/105-178--------------------------------------------------------------------------------
H4_CAEEL/25-94--------------------------------------------------------------------------------
H2A2_XENLA/18-91--------------------------------------------------------------------------------
H2AB2_HUMAN/22-95--------------------------------------------------------------------------------
O00912_LEIIN/23-92--------------------------------------------------------------------------------
O02612_LEIIN/19-89--------------------------------------------------------------------------------
O02613_CRIFA/18-93--------------------------------------------------------------------------------
O02648_DROSI/58-132--------------------------------------------------------------------------------
O15582_ENTHI/30-100--------------------------------------------------------------------------------
O18643_CHAVR/29-99--------------------------------------------------------------------------------
CENPA_MOUSE/51-127--------------------------------------------------------------------------------
O44009_LEIBR/52-126--------------------------------------------------------------------------------
H2B_CAPAN/52-122--------------------------------------------------------------------------------
O96761_9TRYP/19-89--------------------------------------------------------------------------------
O96955_PLAVI/25-95--------------------------------------------------------------------------------
H2B_EUPCR/20-90--------------------------------------------------------------------------------
HCP3L_CAEEL/180-257--------------------------------------------------------------------------------
HAP5_YEAST/152-225--------------------------------------------------------------------------------
Q19649_CAEEL/40-114--------------------------------------------------------------------------------
Q23429_CAEEL/30-104--------------------------------------------------------------------------------
E2RTQ0_GIAIN/25-101--------------------------------------------------------------------------------
E2RU60_GIAIN/21-90--------------------------------------------------------------------------------
E2RU15_GIAIN/15-88--------------------------------------------------------------------------------
A8BYH2_GIAIC/69-146--------------------------------------------------------------------------------
A8B678_GIAIC/68-148--------------------------------------------------------------------------------
A8B471_GIAIC/102-178--------------------------------------------------------------------------------
Q7RRA6_PLAYO/27-103--------------------------------------------------------------------------------
Q7XV46_ORYSJ/214-290--------------------------------------------------------------------------------
Q7XYY4_PYRLU/77-151--------------------------------------------------------------------------------
Q7Z106_PARTE/51-125--------------------------------------------------------------------------------
CENPA_DANRE/65-140--------------------------------------------------------------------------------
H2AV3_ORYSJ/32-106--------------------------------------------------------------------------------
H2A3_ORYSJ/19-92--------------------------------------------------------------------------------
Q867G5_TRYBB/61-135--------------------------------------------------------------------------------
Q867U7_TRYBB/41-111--------------------------------------------------------------------------------
Q86EU0_SCHJA/18-91--------------------------------------------------------------------------------
CENPA_CANGA/159-236--------------------------------------------------------------------------------
Q8BP16_MOUSE/15-88--------------------------------------------------------------------------------
Q8IDZ1_PLAF7/90-167--------------------------------------------------------------------------------
Q8LK76_MAIZE/76-152--------------------------------------------------------------------------------
Q8NIA3_HUMAN/97-169--------------------------------------------------------------------------------
H3L_ENCCU/57-130--------------------------------------------------------------------------------
H4_ENCCU/27-96--------------------------------------------------------------------------------
H31_ENCCU/59-135--------------------------------------------------------------------------------
Q8T9Z4_DROOR/130-206--------------------------------------------------------------------------------
Q8TA36_HETGL/23-92--------------------------------------------------------------------------------
Q8VEE3_MOUSE/32-99--------------------------------------------------------------------------------
H2BV_BOVIN/29-99--------------------------------------------------------------------------------
Q92646_HUMAN/13-84--------------------------------------------------------------------------------
Q98SC6_GUITH/26-100--------------------------------------------------------------------------------
Q9CQ70_MOUSE/15-88--------------------------------------------------------------------------------
H2BV_MOUSE/30-100--------------------------------------------------------------------------------
Q9DAB5_MOUSE/130-200--------------------------------------------------------------------------------
Q9DAD9_MOUSE/13-86--------------------------------------------------------------------------------
Q9GRH3_STYLE/100-174--------------------------------------------------------------------------------
H3L1_LILLO/70-144--------------------------------------------------------------------------------
H2B_LILLO/48-118--------------------------------------------------------------------------------
H2B2_ARATH/145-215--------------------------------------------------------------------------------
H2A8_ARATH/23-97--------------------------------------------------------------------------------
Q9XG41_GUITH/8-78--------------------------------------------------------------------------------
H2A1_LILLO/18-91--------------------------------------------------------------------------------
CENPA_SCHPO/38-118--------------------------------------------------------------------------------

PF04719

Q20563_CAEEL/236-327--------------------------------------------------------------------------------
Q9M565_ARATH/105-194--------------------------------------------------------------------------------
Q9AW46_GUITH/30-124--------------------------------------------------------------------------------
TAF11_DROME/89-177--------------------------------------------------------------------------------
TAF11_MOUSE/106-194--------------------------------------------------------------------------------
Q9C2R5_NEUCS/200-281--------------------------------------------------------------------------------
TAF11_YEAST/124-213--------------------------------------------------------------------------------
Q9LNS8_ARATH/128-217--------------------------------------------------------------------------------
TAF11_SCHPO/93-181--------------------------------------------------------------------------------
Q21417_CAEEL/221-312--------------------------------------------------------------------------------

PF02269

SUPT3_HUMAN/106-198--------------------------------------------------------------------------------
Q17957_CAEEL/27-116--------------------------------------------------------------------------------
SPT3_YEAST/5-96--------------------------------------------------------------------------------
SPT3_SCHPO/8-99--------------------------------------------------------------------------------
TAF13_YEAST/9-101--------------------------------------------------------------------------------
TAF13_HUMAN/30-119--------------------------------------------------------------------------------

PF03847

TAF12_YEAST/416-488--------------------------------------------------------------------------------
TAF12_SCHPO/344-411--------------------------------------------------------------------------------
TAF12_DROME/93-160--------------------------------------------------------------------------------
Q9VR21_DROME/67-133--------------------------------------------------------------------------------
Q9SR71_ARATH/401-468--------------------------------------------------------------------------------
TAF12_HUMAN/59-126--------------------------------------------------------------------------------
Q9U226_CAEEL/233-297--------------------------------------------------------------------------------
Q9LNR1_ARATH/526-593--------------------------------------------------------------------------------

PF00808

NFYB9_ARATH/62-127--------------------------------------------------------------------------------
HARB_PYRSG/2-65--------------------------------------------------------------------------------
HFO2_METFO/2-65--------------------------------------------------------------------------------
HJA2_METJA/2-65--------------------------------------------------------------------------------
NFYB4_ARATH/6-71--------------------------------------------------------------------------------
Q20237_CAEEL/64-128--------------------------------------------------------------------------------
HMFB_METFE/1-64--------------------------------------------------------------------------------
Q9V452_DROME/18-83--------------------------------------------------------------------------------
NFYB5_ARATH/54-119--------------------------------------------------------------------------------
HAF2_ARCFU/2-65--------------------------------------------------------------------------------
Q9GSP1_DROME/10-74--------------------------------------------------------------------------------
Q9FHS0_ARATH/10-74--------------------------------------------------------------------------------
NC2B_HUMAN/11-75--------------------------------------------------------------------------------
HAP3_KLULA/25-90--------------------------------------------------------------------------------
HAF1_ARCFU/6-69--------------------------------------------------------------------------------
HFOB_METFO/1-64--------------------------------------------------------------------------------
Q9LN09_ARATH/108-172--------------------------------------------------------------------------------
HAP3_SCHPO/10-75--------------------------------------------------------------------------------
O59848_ASPOZ/46-111--------------------------------------------------------------------------------
O93641_9EURY/3-67--------------------------------------------------------------------------------
O76256_SCHMA/27-92--------------------------------------------------------------------------------
NC2B_SCHPO/10-75--------------------------------------------------------------------------------
Q9LHG0_ARATH/7-71--------------------------------------------------------------------------------
O17072_CAEEL/108-174--------------------------------------------------------------------------------
O73745_XENLA/39-103--------------------------------------------------------------------------------
O45550_CAEEL/20-84--------------------------------------------------------------------------------
NC2B_ARATH/14-79--------------------------------------------------------------------------------
O17286_CAEEL/64-129--------------------------------------------------------------------------------

PF15511

H2QBC7_PANTR/25-514LTAPESSILMPESVVKP.............................V........PA..RQVVQPSRQESSCGSLELQLP
G3SYD4_LOXAF/26-492LTAPESSIVMPESVVMP.............................VVQPSRRSTSG..PQVVQPSRRESSRGSLELQLP
E2RJV5_CANFA/26-460LTAPESSIMMPEPVVKP.............................V........PT..PQVVQSSRRKSSQGSLELQLP
F6PKQ6_HORSE/26-517LTAPESSIVMPKSVVKP.............................G........PA..PQVVQPSSRESSRGSLELQLP
F1S2K5_PIG/26-517LTAPESSTVMPESVMKP.............................L........TV..PQMVQPSRRESSWSSLELQLP
G1PFK4_MYOLU/26-518LTAPESSMVMPESVVKP.............................V........PA..PQVVQFSRRESSPGSLELQLP
H0XDJ1_OTOGA/25-517LTAPESSILMPESVAKP.............................V........PE..AQVAQPSRRKSSQGSLELQLP
G1SQR3_RABIT/26-502LTAPESSVLVPKSVVKP.............................A........PA..PPVVQPPRRESSRGSLELQLP
H0UV87_CAVPO/26-506LTAPQSSIVMPQVMMKP.............................T........PA..PQ.VQPSRRESSQGSLELRLP
CENPT_RAT/26-471LTAPESSTVMPNPVVKP.............................A........QV..PEVARPSRRGSSRGSLELQLP
F7C6J3_ORNAN/50-507QTAPEASMLVPNSPAPA...........................................VEEVQPLQESRQSSLDLQLP
B2WAR3_PYRTR/18-424PVLARDSRPVEPSPQLP......................................PP..RTRHSALDLPDVEDGPHIAAP
Q0V6N5_PHANO/18-452GALARDTKPVEPSPQAD......................................RR..RTRHSALDLPDVEDGPDPAAP
E4ZUA3_LEPMJ/75-488RALARDSRPVQPSPQVQ......................................AK..PTRHSALDLPDVEDGPDPAAP
H1V6T6_COLHI/84-483RVVKANTQPISSSSSPS...........DLGSRA..........PSASLPIRTVGGD..RRSLAYDDDDDDDDELPIDRP
G2WXZ9_VERDV/71-445QALAPRSKPVETSSSPR.................................DVPSRSR..RSTRAAQ..DDDDDELPIDRP
F0XUM0_GROCL/71-509RRLAPISQPVATSSSPAFSSSGGSSGPKSRLSSL..........SSVLEDRVGNFSV..TGIYDDDDDDDDADSLPLDRP
G2Q011_THIHA/56-448RVLARNTEVITTSSSSS........................PGEDGKGPGSDGAGND..TTLSTINVEDDDDDEELPKRP
G2R3Q2_THITE/60-455RVLARTTQVITTSSSSS...................SSPGDGGGKDRRESDGAGNET..TLGGISVVDDEDDDEELPKRP
Q2H4H2_CHAGB/63-448RVLARTTEVITTSSSPS..........................EEDRGPSSDAGNDT..TLGSISGVDYDDDDEELPKRP
B2AUG9_PODAN/52-455RVLAKKTEPIVTSSSSP.......................GDTPNHNPSDDDDSHET..TLGPLHMSYDDDDEADIPKRP
F7VUV4_SORMK/70-543KVLAPKSERIPSSSSSP...........GSALSGG...SRNNNGQGTEEGDTSEELTFDISTRSRYGD.DDDDEELPKRP
G5EH18_MAGO7/96-512RRLAPQTERVVTSSSPG............DVSNV..........AGGAESARRAQDL..SGIFIDEDDEDDDSGFIERRP
C7YN20_NECH7/70-475RVLAPTSKPIQTSSSSS...........................PDDKSTISPVQQE..ETNIYE...DDDEDDLPIDRP
I1RX16_GIBZE/59-455RALAPKSKPIQYSSSSS...........................PGIRKSSSPAQQE..QSNLYDDDEDDDDDEFLTRRP
E9EUR1_METAR/77-484GVLASGSKPIVSSSPPQ.......................................D..KRSSFAPIQEEDDDDADLPRP
G3JMA4_CORMM/68-522RRLAPSTQQVAASSSPA..............ERGPQSSLLPIGEREEPDDEDDYMDD..EPDVEGDYDDDDDDEDLPAPP
H6BTF1_EXODN/11-447KITAPLTRRTITTPANG.....................................RGK..ENEIPQNAILEEKDNDHVKRP
A6SS64_BOTFB/43-483RTLAPQTRPTIPSPQRA.....................................PSN..SRRQTLLLDDDFDDGPNLVPP
Q5B3X8_EMENI/64-438RALAPESQPIRSSPQPP.....................................PEP..EPEPEIDEIDALDKEPDPERP
G7XFC4_ASPKW/68-429KALAPTTQPIQSSPQEQ...................................VESSP..EPEPERDEIEDLDNEPEIERP
Q4WWL8_ASPFU/76-441KALAPISQPIRSSPQEK...................................LEPTP..EPEKEKDEIEELDNEPELERP
B6HEI8_PENCW/70-421RALAPVSKPIRSSPQEK.....................................PEP...IEEPVDEFERLDNEPEIERP
B8MMW5_TALSN/60-429RTLAPISKPIQSSPQDE..................................RSPTPE..SSSEIEDETIYLDQEPLPERP
C5FZG9_ARTOC/82-443KALAPISKPVSSSPQTE.....................................LED..EPEPPVDEIEELDREPPIPPP
C5PIR4_COCP7/46-397KALAPTSEVIKSSPMTE.........................................TDQETDQQESEDLDEEPDLPRP
C1H556_PARBA/152-504KVLAPNTRTVSSSPTEK......................................PE..IPQ.PKPVVDDLDEEPDPPRP
D5G8P1_TUBMM/86-466RQLATTSTQYVPSPAQP............APRPA..........PRPSYSDRRASDV..VFYSDPGHNSGDEDEELSPAP
G1XD77_ARTOA/125-537KITAPKSKPFIPTPKAI...............TP..........KAVSERRRTLEGI..RLNRDLNAVSSDEEVDPIRPP
B6K2P7_SCHJY/48-429RMLAKHPEPSPSSAENT.............................PLPSRYSSHAV..DSVRRRLSSRSNSQQSTPIRN

PF02291

TAF9_YEAST/19-152--------------------------------------------------------------------------------
TAF9_HUMAN/2-130--------------------------------------------------------------------------------
TAF9_DROME/8-136--------------------------------------------------------------------------------
O45784_CAEEL/13-136--------------------------------------------------------------------------------
TAF9_SCHPO/3-133--------------------------------------------------------------------------------

PF15510

B2RVH1_MOUSE/1-86--------------------------------------------------------------------------------
F1S2W8_PIG/1-102--------------------------------------------------------------------------------
G7P379_MACFA/1-103--------------------------------------------------------------------------------
H0VLK4_CAVPO/1-103--------------------------------------------------------------------------------
D3Z8J2_RAT/1-86--------------------------------------------------------------------------------
G1P8B1_MYOLU/1-88--------------------------------------------------------------------------------

PF02969

TAF6_XENLA/9-74--------------------------------------------------------------------------------
TAF6L_HUMAN/9-73--------------------------------------------------------------------------------
TAF6_SCHPO/3-68--------------------------------------------------------------------------------
Q8LRG9_ORYSJ/1-68--------------------------------------------------------------------------------
TAF6_YEAST/9-74--------------------------------------------------------------------------------
Q9MAU3_ARATH/1-68--------------------------------------------------------------------------------
Q9DDC0_PLEWA/11-76--------------------------------------------------------------------------------
TAF6_DROME/18-83--------------------------------------------------------------------------------
TAF6_HUMAN/11-76--------------------------------------------------------------------------------
Q9GZI6_CAEEL/24-85--------------------------------------------------------------------------------

PF07524

SPT7_SCHPO/707-783--------------------------------------------------------------------------------
TAF8_DANRE/32-108--------------------------------------------------------------------------------
TAF3_SCHPO/7-83--------------------------------------------------------------------------------
ST65G_HUMAN/151-230--------------------------------------------------------------------------------
Q8LFR3_ARATH/24-100--------------------------------------------------------------------------------
Q9VP40_DROME/6-77--------------------------------------------------------------------------------
Q9SA19_ARATH/24-100--------------------------------------------------------------------------------
TAF8_HUMAN/29-106--------------------------------------------------------------------------------
Q9NAZ5_DROHY/4-80--------------------------------------------------------------------------------
Q8MSB9_DROME/4-80--------------------------------------------------------------------------------
Q7S5N4_NEUCR/125-200--------------------------------------------------------------------------------
Q7YTH5_CAEEL/66-142--------------------------------------------------------------------------------

PF15630

A3GI04_PICST/11-91--------------------------------------------------------------------------------
A6RJU4_BOTFB/10-85--------------------------------------------------------------------------------
A7RMQ5_NEMVE/23-98--------------------------------------------------------------------------------
A7TEH2_VANPO/17-91--------------------------------------------------------------------------------
B2W5N7_PYRTR/12-87--------------------------------------------------------------------------------
B3DJV8_DANRE/9-84--------------------------------------------------------------------------------
B3RZC1_TRIAD/15-90--------------------------------------------------------------------------------
B6JX09_SCHJY/4-85--------------------------------------------------------------------------------
B6QUS3_PENMQ/14-92--------------------------------------------------------------------------------
B7PXV9_IXOSC/11-86--------------------------------------------------------------------------------
C4Y931_CLAL4/26-101--------------------------------------------------------------------------------
C5DNB5_LACTC/22-96--------------------------------------------------------------------------------
C5G144_ARTOC/13-88--------------------------------------------------------------------------------
C5PFL7_COCP7/14-89--------------------------------------------------------------------------------
C7YTU2_NECH7/15-94--------------------------------------------------------------------------------
D3B378_POLPA/165-243--------------------------------------------------------------------------------
D5GA13_TUBMM/32-107--------------------------------------------------------------------------------
D7FWQ8_ECTSI/32-105--------------------------------------------------------------------------------
E4ZQ21_LEPMJ/13-88--------------------------------------------------------------------------------
E9CD47_CAPO3/14-89--------------------------------------------------------------------------------
E9ECA7_METAQ/10-85--------------------------------------------------------------------------------
F0XLX6_GROCL/7-82--------------------------------------------------------------------------------
F4PRK1_DICFS/235-311--------------------------------------------------------------------------------
F4RWE9_MELLP/40-115--------------------------------------------------------------------------------
F6Y3J5_MONDO/1-76--------------------------------------------------------------------------------
F7DQN4_XENTR/13-88--------------------------------------------------------------------------------
F7VU88_SORMK/11-86--------------------------------------------------------------------------------
F9WY71_MYCGM/13-88--------------------------------------------------------------------------------
G0V9K8_NAUCC/14-94--------------------------------------------------------------------------------
G3BEG3_CANTC/8-83--------------------------------------------------------------------------------
G3MSD4_9ACAR/15-89--------------------------------------------------------------------------------
G3PEU4_GASAC/26-101--------------------------------------------------------------------------------
G3VT77_SARHA/17-92--------------------------------------------------------------------------------
G4LYK5_SCHMA/9-84--------------------------------------------------------------------------------
G4MZ92_MAGO7/9-84--------------------------------------------------------------------------------
G6DRA0_DANPL/11-86--------------------------------------------------------------------------------
G8YL18_PICSO/12-89--------------------------------------------------------------------------------
H1VQ95_COLHI/11-86--------------------------------------------------------------------------------
H2LES2_ORYLA/10-85--------------------------------------------------------------------------------
H2N958_PONAB/17-92--------------------------------------------------------------------------------
H6C6E0_EXODN/12-87--------------------------------------------------------------------------------
H9J6V9_BOMMO/11-84--------------------------------------------------------------------------------
H9KVI3_CHICK/15-90--------------------------------------------------------------------------------
I1FQJ7_AMPQE/21-96--------------------------------------------------------------------------------
Q54PV0_DICDI/238-315--------------------------------------------------------------------------------
Q6BIJ2_DEBHA/13-90--------------------------------------------------------------------------------

PF00125

Q8IL74_PLAF7/27-103--------------------------------------------------------------------------------
H2BWT_HUMAN/75-145--------------------------------------------------------------------------------
Q7PVU9_ANOGA/105-178--------------------------------------------------------------------------------
H4_CAEEL/25-94--------------------------------------------------------------------------------
H2A2_XENLA/18-91--------------------------------------------------------------------------------
H2AB2_HUMAN/22-95--------------------------------------------------------------------------------
O00912_LEIIN/23-92--------------------------------------------------------------------------------
O02612_LEIIN/19-89--------------------------------------------------------------------------------
O02613_CRIFA/18-93--------------------------------------------------------------------------------
O02648_DROSI/58-132--------------------------------------------------------------------------------
O15582_ENTHI/30-100--------------------------------------------------------------------------------
O18643_CHAVR/29-99--------------------------------------------------------------------------------
CENPA_MOUSE/51-127--------------------------------------------------------------------------------
O44009_LEIBR/52-126--------------------------------------------------------------------------------
H2B_CAPAN/52-122--------------------------------------------------------------------------------
O96761_9TRYP/19-89--------------------------------------------------------------------------------
O96955_PLAVI/25-95--------------------------------------------------------------------------------
H2B_EUPCR/20-90--------------------------------------------------------------------------------
HCP3L_CAEEL/180-257--------------------------------------------------------------------------------
HAP5_YEAST/152-225--------------------------------------------------------------------------------
Q19649_CAEEL/40-114--------------------------------------------------------------------------------
Q23429_CAEEL/30-104--------------------------------------------------------------------------------
E2RTQ0_GIAIN/25-101--------------------------------------------------------------------------------
E2RU60_GIAIN/21-90--------------------------------------------------------------------------------
E2RU15_GIAIN/15-88--------------------------------------------------------------------------------
A8BYH2_GIAIC/69-146--------------------------------------------------------------------------------
A8B678_GIAIC/68-148--------------------------------------------------------------------------------
A8B471_GIAIC/102-178--------------------------------------------------------------------------------
Q7RRA6_PLAYO/27-103--------------------------------------------------------------------------------
Q7XV46_ORYSJ/214-290--------------------------------------------------------------------------------
Q7XYY4_PYRLU/77-151--------------------------------------------------------------------------------
Q7Z106_PARTE/51-125--------------------------------------------------------------------------------
CENPA_DANRE/65-140--------------------------------------------------------------------------------
H2AV3_ORYSJ/32-106--------------------------------------------------------------------------------
H2A3_ORYSJ/19-92--------------------------------------------------------------------------------
Q867G5_TRYBB/61-135--------------------------------------------------------------------------------
Q867U7_TRYBB/41-111--------------------------------------------------------------------------------
Q86EU0_SCHJA/18-91--------------------------------------------------------------------------------
CENPA_CANGA/159-236--------------------------------------------------------------------------------
Q8BP16_MOUSE/15-88--------------------------------------------------------------------------------
Q8IDZ1_PLAF7/90-167--------------------------------------------------------------------------------
Q8LK76_MAIZE/76-152--------------------------------------------------------------------------------
Q8NIA3_HUMAN/97-169--------------------------------------------------------------------------------
H3L_ENCCU/57-130--------------------------------------------------------------------------------
H4_ENCCU/27-96--------------------------------------------------------------------------------
H31_ENCCU/59-135--------------------------------------------------------------------------------
Q8T9Z4_DROOR/130-206--------------------------------------------------------------------------------
Q8TA36_HETGL/23-92--------------------------------------------------------------------------------
Q8VEE3_MOUSE/32-99--------------------------------------------------------------------------------
H2BV_BOVIN/29-99--------------------------------------------------------------------------------
Q92646_HUMAN/13-84--------------------------------------------------------------------------------
Q98SC6_GUITH/26-100--------------------------------------------------------------------------------
Q9CQ70_MOUSE/15-88--------------------------------------------------------------------------------
H2BV_MOUSE/30-100--------------------------------------------------------------------------------
Q9DAB5_MOUSE/130-200--------------------------------------------------------------------------------
Q9DAD9_MOUSE/13-86--------------------------------------------------------------------------------
Q9GRH3_STYLE/100-174--------------------------------------------------------------------------------
H3L1_LILLO/70-144--------------------------------------------------------------------------------
H2B_LILLO/48-118--------------------------------------------------------------------------------
H2B2_ARATH/145-215--------------------------------------------------------------------------------
H2A8_ARATH/23-97--------------------------------------------------------------------------------
Q9XG41_GUITH/8-78--------------------------------------------------------------------------------
H2A1_LILLO/18-91--------------------------------------------------------------------------------
CENPA_SCHPO/38-118--------------------------------------------------------------------------------

PF04719

Q20563_CAEEL/236-327--------------------------------------------------------------------------------
Q9M565_ARATH/105-194--------------------------------------------------------------------------------
Q9AW46_GUITH/30-124--------------------------------------------------------------------------------
TAF11_DROME/89-177--------------------------------------------------------------------------------
TAF11_MOUSE/106-194--------------------------------------------------------------------------------
Q9C2R5_NEUCS/200-281--------------------------------------------------------------------------------
TAF11_YEAST/124-213--------------------------------------------------------------------------------
Q9LNS8_ARATH/128-217--------------------------------------------------------------------------------
TAF11_SCHPO/93-181--------------------------------------------------------------------------------
Q21417_CAEEL/221-312--------------------------------------------------------------------------------

PF02269

SUPT3_HUMAN/106-198--------------------------------------------------------------------------------
Q17957_CAEEL/27-116--------------------------------------------------------------------------------
SPT3_YEAST/5-96--------------------------------------------------------------------------------
SPT3_SCHPO/8-99--------------------------------------------------------------------------------
TAF13_YEAST/9-101--------------------------------------------------------------------------------
TAF13_HUMAN/30-119--------------------------------------------------------------------------------

PF03847

TAF12_YEAST/416-488--------------------------------------------------------------------------------
TAF12_SCHPO/344-411--------------------------------------------------------------------------------
TAF12_DROME/93-160--------------------------------------------------------------------------------
Q9VR21_DROME/67-133--------------------------------------------------------------------------------
Q9SR71_ARATH/401-468--------------------------------------------------------------------------------
TAF12_HUMAN/59-126--------------------------------------------------------------------------------
Q9U226_CAEEL/233-297--------------------------------------------------------------------------------
Q9LNR1_ARATH/526-593--------------------------------------------------------------------------------

PF00808

NFYB9_ARATH/62-127--------------------------------------------------------------------------------
HARB_PYRSG/2-65--------------------------------------------------------------------------------
HFO2_METFO/2-65--------------------------------------------------------------------------------
HJA2_METJA/2-65--------------------------------------------------------------------------------
NFYB4_ARATH/6-71--------------------------------------------------------------------------------
Q20237_CAEEL/64-128--------------------------------------------------------------------------------
HMFB_METFE/1-64--------------------------------------------------------------------------------
Q9V452_DROME/18-83--------------------------------------------------------------------------------
NFYB5_ARATH/54-119--------------------------------------------------------------------------------
HAF2_ARCFU/2-65--------------------------------------------------------------------------------
Q9GSP1_DROME/10-74--------------------------------------------------------------------------------
Q9FHS0_ARATH/10-74--------------------------------------------------------------------------------
NC2B_HUMAN/11-75--------------------------------------------------------------------------------
HAP3_KLULA/25-90--------------------------------------------------------------------------------
HAF1_ARCFU/6-69--------------------------------------------------------------------------------
HFOB_METFO/1-64--------------------------------------------------------------------------------
Q9LN09_ARATH/108-172--------------------------------------------------------------------------------
HAP3_SCHPO/10-75--------------------------------------------------------------------------------
O59848_ASPOZ/46-111--------------------------------------------------------------------------------
O93641_9EURY/3-67--------------------------------------------------------------------------------
O76256_SCHMA/27-92--------------------------------------------------------------------------------
NC2B_SCHPO/10-75--------------------------------------------------------------------------------
Q9LHG0_ARATH/7-71--------------------------------------------------------------------------------
O17072_CAEEL/108-174--------------------------------------------------------------------------------
O73745_XENLA/39-103--------------------------------------------------------------------------------
O45550_CAEEL/20-84--------------------------------------------------------------------------------
NC2B_ARATH/14-79--------------------------------------------------------------------------------
O17286_CAEEL/64-129--------------------------------------------------------------------------------

PF15511

H2QBC7_PANTR/25-514ELEPPTTL.......APGLLAPGRRKQRLRLSMFQQGVD...QGLSLSQ.......EPQ..GNADASSLTR.SLNLTFAT
G3SYD4_LOXAF/26-492ELEPSRTL.......APGLLASGRKKQKLRLSVFQQGVD...QGLPLSQACCRALTEPH..GNADASSLTSTSLNLNFAT
E2RJV5_CANFA/26-460ELEPPTTL.......ALGLLAPGRRKQRLRLSAFQQGVD...QGLPLSQ.......EPH..GNANASSLTS.SLNLTFAT
F6PKQ6_HORSE/26-517ELEPPTTL.......APGLLAPGRRKQRLRLSVFQEGMD...KGLPLSQ.......ESR..GNADASSLTS.SLNLTFAT
F1S2K5_PIG/26-517ELEPPTTL.......APGLLASGRRKQKLRLSVFQQGMD...QELPLSQ.......ESR..GNADASSLTS.SLNLTFAT
G1PFK4_MYOLU/26-518ELNASTTL.......APGRLTSGRRKKRLRLSEFQQGVD...QGLPLSQ...GPVTEPP..GNTGASSLSS.SLNLTFAT
H0XDJ1_OTOGA/25-517EPEPPAPL.......PQGLLAPGKRKQRLRLYVFQQGVD...EGLPLSH.......EPR..GNPDASSLAS.SLNLTFAT
G1SQR3_RABIT/26-502ELEPTTSL.......APGLLARGRRKQRLRLSVFQQEVD...QGLPLSQ.......EPP..ETAGASSLTS.SLNLTFAT
H0UV87_CAVPO/26-506ELESPPTL.......GPVLLGSGRRKQRLRLSMFQQEVDQEPQELPISQ.......EPP..GNPDASSLTS.SFKLTFAT
CENPT_RAT/26-471ELDPPSTL.......APGLKAPGKRKQKLRLSVFQQEVN...QQLPLPQ.......EQR..GAADGSSLAS.SFNLSFVP
F7C6J3_ORNAN/50-507ELEPLMPM.......ARAQLGTGRKRRKLRLSEFERGVDQGLAA............SVEEPLASANTSSLTKSFNLSLTA
B2WAR3_PYRTR/18-424RLSMPLDN...............MYDDE............................DSFHSAPPRQSLLPDLPDDVDGG.
Q0V6N5_PHANO/18-452RLSMAIDD...............MYDD.............................DSYHEHPPRQSFLPDLPDDVDGG.
E4ZUA3_LEPMJ/75-488RLSMALGD...............MYDDDD...........................ESYHSAPPRQSLLPDLPDDVDGG.
H1V6T6_COLHI/84-483RLSLPLDV................EDE.............................DEDDLVAPELSQIDENA.......
G2WXZ9_VERDV/71-445EMTLPLDM.......D........................................DDSDLVPPRSSILEDP........
F0XUM0_GROCL/71-509RMSLPIED.................DD.............................NDDDLRPHRSQILDDEENF.....
G2Q011_THIHA/56-448RLSLPIDE...............EDDD.............................DSDDLQPHRSVVFDDNDNF.....
G2R3Q2_THITE/60-455RLSLPIDE..............EDDDD.............................DSDDLQPHRSVLIDDENF......
Q2H4H2_CHAGB/63-448RLSLPIGD...............EDDD.............................DSDDIQPHRSVVFDDDNNF.....
B2AUG9_PODAN/52-455RLSLPIDR...............DDDS.............................GSDDLVPHRSMLLDNEDNF.....
F7VUV4_SORMK/70-543RLSLGLGA.......PE...EDWEDDD.............................DADLPQPHRSAGLEDLTENF....
G5EH18_MAGO7/96-512RLSLPIDA.......G.........DD.............................DEVELRPPRTSGLENITDD.....
C7YN20_NECH7/70-475RLSLPLDD..............EDASS.............................TSSDLRPPRLSQLEEDNF......
I1RX16_GIBZE/59-455RLSLPLD...............EDASS.............................MSSEIPPPRLSQLDEDNF......
E9EUR1_METAR/77-484RLSLPIDQD...............................................DDSDLIPPRSSGLESEH.......
G3JMA4_CORMM/68-522RLSLALQE................DED.............................DTIELRPPRLSVIPDDNI......
H6BTF1_EXODN/11-447RLTLNIDDDSSIDDVEPPVLNEQEEED.............................DSELPVAPTPSILPDGDDGGPPIR
A6SS64_BOTFB/43-483RLSIPLDD...........DNDEDDNE.............................DDESLLLPSLAALEDENL......
Q5B3X8_EMENI/64-438RLSLPLED............VEEEDDD.............................GSPEIRPPRMSLALGDDDMLHDDI
G7XFC4_ASPKW/68-429RLSLPLDE............VEEVDEE...............................PEMHPPRLSLAFEEEDI.....
Q4WWL8_ASPFU/76-441RLSLPLEE............VEEVDE..............................GSPEMRPPRLSLAFDEEDITHT..
B6HEI8_PENCW/70-421RLSLPIQE............SEEEGEE.............................ASPEMRPPRMSLAFAEEDM.....
B8MMW5_TALSN/60-429RLSLPLRA............DSGSSSD.............................GSPDMPPPRLSLQFVEDDI.....
C5FZG9_ARTOC/82-443RLSLPLNE..........MTVVQED.D.............................NSPEIPPPKLSLLPEDEDI.....
C5PIR4_COCP7/46-397RLSLPMHE..........MIVPGDGD..............................GSPEIVPPRLSLPLDEDDF.....
C1H556_PARBA/152-504RLSLPLRE..........MLPEGD................................GSPEITPPRLSLALDEDAEL....
D5G8P1_TUBMM/86-466RLSMNLNE.......F.....EQAEEE.............................EDARLPVPRYSLPLENIEDMDY..
G1XD77_ARTOA/125-537RLS.NVSLRLIGKRLTIRDNHEAEEDD.............................DVEISPPPQLSTPLRDSGDDDDLK
B6K2P7_SCHJY/48-429RRNLSQQH................................................ENAIEEDAEISVQ...........

PF02291

TAF9_YEAST/19-152--------------------------------------------------------------------------------
TAF9_HUMAN/2-130--------------------------------------------------------------------------------
TAF9_DROME/8-136--------------------------------------------------------------------------------
O45784_CAEEL/13-136--------------------------------------------------------------------------------
TAF9_SCHPO/3-133--------------------------------------------------------------------------------

PF15510

B2RVH1_MOUSE/1-86--------------------------------------------------------------------------------
F1S2W8_PIG/1-102--------------------------------------------------------------------------------
G7P379_MACFA/1-103--------------------------------------------------------------------------------
H0VLK4_CAVPO/1-103--------------------------------------------------------------------------------
D3Z8J2_RAT/1-86--------------------------------------------------------------------------------
G1P8B1_MYOLU/1-88--------------------------------------------------------------------------------

PF02969

TAF6_XENLA/9-74--------------------------------------------------------------------------------
TAF6L_HUMAN/9-73--------------------------------------------------------------------------------
TAF6_SCHPO/3-68--------------------------------------------------------------------------------
Q8LRG9_ORYSJ/1-68--------------------------------------------------------------------------------
TAF6_YEAST/9-74--------------------------------------------------------------------------------
Q9MAU3_ARATH/1-68--------------------------------------------------------------------------------
Q9DDC0_PLEWA/11-76--------------------------------------------------------------------------------
TAF6_DROME/18-83--------------------------------------------------------------------------------
TAF6_HUMAN/11-76--------------------------------------------------------------------------------
Q9GZI6_CAEEL/24-85--------------------------------------------------------------------------------

PF07524

SPT7_SCHPO/707-783--------------------------------------------------------------------------------
TAF8_DANRE/32-108--------------------------------------------------------------------------------
TAF3_SCHPO/7-83--------------------------------------------------------------------------------
ST65G_HUMAN/151-230--------------------------------------------------------------------------------
Q8LFR3_ARATH/24-100--------------------------------------------------------------------------------
Q9VP40_DROME/6-77--------------------------------------------------------------------------------
Q9SA19_ARATH/24-100--------------------------------------------------------------------------------
TAF8_HUMAN/29-106--------------------------------------------------------------------------------
Q9NAZ5_DROHY/4-80--------------------------------------------------------------------------------
Q8MSB9_DROME/4-80--------------------------------------------------------------------------------
Q7S5N4_NEUCR/125-200--------------------------------------------------------------------------------
Q7YTH5_CAEEL/66-142--------------------------------------------------------------------------------

PF15630

A3GI04_PICST/11-91--------------------------------------------------------------------------------
A6RJU4_BOTFB/10-85--------------------------------------------------------------------------------
A7RMQ5_NEMVE/23-98--------------------------------------------------------------------------------
A7TEH2_VANPO/17-91--------------------------------------------------------------------------------
B2W5N7_PYRTR/12-87--------------------------------------------------------------------------------
B3DJV8_DANRE/9-84--------------------------------------------------------------------------------
B3RZC1_TRIAD/15-90--------------------------------------------------------------------------------
B6JX09_SCHJY/4-85--------------------------------------------------------------------------------
B6QUS3_PENMQ/14-92--------------------------------------------------------------------------------
B7PXV9_IXOSC/11-86--------------------------------------------------------------------------------
C4Y931_CLAL4/26-101--------------------------------------------------------------------------------
C5DNB5_LACTC/22-96--------------------------------------------------------------------------------
C5G144_ARTOC/13-88--------------------------------------------------------------------------------
C5PFL7_COCP7/14-89--------------------------------------------------------------------------------
C7YTU2_NECH7/15-94--------------------------------------------------------------------------------
D3B378_POLPA/165-243--------------------------------------------------------------------------------
D5GA13_TUBMM/32-107--------------------------------------------------------------------------------
D7FWQ8_ECTSI/32-105--------------------------------------------------------------------------------
E4ZQ21_LEPMJ/13-88--------------------------------------------------------------------------------
E9CD47_CAPO3/14-89--------------------------------------------------------------------------------
E9ECA7_METAQ/10-85--------------------------------------------------------------------------------
F0XLX6_GROCL/7-82--------------------------------------------------------------------------------
F4PRK1_DICFS/235-311--------------------------------------------------------------------------------
F4RWE9_MELLP/40-115--------------------------------------------------------------------------------
F6Y3J5_MONDO/1-76--------------------------------------------------------------------------------
F7DQN4_XENTR/13-88--------------------------------------------------------------------------------
F7VU88_SORMK/11-86--------------------------------------------------------------------------------
F9WY71_MYCGM/13-88--------------------------------------------------------------------------------
G0V9K8_NAUCC/14-94--------------------------------------------------------------------------------
G3BEG3_CANTC/8-83--------------------------------------------------------------------------------
G3MSD4_9ACAR/15-89--------------------------------------------------------------------------------
G3PEU4_GASAC/26-101--------------------------------------------------------------------------------
G3VT77_SARHA/17-92--------------------------------------------------------------------------------
G4LYK5_SCHMA/9-84--------------------------------------------------------------------------------
G4MZ92_MAGO7/9-84--------------------------------------------------------------------------------
G6DRA0_DANPL/11-86--------------------------------------------------------------------------------
G8YL18_PICSO/12-89--------------------------------------------------------------------------------
H1VQ95_COLHI/11-86--------------------------------------------------------------------------------
H2LES2_ORYLA/10-85--------------------------------------------------------------------------------
H2N958_PONAB/17-92--------------------------------------------------------------------------------
H6C6E0_EXODN/12-87--------------------------------------------------------------------------------
H9J6V9_BOMMO/11-84--------------------------------------------------------------------------------
H9KVI3_CHICK/15-90--------------------------------------------------------------------------------
I1FQJ7_AMPQE/21-96--------------------------------------------------------------------------------
Q54PV0_DICDI/238-315--------------------------------------------------------------------------------
Q6BIJ2_DEBHA/13-90--------------------------------------------------------------------------------

PF00125

Q8IL74_PLAF7/27-103--------------------------------------------------------------------------------
H2BWT_HUMAN/75-145--------------------------------------------------------------------------------
Q7PVU9_ANOGA/105-178--------------------------------------------------------------------------------
H4_CAEEL/25-94--------------------------------------------------------------------------------
H2A2_XENLA/18-91--------------------------------------------------------------------------------
H2AB2_HUMAN/22-95--------------------------------------------------------------------------------
O00912_LEIIN/23-92--------------------------------------------------------------------------------
O02612_LEIIN/19-89--------------------------------------------------------------------------------
O02613_CRIFA/18-93--------------------------------------------------------------------------------
O02648_DROSI/58-132--------------------------------------------------------------------------------
O15582_ENTHI/30-100--------------------------------------------------------------------------------
O18643_CHAVR/29-99--------------------------------------------------------------------------------
CENPA_MOUSE/51-127--------------------------------------------------------------------------------
O44009_LEIBR/52-126--------------------------------------------------------------------------------
H2B_CAPAN/52-122--------------------------------------------------------------------------------
O96761_9TRYP/19-89--------------------------------------------------------------------------------
O96955_PLAVI/25-95--------------------------------------------------------------------------------
H2B_EUPCR/20-90--------------------------------------------------------------------------------
HCP3L_CAEEL/180-257--------------------------------------------------------------------------------
HAP5_YEAST/152-225--------------------------------------------------------------------------------
Q19649_CAEEL/40-114--------------------------------------------------------------------------------
Q23429_CAEEL/30-104--------------------------------------------------------------------------------
E2RTQ0_GIAIN/25-101--------------------------------------------------------------------------------
E2RU60_GIAIN/21-90--------------------------------------------------------------------------------
E2RU15_GIAIN/15-88--------------------------------------------------------------------------------
A8BYH2_GIAIC/69-146--------------------------------------------------------------------------------
A8B678_GIAIC/68-148--------------------------------------------------------------------------------
A8B471_GIAIC/102-178--------------------------------------------------------------------------------
Q7RRA6_PLAYO/27-103--------------------------------------------------------------------------------
Q7XV46_ORYSJ/214-290--------------------------------------------------------------------------------
Q7XYY4_PYRLU/77-151--------------------------------------------------------------------------------
Q7Z106_PARTE/51-125--------------------------------------------------------------------------------
CENPA_DANRE/65-140--------------------------------------------------------------------------------
H2AV3_ORYSJ/32-106--------------------------------------------------------------------------------
H2A3_ORYSJ/19-92--------------------------------------------------------------------------------
Q867G5_TRYBB/61-135--------------------------------------------------------------------------------
Q867U7_TRYBB/41-111--------------------------------------------------------------------------------
Q86EU0_SCHJA/18-91--------------------------------------------------------------------------------
CENPA_CANGA/159-236--------------------------------------------------------------------------------
Q8BP16_MOUSE/15-88--------------------------------------------------------------------------------
Q8IDZ1_PLAF7/90-167--------------------------------------------------------------------------------
Q8LK76_MAIZE/76-152--------------------------------------------------------------------------------
Q8NIA3_HUMAN/97-169--------------------------------------------------------------------------------
H3L_ENCCU/57-130--------------------------------------------------------------------------------
H4_ENCCU/27-96--------------------------------------------------------------------------------
H31_ENCCU/59-135--------------------------------------------------------------------------------
Q8T9Z4_DROOR/130-206--------------------------------------------------------------------------------
Q8TA36_HETGL/23-92--------------------------------------------------------------------------------
Q8VEE3_MOUSE/32-99--------------------------------------------------------------------------------
H2BV_BOVIN/29-99--------------------------------------------------------------------------------
Q92646_HUMAN/13-84--------------------------------------------------------------------------------
Q98SC6_GUITH/26-100--------------------------------------------------------------------------------
Q9CQ70_MOUSE/15-88--------------------------------------------------------------------------------
H2BV_MOUSE/30-100--------------------------------------------------------------------------------
Q9DAB5_MOUSE/130-200--------------------------------------------------------------------------------
Q9DAD9_MOUSE/13-86--------------------------------------------------------------------------------
Q9GRH3_STYLE/100-174--------------------------------------------------------------------------------
H3L1_LILLO/70-144--------------------------------------------------------------------------------
H2B_LILLO/48-118--------------------------------------------------------------------------------
H2B2_ARATH/145-215--------------------------------------------------------------------------------
H2A8_ARATH/23-97--------------------------------------------------------------------------------
Q9XG41_GUITH/8-78--------------------------------------------------------------------------------
H2A1_LILLO/18-91--------------------------------------------------------------------------------
CENPA_SCHPO/38-118--------------------------------------------------------------------------------

PF04719

Q20563_CAEEL/236-327--------------------------------------------------------------------------------
Q9M565_ARATH/105-194--------------------------------------------------------------------------------
Q9AW46_GUITH/30-124--------------------------------------------------------------------------------
TAF11_DROME/89-177--------------------------------------------------------------------------------
TAF11_MOUSE/106-194--------------------------------------------------------------------------------
Q9C2R5_NEUCS/200-281--------------------------------------------------------------------------------
TAF11_YEAST/124-213--------------------------------------------------------------------------------
Q9LNS8_ARATH/128-217--------------------------------------------------------------------------------
TAF11_SCHPO/93-181--------------------------------------------------------------------------------
Q21417_CAEEL/221-312--------------------------------------------------------------------------------

PF02269

SUPT3_HUMAN/106-198--------------------------------------------------------------------------------
Q17957_CAEEL/27-116--------------------------------------------------------------------------------
SPT3_YEAST/5-96--------------------------------------------------------------------------------
SPT3_SCHPO/8-99--------------------------------------------------------------------------------
TAF13_YEAST/9-101--------------------------------------------------------------------------------
TAF13_HUMAN/30-119--------------------------------------------------------------------------------

PF03847

TAF12_YEAST/416-488--------------------------------------------------------------------------------
TAF12_SCHPO/344-411--------------------------------------------------------------------------------
TAF12_DROME/93-160--------------------------------------------------------------------------------
Q9VR21_DROME/67-133--------------------------------------------------------------------------------
Q9SR71_ARATH/401-468--------------------------------------------------------------------------------
TAF12_HUMAN/59-126--------------------------------------------------------------------------------
Q9U226_CAEEL/233-297--------------------------------------------------------------------------------
Q9LNR1_ARATH/526-593--------------------------------------------------------------------------------

PF00808

NFYB9_ARATH/62-127--------------------------------------------------------------------------------
HARB_PYRSG/2-65--------------------------------------------------------------------------------
HFO2_METFO/2-65--------------------------------------------------------------------------------
HJA2_METJA/2-65--------------------------------------------------------------------------------
NFYB4_ARATH/6-71--------------------------------------------------------------------------------
Q20237_CAEEL/64-128--------------------------------------------------------------------------------
HMFB_METFE/1-64--------------------------------------------------------------------------------
Q9V452_DROME/18-83--------------------------------------------------------------------------------
NFYB5_ARATH/54-119--------------------------------------------------------------------------------
HAF2_ARCFU/2-65--------------------------------------------------------------------------------
Q9GSP1_DROME/10-74--------------------------------------------------------------------------------
Q9FHS0_ARATH/10-74--------------------------------------------------------------------------------
NC2B_HUMAN/11-75--------------------------------------------------------------------------------
HAP3_KLULA/25-90--------------------------------------------------------------------------------
HAF1_ARCFU/6-69--------------------------------------------------------------------------------
HFOB_METFO/1-64--------------------------------------------------------------------------------
Q9LN09_ARATH/108-172--------------------------------------------------------------------------------
HAP3_SCHPO/10-75--------------------------------------------------------------------------------
O59848_ASPOZ/46-111--------------------------------------------------------------------------------
O93641_9EURY/3-67--------------------------------------------------------------------------------
O76256_SCHMA/27-92--------------------------------------------------------------------------------
NC2B_SCHPO/10-75--------------------------------------------------------------------------------
Q9LHG0_ARATH/7-71--------------------------------------------------------------------------------
O17072_CAEEL/108-174--------------------------------------------------------------------------------
O73745_XENLA/39-103--------------------------------------------------------------------------------
O45550_CAEEL/20-84--------------------------------------------------------------------------------
NC2B_ARATH/14-79--------------------------------------------------------------------------------
O17286_CAEEL/64-129--------------------------------------------------------------------------------

PF15511

H2QBC7_PANTR/25-514PLQPQSVQ...RPGLARRPPARRAVDVGAFLRDLRDTS..LAPP.............NIV....LEDTQPF..SQPMV..
G3SYD4_LOXAF/26-492PLQSQSVG...RPGLARRPPTRRAVDMGAFLQDLRDTSMALVSPGDSHRTPIATLQKDAV....LEDTQPF..FPPLV..
E2RJV5_CANFA/26-460PLQPQSVQ...RPGLARRPPTRRAVDVGAFLQDLRDTS..LVSPGDSLRTPVATLPTDTV....LEDTQPF..SQPLV..
F6PKQ6_HORSE/26-517PLQPQSVQ...RPGLARRPPTRRAVDVGAFLQDLRDTS..LALA...........PPDTV....LEDTQPF..SQPLV..
F1S2K5_PIG/26-517PLQPLSVK...RPGLARRPLTRRAVDVGTFFQDLRDTS..VALP...........PPDTV....LEDTQPF..SQPLA..
G1PFK4_MYOLU/26-518PLLPQSVQ...RPGLARRPPTRRAVDVGIFLQDLQDTSVATALP.............DTV....LEDTQPF..SQPLI..
H0XDJ1_OTOGA/25-517PLQPQSVH...RPGLARRPPTHRSVDVAAFLQDLRDTN..LAPP.............NIV....LEDTQPF..SQPLA..
G1SQR3_RABIT/26-502PVQPQSVK...RPGLARRPPTRRAVDVGVLLQDLRDTS..LAPS.............DTV....LEDTQPF..SQPLV..
H0UV87_CAVPO/26-506PLQPQSVK...RPGLARKPPPRRAIDVGALLQDLRDNSSAPAPL.............DTV....LEDTQPF..SHPLV..
CENPT_RAT/26-471SVQPQTVD...RPGLARRRPVRRPVNIGAFLQNLENKSLTSALPGDSHRTPVAALPTDVV....FEDTQPF..SQPLA..
F7C6J3_ORNAN/50-507LVLPESVK...RPGLARRPRTRKAISLEAFEQGLEKTPLPTQEAL...................LGDTQLF..LQASP..
B2WAR3_PYRTR/18-424.....TVQ...SLEFGRKAISEDPRM...............FGGRQSER....FGDLSELGAVEEEYEIDG..TFISR..
Q0V6N5_PHANO/18-452.....TVQ...SLEFGRRAISEDPRFM..............YPGRISER....FADLSELGAVEEEFEIDG..TFIN...
E4ZUA3_LEPMJ/75-488.....TVQ...SLEFGRRAVSEDPRHM..............FGGRYSAH....FGDLSELGAVDEEFEIDG..TFINQ..
H1V6T6_COLHI/84-483...........TIEFPRRAYT.......DQVSRMSM.....GSVRLSE.....YRNYDDLDDDNDEGGEGF..FPGFE..
G2WXZ9_VERDV/71-445...........TLELPRRAYS.......EAPSRLSL.....ASRRLSE.....FYNVRDTLSDEDAPGQGF..FPSMD..
F0XUM0_GROCL/71-509.....TMR...SIELARRTANLEQLQQARRFSRGSLGRSSIGSLGMSDYIDGFIGSADGDDDRDERLQSAF..FADGA..
G2Q011_THIHA/56-448.....TMQ...SIEMPRRAYS......EQPGGRLSM.....GSARMSDY....FNTNDMLHSEDVGVDSGF..FPPTA..
G2R3Q2_THITE/60-455.....TMQ...SIEMPRRAIS......EQPGGRLSL.....GSTRMSDY....FNVNDMLHSEDVGIDSGF..FPPTA..
Q2H4H2_CHAGB/63-448.....TLQ...SIEMPRRAIS......EQPGGRFSM.....GSTRMSDY....FNMNDMLHSEDIGVDSGF..FPPTA..
B2AUG9_PODAN/52-455.....TMQ...SVEMPRRAYS......EGPGGRLSL.....NSTRMSDF....FNANDMLHSEDFGRESGM..FPPIN..
F7VUV4_SORMK/70-543.....TVQ...SIELPRRVDP....ERDGHGSRMRD.....SMGRLSD.....FPQL...QQQSDGIDSGF..FPPTAGA
G5EH18_MAGO7/96-512.....TVM...SIEAPRRAISEQPYRRAGR...........DSLRMSDY....FGNGQDDFTVEIGQDFDD..PIPPA..
C7YN20_NECH7/70-475.....TMQ...SIEMPRRAIS...EQAASRLSRGSF.....GSVRMSDY.......FNDEEGTEDIGQQSD..FFPGL..
I1RX16_GIBZE/59-455.....TVQ...SIEMPRRYAE......NPRLSRGSP.....GSERISDY.......FNNEPTE.DIGQQSD..FFPGF..
E9EUR1_METAR/77-484.....TLP...IVEKPRRAYS.......EQPSRLSGPDFGGGFDSDAFD........PNEVTGEMGRVSDF..FPGSL..
G3JMA4_CORMM/68-522.....TNHTVGSVELPREYRD.......PGWARGSL.....GSVRGSD.....YFDPNDPTVEMTGRPSDF..FNGSL..
H6BTF1_EXODN/11-447GKDRDATITFDSIDFTREAREGASFIRDGRLSRVS......GVTGDNEEPTILVEMGRRAISEEPTGRLSR..YSFGS..
A6SS64_BOTFB/43-483.....TTR...SIELSRRAVT...ERPSRLFSRSSF.....GSVRGSDH....FGNLDEAEFGRDEMETSF..FNAND..
Q5B3X8_EMENI/64-438THDDMTHT...SIEYPRRATL...DRDRNRLSMVSA.....GGPRLSEN....FGDATGL....ESDSDVG..GNTSV..
G7XFC4_ASPKW/68-429...........TVEYPRRAMS...EHDRNRLSMMSV.....GGPRMSE.....IGAATGL....ESESEDG..DDTGI..
Q4WWL8_ASPFU/76-441...........SVEYPRRATS...EYDRARLSMMSY.....GNPRLSEN....FGDSTRL....GSGSEGGEDDDTGM..
B6HEI8_PENCW/70-421...DITYQ...SVEYPRDTSI....RDRDRLSMMSR.....ATGRISGD.....FDETRL......ESDGG..DGTGI..
B8MMW5_TALSN/60-429.....TQR...SVEYPRRAIS...DKDRQRLERMSF.....GDVRMSEN....FGDLTRL....DAFSEAG..DITTL..
C5FZG9_ARTOC/82-443.....TRG...SIELPRRERS...GRDLARLSRVSF.....ASNRFSDH....FGDTTNL....EDPAEAL..DFRVG..
C5PIR4_COCP7/46-397.....TQR...SIEMPRRERS...TRDLATLSRYSL.....ASTRFSEH....FGDASRL....EYTEEGM..EFTAP..
C1H556_PARBA/152-504.....TTT...SIEFARRDRS...LRDRATLSRVSL.....GSTRFSDR....FGDLSRM...EDLEEE....DYTVA..
D5G8P1_TUBMM/86-466.....THT...SIEFGRRAVTERPYRPSFGIRLSDRFADFHGVTGESSPRTAGYEDGDEREEEEDGETGVM..GDESV..
G1XD77_ARTOA/125-537SGGIETP....RFEVARRAVGENDRRFSFLPNMADRFADFGDVVMDDSIIQEAGGEHIVEVFEGESFAVEG..DGMEG..
B6K2P7_SCHJY/48-429...........SIEAPRRALN...NRLSELLTPDVRRISSSSFVSMTTNKQAYFKPSKDRLLDVGGDDDIE..EPVYH..

PF02291

TAF9_YEAST/19-152--------------------------------------------------------------------------------
TAF9_HUMAN/2-130--------------------------------------------------------------------------------
TAF9_DROME/8-136--------------------------------------------------------------------------------
O45784_CAEEL/13-136--------------------------------------------------------------------------------
TAF9_SCHPO/3-133--------------------------------------------------------------------------------

PF15510

B2RVH1_MOUSE/1-86--------------------------------------------------------------------------------
F1S2W8_PIG/1-102--------------------------------------------------------------------------------
G7P379_MACFA/1-103--------------------------------------------------------------------------------
H0VLK4_CAVPO/1-103--------------------------------------------------------------------------------
D3Z8J2_RAT/1-86--------------------------------------------------------------------------------
G1P8B1_MYOLU/1-88--------------------------------------------------------------------------------

PF02969

TAF6_XENLA/9-74--------------------------------------------------------------------------------
TAF6L_HUMAN/9-73--------------------------------------------------------------------------------
TAF6_SCHPO/3-68--------------------------------------------------------------------------------
Q8LRG9_ORYSJ/1-68--------------------------------------------------------------------------------
TAF6_YEAST/9-74--------------------------------------------------------------------------------
Q9MAU3_ARATH/1-68--------------------------------------------------------------------------------
Q9DDC0_PLEWA/11-76--------------------------------------------------------------------------------
TAF6_DROME/18-83--------------------------------------------------------------------------------
TAF6_HUMAN/11-76--------------------------------------------------------------------------------
Q9GZI6_CAEEL/24-85--------------------------------------------------------------------------------

PF07524

SPT7_SCHPO/707-783--------------------------------------------------------------------------------
TAF8_DANRE/32-108--------------------------------------------------------------------------------
TAF3_SCHPO/7-83--------------------------------------------------------------------------------
ST65G_HUMAN/151-230--------------------------------------------------------------------------------
Q8LFR3_ARATH/24-100--------------------------------------------------------------------------------
Q9VP40_DROME/6-77--------------------------------------------------------------------------------
Q9SA19_ARATH/24-100--------------------------------------------------------------------------------
TAF8_HUMAN/29-106--------------------------------------------------------------------------------
Q9NAZ5_DROHY/4-80--------------------------------------------------------------------------------
Q8MSB9_DROME/4-80--------------------------------------------------------------------------------
Q7S5N4_NEUCR/125-200--------------------------------------------------------------------------------
Q7YTH5_CAEEL/66-142--------------------------------------------------------------------------------

PF15630

A3GI04_PICST/11-91--------------------------------------------------------------------------------
A6RJU4_BOTFB/10-85--------------------------------------------------------------------------------
A7RMQ5_NEMVE/23-98--------------------------------------------------------------------------------
A7TEH2_VANPO/17-91--------------------------------------------------------------------------------
B2W5N7_PYRTR/12-87--------------------------------------------------------------------------------
B3DJV8_DANRE/9-84--------------------------------------------------------------------------------
B3RZC1_TRIAD/15-90--------------------------------------------------------------------------------
B6JX09_SCHJY/4-85--------------------------------------------------------------------------------
B6QUS3_PENMQ/14-92--------------------------------------------------------------------------------
B7PXV9_IXOSC/11-86--------------------------------------------------------------------------------
C4Y931_CLAL4/26-101--------------------------------------------------------------------------------
C5DNB5_LACTC/22-96--------------------------------------------------------------------------------
C5G144_ARTOC/13-88--------------------------------------------------------------------------------
C5PFL7_COCP7/14-89--------------------------------------------------------------------------------
C7YTU2_NECH7/15-94--------------------------------------------------------------------------------
D3B378_POLPA/165-243--------------------------------------------------------------------------------
D5GA13_TUBMM/32-107--------------------------------------------------------------------------------
D7FWQ8_ECTSI/32-105--------------------------------------------------------------------------------
E4ZQ21_LEPMJ/13-88--------------------------------------------------------------------------------
E9CD47_CAPO3/14-89--------------------------------------------------------------------------------
E9ECA7_METAQ/10-85--------------------------------------------------------------------------------
F0XLX6_GROCL/7-82--------------------------------------------------------------------------------
F4PRK1_DICFS/235-311--------------------------------------------------------------------------------
F4RWE9_MELLP/40-115--------------------------------------------------------------------------------
F6Y3J5_MONDO/1-76--------------------------------------------------------------------------------
F7DQN4_XENTR/13-88--------------------------------------------------------------------------------
F7VU88_SORMK/11-86--------------------------------------------------------------------------------
F9WY71_MYCGM/13-88--------------------------------------------------------------------------------
G0V9K8_NAUCC/14-94--------------------------------------------------------------------------------
G3BEG3_CANTC/8-83--------------------------------------------------------------------------------
G3MSD4_9ACAR/15-89--------------------------------------------------------------------------------
G3PEU4_GASAC/26-101--------------------------------------------------------------------------------
G3VT77_SARHA/17-92--------------------------------------------------------------------------------
G4LYK5_SCHMA/9-84--------------------------------------------------------------------------------
G4MZ92_MAGO7/9-84--------------------------------------------------------------------------------
G6DRA0_DANPL/11-86--------------------------------------------------------------------------------
G8YL18_PICSO/12-89--------------------------------------------------------------------------------
H1VQ95_COLHI/11-86--------------------------------------------------------------------------------
H2LES2_ORYLA/10-85--------------------------------------------------------------------------------
H2N958_PONAB/17-92--------------------------------------------------------------------------------
H6C6E0_EXODN/12-87--------------------------------------------------------------------------------
H9J6V9_BOMMO/11-84--------------------------------------------------------------------------------
H9KVI3_CHICK/15-90--------------------------------------------------------------------------------
I1FQJ7_AMPQE/21-96--------------------------------------------------------------------------------
Q54PV0_DICDI/238-315--------------------------------------------------------------------------------
Q6BIJ2_DEBHA/13-90--------------------------------------------------------------------------------

PF00125

Q8IL74_PLAF7/27-103--------------------------------------------------------------------------------
H2BWT_HUMAN/75-145--------------------------------------------------------------------------------
Q7PVU9_ANOGA/105-178--------------------------------------------------------------------------------
H4_CAEEL/25-94--------------------------------------------------------------------------------
H2A2_XENLA/18-91--------------------------------------------------------------------------------
H2AB2_HUMAN/22-95--------------------------------------------------------------------------------
O00912_LEIIN/23-92--------------------------------------------------------------------------------
O02612_LEIIN/19-89--------------------------------------------------------------------------------
O02613_CRIFA/18-93--------------------------------------------------------------------------------
O02648_DROSI/58-132--------------------------------------------------------------------------------
O15582_ENTHI/30-100--------------------------------------------------------------------------------
O18643_CHAVR/29-99--------------------------------------------------------------------------------
CENPA_MOUSE/51-127--------------------------------------------------------------------------------
O44009_LEIBR/52-126--------------------------------------------------------------------------------
H2B_CAPAN/52-122--------------------------------------------------------------------------------
O96761_9TRYP/19-89--------------------------------------------------------------------------------
O96955_PLAVI/25-95--------------------------------------------------------------------------------
H2B_EUPCR/20-90--------------------------------------------------------------------------------
HCP3L_CAEEL/180-257--------------------------------------------------------------------------------
HAP5_YEAST/152-225--------------------------------------------------------------------------------
Q19649_CAEEL/40-114--------------------------------------------------------------------------------
Q23429_CAEEL/30-104--------------------------------------------------------------------------------
E2RTQ0_GIAIN/25-101--------------------------------------------------------------------------------
E2RU60_GIAIN/21-90--------------------------------------------------------------------------------
E2RU15_GIAIN/15-88--------------------------------------------------------------------------------
A8BYH2_GIAIC/69-146--------------------------------------------------------------------------------
A8B678_GIAIC/68-148--------------------------------------------------------------------------------
A8B471_GIAIC/102-178--------------------------------------------------------------------------------
Q7RRA6_PLAYO/27-103--------------------------------------------------------------------------------
Q7XV46_ORYSJ/214-290--------------------------------------------------------------------------------
Q7XYY4_PYRLU/77-151--------------------------------------------------------------------------------
Q7Z106_PARTE/51-125--------------------------------------------------------------------------------
CENPA_DANRE/65-140--------------------------------------------------------------------------------
H2AV3_ORYSJ/32-106--------------------------------------------------------------------------------
H2A3_ORYSJ/19-92--------------------------------------------------------------------------------
Q867G5_TRYBB/61-135--------------------------------------------------------------------------------
Q867U7_TRYBB/41-111--------------------------------------------------------------------------------
Q86EU0_SCHJA/18-91--------------------------------------------------------------------------------
CENPA_CANGA/159-236--------------------------------------------------------------------------------
Q8BP16_MOUSE/15-88--------------------------------------------------------------------------------
Q8IDZ1_PLAF7/90-167--------------------------------------------------------------------------------
Q8LK76_MAIZE/76-152--------------------------------------------------------------------------------
Q8NIA3_HUMAN/97-169--------------------------------------------------------------------------------
H3L_ENCCU/57-130--------------------------------------------------------------------------------
H4_ENCCU/27-96--------------------------------------------------------------------------------
H31_ENCCU/59-135--------------------------------------------------------------------------------
Q8T9Z4_DROOR/130-206--------------------------------------------------------------------------------
Q8TA36_HETGL/23-92--------------------------------------------------------------------------------
Q8VEE3_MOUSE/32-99--------------------------------------------------------------------------------
H2BV_BOVIN/29-99--------------------------------------------------------------------------------
Q92646_HUMAN/13-84--------------------------------------------------------------------------------
Q98SC6_GUITH/26-100--------------------------------------------------------------------------------
Q9CQ70_MOUSE/15-88--------------------------------------------------------------------------------
H2BV_MOUSE/30-100--------------------------------------------------------------------------------
Q9DAB5_MOUSE/130-200--------------------------------------------------------------------------------
Q9DAD9_MOUSE/13-86--------------------------------------------------------------------------------
Q9GRH3_STYLE/100-174--------------------------------------------------------------------------------
H3L1_LILLO/70-144--------------------------------------------------------------------------------
H2B_LILLO/48-118--------------------------------------------------------------------------------
H2B2_ARATH/145-215--------------------------------------------------------------------------------
H2A8_ARATH/23-97--------------------------------------------------------------------------------
Q9XG41_GUITH/8-78--------------------------------------------------------------------------------
H2A1_LILLO/18-91--------------------------------------------------------------------------------
CENPA_SCHPO/38-118--------------------------------------------------------------------------------

PF04719

Q20563_CAEEL/236-327--------------------------------------------------------------------------------
Q9M565_ARATH/105-194--------------------------------------------------------------------------------
Q9AW46_GUITH/30-124--------------------------------------------------------------------------------
TAF11_DROME/89-177--------------------------------------------------------------------------------
TAF11_MOUSE/106-194--------------------------------------------------------------------------------
Q9C2R5_NEUCS/200-281--------------------------------------------------------------------------------
TAF11_YEAST/124-213--------------------------------------------------------------------------------
Q9LNS8_ARATH/128-217--------------------------------------------------------------------------------
TAF11_SCHPO/93-181--------------------------------------------------------------------------------
Q21417_CAEEL/221-312--------------------------------------------------------------------------------

PF02269

SUPT3_HUMAN/106-198--------------------------------------------------------------------------------
Q17957_CAEEL/27-116--------------------------------------------------------------------------------
SPT3_YEAST/5-96--------------------------------------------------------------------------------
SPT3_SCHPO/8-99--------------------------------------------------------------------------------
TAF13_YEAST/9-101--------------------------------------------------------------------------------
TAF13_HUMAN/30-119--------------------------------------------------------------------------------

PF03847

TAF12_YEAST/416-488--------------------------------------------------------------------------------
TAF12_SCHPO/344-411--------------------------------------------------------------------------------
TAF12_DROME/93-160--------------------------------------------------------------------------------
Q9VR21_DROME/67-133--------------------------------------------------------------------------------
Q9SR71_ARATH/401-468--------------------------------------------------------------------------------
TAF12_HUMAN/59-126--------------------------------------------------------------------------------
Q9U226_CAEEL/233-297--------------------------------------------------------------------------------
Q9LNR1_ARATH/526-593--------------------------------------------------------------------------------

PF00808

NFYB9_ARATH/62-127--------------------------------------------------------------------------------
HARB_PYRSG/2-65--------------------------------------------------------------------------------
HFO2_METFO/2-65--------------------------------------------------------------------------------
HJA2_METJA/2-65--------------------------------------------------------------------------------
NFYB4_ARATH/6-71--------------------------------------------------------------------------------
Q20237_CAEEL/64-128--------------------------------------------------------------------------------
HMFB_METFE/1-64--------------------------------------------------------------------------------
Q9V452_DROME/18-83--------------------------------------------------------------------------------
NFYB5_ARATH/54-119--------------------------------------------------------------------------------
HAF2_ARCFU/2-65--------------------------------------------------------------------------------
Q9GSP1_DROME/10-74--------------------------------------------------------------------------------
Q9FHS0_ARATH/10-74--------------------------------------------------------------------------------
NC2B_HUMAN/11-75--------------------------------------------------------------------------------
HAP3_KLULA/25-90--------------------------------------------------------------------------------
HAF1_ARCFU/6-69--------------------------------------------------------------------------------
HFOB_METFO/1-64--------------------------------------------------------------------------------
Q9LN09_ARATH/108-172--------------------------------------------------------------------------------
HAP3_SCHPO/10-75--------------------------------------------------------------------------------
O59848_ASPOZ/46-111--------------------------------------------------------------------------------
O93641_9EURY/3-67--------------------------------------------------------------------------------
O76256_SCHMA/27-92--------------------------------------------------------------------------------
NC2B_SCHPO/10-75--------------------------------------------------------------------------------
Q9LHG0_ARATH/7-71--------------------------------------------------------------------------------
O17072_CAEEL/108-174--------------------------------------------------------------------------------
O73745_XENLA/39-103--------------------------------------------------------------------------------
O45550_CAEEL/20-84--------------------------------------------------------------------------------
NC2B_ARATH/14-79--------------------------------------------------------------------------------
O17286_CAEEL/64-129--------------------------------------------------------------------------------

PF15511

H2QBC7_PANTR/25-514...G.SPHVYHSLPCTPHTGAEDAEQAAGRKTQSSGPGLQK..NSPGKPAQFLAGEAEEGDAFALGFLSTSSGVSGEDEV
G3SYD4_LOXAF/26-492...GRSPSTHCSLPGPSHTGAVHAERAVGRRTWS.GPGLQN..NS...............EWAGLGFATPSLPFS.....
E2RJV5_CANFA/26-460...GRSPSVYHSLPCLSHTEAEDAERAVSHRTQSSGPKLQN.........................YSVRAGSVWGQDTL
F6PKQ6_HORSE/26-517...GRSPSVHHSLPCPSHSGAEDAERAVSHRTRSTGPRLQN..NSPGKPAQLLAGKA.EVDALAMNFPNTSSSIFGEVGV
F1S2K5_PIG/26-517...GHSPSVRHSLPCPPHSGAKELERADSRRTLSGGPGPQN..NGPGEPAQLLAGKVEEAAAAAVGFPNASSSISGEDGV
G1PFK4_MYOLU/26-518...GRSPSVHHSLPYPSLS....AERTVSRRTRSSGPGLQN..NSPGKPAQFLAGKAEEVDALAMGFPNTSSSTSGEDGL
H0XDJ1_OTOGA/25-517...GCSPSMHGSQPLPSHTGAEDTERVASPRTWSSGSRLQN..SSPEKPAQFLARKAKEVNALALGFPNTSNSISG.DAV
G1SQR3_RABIT/26-502...GRSPSVHHSLPHPSHNETEDTEKAVDHWTQSSQPGLQNDSEYVGQVAWSVHPQAHMCASWLWAPPASKSRVSVGPG.
H0UV87_CAVPO/26-506...DHSASVYHSLPHP.HPGPEDAERAVRHRTQNSSPELQN..HSEWPAAMLSLGRIIPTGFLSSNLESSLCGSNK....
CENPT_RAT/26-471...GCSLSVHHSLPNPSQTEVEDAERVVGPRTPSTGTRPQSQMSRAGFGASPLPF.........................
F7C6J3_ORNAN/50-507...WDQSRPHHSQVQPAGEGKQDPDKADAHQTRS.................................PSSAASRLSPARQ
B2WAR3_PYRTR/18-424...RADGLLDQTIDGGLDEDDTTTQMRAL...............................................TGRR
Q0V6N5_PHANO/18-452...RRDGLLDQTINEALDEDDTTTQIRAL...............................................TGRR
E4ZUA3_LEPMJ/75-488...RRNTILDQPIDEALEEDDTTTQLRAL...............................................TGRR
H1V6T6_COLHI/84-483...VGALDEESGRDREESFGRDEEENLRR...............................................QTMA
G2WXZ9_VERDV/71-445...ADEGMDDEGAVDATLERIDEERRETL...................................................
F0XUM0_GROCL/71-509...FDNLAVEQPGEDITFERLDSESGQQM................................................DAF
G2Q011_THIHA/56-448...VMEEGNVTMGVLDLSSPERLDSDVGR.................................................RE
G2R3Q2_THITE/60-455...VLDEGNLTVGPEELPSPERLDSEADR.................................................RD
Q2H4H2_CHAGB/63-448...VLDDGIT.MGLEELPSPERLDSDDRR..................................................D
B2AUG9_PODAN/52-455...VVEEEGTFTMADIMSPERIEDGRRET...................................................
F7VUV4_SORMK/70-543FDDDDDDEFGNAEDRIPDEFSRLDSDDPT................................RRRETIGHLEGGGGMGMGL
G5EH18_MAGO7/96-512...FDDGDTVRLENDTIERLDSPQGRQDA.................................................LA
C7YN20_NECH7/70-475...LEDLQARAGADDLSLDQ..FDADQSR................................................RMT
I1RX16_GIBZE/59-455...LENLDARAG..DVSLEASRFEADQTR................................................RMT
E9EUR1_METAR/77-484...LDNIRAQAIASGNQTITRIDDESRRN.................................................TV
G3JMA4_CORMM/68-522...LADLQDRADDNAVAFQRGRFENDPTM.................................................RT
H6BTF1_EXODN/11-447...IRMSDFGSELEIRRESEVKTSRSQHD..................................................Q
A6SS64_BOTFB/43-483...FENDDFREMANSPFFGSDRAGLQGEL.........................................ETALHRRSLL
Q5B3X8_EMENI/64-438...MPDG....EQDETIISHGAFDRGGET...................................................
G7XFC4_ASPKW/68-429...VHG.DD..GGEDTVLTQGDFDGGGET...................................................
Q4WWL8_ASPFU/76-441...EGD.....GPDDTMISQGAFDRGGET...................................................
B6HEI8_PENCW/70-421...VGEDD...EAEDTMMSGGDFDRGGET...................................................
B8MMW5_TALSN/60-429...AQNDDD..DIEQSQLDEGAFDAGGET...................................................
C5FZG9_ARTOC/82-443...PEEDFDED..VDNTTGQPMLDAGGET...................................................
C5PIR4_COCP7/46-397...QGDDNFVDDQIELTAEQPIFDVGGET...................................................
C1H556_PARBA/152-504...HEDEDDDHGAD..TTGQPLFDAGGET...................................................
D5G8P1_TUBMM/86-466...ASRMSVVNDGDGDVTGDITGALDGNL...................................................
G1XD77_ARTOA/125-537...LSFADHTIDLNAPEEDVSGLFNAQGM...................................................
B6K2P7_SCHJY/48-429...VSLSGIEPDQDPETIRAAERSSLKSP...................................................

PF02291

TAF9_YEAST/19-152--------------------------------------------------------------------------------
TAF9_HUMAN/2-130--------------------------------------------------------------------------------
TAF9_DROME/8-136--------------------------------------------------------------------------------
O45784_CAEEL/13-136--------------------------------------------------------------------------------
TAF9_SCHPO/3-133--------------------------------------------------------------------------------

PF15510

B2RVH1_MOUSE/1-86--------------------------------------------------------------------------------
F1S2W8_PIG/1-102--------------------------------------------------------------------------------
G7P379_MACFA/1-103--------------------------------------------------------------------------------
H0VLK4_CAVPO/1-103--------------------------------------------------------------------------------
D3Z8J2_RAT/1-86--------------------------------------------------------------------------------
G1P8B1_MYOLU/1-88--------------------------------------------------------------------------------

PF02969

TAF6_XENLA/9-74--------------------------------------------------------------------------------
TAF6L_HUMAN/9-73--------------------------------------------------------------------------------
TAF6_SCHPO/3-68--------------------------------------------------------------------------------
Q8LRG9_ORYSJ/1-68--------------------------------------------------------------------------------
TAF6_YEAST/9-74--------------------------------------------------------------------------------
Q9MAU3_ARATH/1-68--------------------------------------------------------------------------------
Q9DDC0_PLEWA/11-76--------------------------------------------------------------------------------
TAF6_DROME/18-83--------------------------------------------------------------------------------
TAF6_HUMAN/11-76--------------------------------------------------------------------------------
Q9GZI6_CAEEL/24-85--------------------------------------------------------------------------------

PF07524

SPT7_SCHPO/707-783--------------------------------------------------------------------------------
TAF8_DANRE/32-108--------------------------------------------------------------------------------
TAF3_SCHPO/7-83--------------------------------------------------------------------------------
ST65G_HUMAN/151-230--------------------------------------------------------------------------------
Q8LFR3_ARATH/24-100--------------------------------------------------------------------------------
Q9VP40_DROME/6-77--------------------------------------------------------------------------------
Q9SA19_ARATH/24-100--------------------------------------------------------------------------------
TAF8_HUMAN/29-106--------------------------------------------------------------------------------
Q9NAZ5_DROHY/4-80--------------------------------------------------------------------------------
Q8MSB9_DROME/4-80--------------------------------------------------------------------------------
Q7S5N4_NEUCR/125-200--------------------------------------------------------------------------------
Q7YTH5_CAEEL/66-142--------------------------------------------------------------------------------

PF15630

A3GI04_PICST/11-91--------------------------------------------------------------------------------
A6RJU4_BOTFB/10-85--------------------------------------------------------------------------------
A7RMQ5_NEMVE/23-98--------------------------------------------------------------------------------
A7TEH2_VANPO/17-91--------------------------------------------------------------------------------
B2W5N7_PYRTR/12-87--------------------------------------------------------------------------------
B3DJV8_DANRE/9-84--------------------------------------------------------------------------------
B3RZC1_TRIAD/15-90--------------------------------------------------------------------------------
B6JX09_SCHJY/4-85--------------------------------------------------------------------------------
B6QUS3_PENMQ/14-92--------------------------------------------------------------------------------
B7PXV9_IXOSC/11-86--------------------------------------------------------------------------------
C4Y931_CLAL4/26-101--------------------------------------------------------------------------------
C5DNB5_LACTC/22-96--------------------------------------------------------------------------------
C5G144_ARTOC/13-88--------------------------------------------------------------------------------
C5PFL7_COCP7/14-89--------------------------------------------------------------------------------
C7YTU2_NECH7/15-94--------------------------------------------------------------------------------
D3B378_POLPA/165-243--------------------------------------------------------------------------------
D5GA13_TUBMM/32-107--------------------------------------------------------------------------------
D7FWQ8_ECTSI/32-105--------------------------------------------------------------------------------
E4ZQ21_LEPMJ/13-88--------------------------------------------------------------------------------
E9CD47_CAPO3/14-89--------------------------------------------------------------------------------
E9ECA7_METAQ/10-85--------------------------------------------------------------------------------
F0XLX6_GROCL/7-82--------------------------------------------------------------------------------
F4PRK1_DICFS/235-311--------------------------------------------------------------------------------
F4RWE9_MELLP/40-115--------------------------------------------------------------------------------
F6Y3J5_MONDO/1-76--------------------------------------------------------------------------------
F7DQN4_XENTR/13-88--------------------------------------------------------------------------------
F7VU88_SORMK/11-86--------------------------------------------------------------------------------
F9WY71_MYCGM/13-88--------------------------------------------------------------------------------
G0V9K8_NAUCC/14-94--------------------------------------------------------------------------------
G3BEG3_CANTC/8-83--------------------------------------------------------------------------------
G3MSD4_9ACAR/15-89--------------------------------------------------------------------------------
G3PEU4_GASAC/26-101--------------------------------------------------------------------------------
G3VT77_SARHA/17-92--------------------------------------------------------------------------------
G4LYK5_SCHMA/9-84--------------------------------------------------------------------------------
G4MZ92_MAGO7/9-84--------------------------------------------------------------------------------
G6DRA0_DANPL/11-86--------------------------------------------------------------------------------
G8YL18_PICSO/12-89--------------------------------------------------------------------------------
H1VQ95_COLHI/11-86--------------------------------------------------------------------------------
H2LES2_ORYLA/10-85--------------------------------------------------------------------------------
H2N958_PONAB/17-92--------------------------------------------------------------------------------
H6C6E0_EXODN/12-87--------------------------------------------------------------------------------
H9J6V9_BOMMO/11-84--------------------------------------------------------------------------------
H9KVI3_CHICK/15-90--------------------------------------------------------------------------------
I1FQJ7_AMPQE/21-96--------------------------------------------------------------------------------
Q54PV0_DICDI/238-315--------------------------------------------------------------------------------
Q6BIJ2_DEBHA/13-90--------------------------------------------------------------------------------

PF00125

Q8IL74_PLAF7/27-103--------------------------------------------------------------------------------
H2BWT_HUMAN/75-145--------------------------------------------------------------------------------
Q7PVU9_ANOGA/105-178--------------------------------------------------------------------------------
H4_CAEEL/25-94--------------------------------------------------------------------------------
H2A2_XENLA/18-91--------------------------------------------------------------------------------
H2AB2_HUMAN/22-95--------------------------------------------------------------------------------
O00912_LEIIN/23-92--------------------------------------------------------------------------------
O02612_LEIIN/19-89--------------------------------------------------------------------------------
O02613_CRIFA/18-93--------------------------------------------------------------------------------
O02648_DROSI/58-132--------------------------------------------------------------------------------
O15582_ENTHI/30-100--------------------------------------------------------------------------------
O18643_CHAVR/29-99--------------------------------------------------------------------------------
CENPA_MOUSE/51-127--------------------------------------------------------------------------------
O44009_LEIBR/52-126--------------------------------------------------------------------------------
H2B_CAPAN/52-122--------------------------------------------------------------------------------
O96761_9TRYP/19-89--------------------------------------------------------------------------------
O96955_PLAVI/25-95--------------------------------------------------------------------------------
H2B_EUPCR/20-90--------------------------------------------------------------------------------
HCP3L_CAEEL/180-257--------------------------------------------------------------------------------
HAP5_YEAST/152-225--------------------------------------------------------------------------------
Q19649_CAEEL/40-114--------------------------------------------------------------------------------
Q23429_CAEEL/30-104--------------------------------------------------------------------------------
E2RTQ0_GIAIN/25-101--------------------------------------------------------------------------------
E2RU60_GIAIN/21-90--------------------------------------------------------------------------------
E2RU15_GIAIN/15-88--------------------------------------------------------------------------------
A8BYH2_GIAIC/69-146--------------------------------------------------------------------------------
A8B678_GIAIC/68-148--------------------------------------------------------------------------------
A8B471_GIAIC/102-178--------------------------------------------------------------------------------
Q7RRA6_PLAYO/27-103--------------------------------------------------------------------------------
Q7XV46_ORYSJ/214-290--------------------------------------------------------------------------------
Q7XYY4_PYRLU/77-151--------------------------------------------------------------------------------
Q7Z106_PARTE/51-125--------------------------------------------------------------------------------
CENPA_DANRE/65-140--------------------------------------------------------------------------------
H2AV3_ORYSJ/32-106--------------------------------------------------------------------------------
H2A3_ORYSJ/19-92--------------------------------------------------------------------------------
Q867G5_TRYBB/61-135--------------------------------------------------------------------------------
Q867U7_TRYBB/41-111--------------------------------------------------------------------------------
Q86EU0_SCHJA/18-91--------------------------------------------------------------------------------
CENPA_CANGA/159-236--------------------------------------------------------------------------------
Q8BP16_MOUSE/15-88--------------------------------------------------------------------------------
Q8IDZ1_PLAF7/90-167--------------------------------------------------------------------------------
Q8LK76_MAIZE/76-152--------------------------------------------------------------------------------
Q8NIA3_HUMAN/97-169--------------------------------------------------------------------------------
H3L_ENCCU/57-130--------------------------------------------------------------------------------
H4_ENCCU/27-96--------------------------------------------------------------------------------
H31_ENCCU/59-135--------------------------------------------------------------------------------
Q8T9Z4_DROOR/130-206--------------------------------------------------------------------------------
Q8TA36_HETGL/23-92--------------------------------------------------------------------------------
Q8VEE3_MOUSE/32-99--------------------------------------------------------------------------------
H2BV_BOVIN/29-99--------------------------------------------------------------------------------
Q92646_HUMAN/13-84--------------------------------------------------------------------------------
Q98SC6_GUITH/26-100--------------------------------------------------------------------------------
Q9CQ70_MOUSE/15-88--------------------------------------------------------------------------------
H2BV_MOUSE/30-100--------------------------------------------------------------------------------
Q9DAB5_MOUSE/130-200--------------------------------------------------------------------------------
Q9DAD9_MOUSE/13-86--------------------------------------------------------------------------------
Q9GRH3_STYLE/100-174--------------------------------------------------------------------------------
H3L1_LILLO/70-144--------------------------------------------------------------------------------
H2B_LILLO/48-118--------------------------------------------------------------------------------
H2B2_ARATH/145-215--------------------------------------------------------------------------------
H2A8_ARATH/23-97--------------------------------------------------------------------------------
Q9XG41_GUITH/8-78--------------------------------------------------------------------------------
H2A1_LILLO/18-91--------------------------------------------------------------------------------
CENPA_SCHPO/38-118--------------------------------------------------------------------------------

PF04719

Q20563_CAEEL/236-327--------------------------------------------------------------------------------
Q9M565_ARATH/105-194--------------------------------------------------------------------------------
Q9AW46_GUITH/30-124--------------------------------------------------------------------------------
TAF11_DROME/89-177--------------------------------------------------------------------------------
TAF11_MOUSE/106-194--------------------------------------------------------------------------------
Q9C2R5_NEUCS/200-281--------------------------------------------------------------------------------
TAF11_YEAST/124-213--------------------------------------------------------------------------------
Q9LNS8_ARATH/128-217--------------------------------------------------------------------------------
TAF11_SCHPO/93-181--------------------------------------------------------------------------------
Q21417_CAEEL/221-312--------------------------------------------------------------------------------

PF02269

SUPT3_HUMAN/106-198--------------------------------------------------------------------------------
Q17957_CAEEL/27-116--------------------------------------------------------------------------------
SPT3_YEAST/5-96--------------------------------------------------------------------------------
SPT3_SCHPO/8-99--------------------------------------------------------------------------------
TAF13_YEAST/9-101--------------------------------------------------------------------------------
TAF13_HUMAN/30-119--------------------------------------------------------------------------------

PF03847

TAF12_YEAST/416-488--------------------------------------------------------------------------------
TAF12_SCHPO/344-411--------------------------------------------------------------------------------
TAF12_DROME/93-160--------------------------------------------------------------------------------
Q9VR21_DROME/67-133--------------------------------------------------------------------------------
Q9SR71_ARATH/401-468--------------------------------------------------------------------------------
TAF12_HUMAN/59-126--------------------------------------------------------------------------------
Q9U226_CAEEL/233-297--------------------------------------------------------------------------------
Q9LNR1_ARATH/526-593--------------------------------------------------------------------------------

PF00808

NFYB9_ARATH/62-127--------------------------------------------------------------------------------
HARB_PYRSG/2-65--------------------------------------------------------------------------------
HFO2_METFO/2-65--------------------------------------------------------------------------------
HJA2_METJA/2-65--------------------------------------------------------------------------------
NFYB4_ARATH/6-71--------------------------------------------------------------------------------
Q20237_CAEEL/64-128--------------------------------------------------------------------------------
HMFB_METFE/1-64--------------------------------------------------------------------------------
Q9V452_DROME/18-83--------------------------------------------------------------------------------
NFYB5_ARATH/54-119--------------------------------------------------------------------------------
HAF2_ARCFU/2-65--------------------------------------------------------------------------------
Q9GSP1_DROME/10-74--------------------------------------------------------------------------------
Q9FHS0_ARATH/10-74--------------------------------------------------------------------------------
NC2B_HUMAN/11-75--------------------------------------------------------------------------------
HAP3_KLULA/25-90--------------------------------------------------------------------------------
HAF1_ARCFU/6-69--------------------------------------------------------------------------------
HFOB_METFO/1-64--------------------------------------------------------------------------------
Q9LN09_ARATH/108-172--------------------------------------------------------------------------------
HAP3_SCHPO/10-75--------------------------------------------------------------------------------
O59848_ASPOZ/46-111--------------------------------------------------------------------------------
O93641_9EURY/3-67--------------------------------------------------------------------------------
O76256_SCHMA/27-92--------------------------------------------------------------------------------
NC2B_SCHPO/10-75--------------------------------------------------------------------------------
Q9LHG0_ARATH/7-71--------------------------------------------------------------------------------
O17072_CAEEL/108-174--------------------------------------------------------------------------------
O73745_XENLA/39-103--------------------------------------------------------------------------------
O45550_CAEEL/20-84--------------------------------------------------------------------------------
NC2B_ARATH/14-79--------------------------------------------------------------------------------
O17286_CAEEL/64-129--------------------------------------------------------------------------------

PF15511

H2QBC7_PANTR/25-514EPLHGGV..EEAEKKMEEE..GVSMSEMEATGAQGPSRVEEAEG....HTEVTEAEGSQGTAEAD........GPGASSG
G3SYD4_LOXAF/26-492......................................EEESEG....HTEVTEADGSAGAVEAK........EPGGSSG
E2RJV5_CANFA/26-460N....................................KTENSKG....YREMTE......AVETN........EPKGSSE
F6PKQ6_HORSE/26-517EPLQDGVG.GEAEERTEKS..LSMSKVKEAARARGSARAQEPEG....HTQVTEAEGSQGAIETK........EPEGSSG
F1S2K5_PIG/26-517EPLQNRVG.EEAEERTEES..WSMREVEEAAGAQGSARAGEPEG....HTEVTEAEGSWGAVEAK........EPEGSSE
G1PFK4_MYOLU/26-518EPLLGGVG.EEVEERMEES..MSLSEVKEAAGAQASARAEEPEA....HTEVAEAEGSWGAIEEK........EPEGSSG
H0XDJ1_OTOGA/25-517EPLQDGVG.EEAEKKMEEEEGLSMSEVKETTGSQGPFRAEQPGG....HTEVTESEGFQGAVETE........EPEESKG
G1SQR3_RABIT/26-502................DRRSVCPGTALDRLPSVGGSEPHPWPAA....PPEVTESMGSQGAVEAE........ESDVSSG
H0UV87_CAVPO/26-506.....................EHMSKAVATPSLPFLGLPPERAA....PPEVTEAVTFQRAVEGTLELAWVVLGTGDVWG
CENPT_RAT/26-471......................................SEPQPQ....SPELREAVGSKEAEEPK........DLEGSSG
F7C6J3_ORNAN/50-507VDGGLAGKGKAAPLAGEDVATTAMGEREGTPLAGEDGTSAVTGEGKAASPEPLVEEDGLATTEEEEVETEAEGSEEHTGA
B2WAR3_PYRTR/18-424DGRPSDVNLGVFGEVEDDMDEPTFRFQIPERIRLPVQEDQREGQ....RDQEVEEDQDRDIGPQDLPDDSEMLDDNEQEN
Q0V6N5_PHANO/18-452DGRPSDVDLGVFGDAEDDNDEPTFRFNIPERIRAPQREEPTEEQ......DFEDALEDALPTFANDDEELLQPEGDEQDE
E4ZUA3_LEPMJ/75-488DGRPSDVDLGIFGRDDDDTEEPTFRFNIPERIRAPARTREQEEQ.....EQEEVGQDADSEPPGPQDESMQYLEDDEQNE
H1V6T6_COLHI/84-483SARASDFG.FEVPVDADNQTTFVMAVEGQSSPARPLPEVTDEQP....SLNITPAYDESVFDELNPPMDEDMGFGGAYDD
G2WXZ9_VERDV/71-445GGRPSDFG.FAIPQDADPDASTFIMGLGPQSSPTRPVDVAPDEI....EVDLGPVMEEDPSALMEATFDALASDANQPDP
F0XUM0_GROCL/71-509DGRESGFGVIDVPLNGDE...TTFLL...GPQGGADQPMADETA....GPAYSDGGDDGGPADADVGTPFDDYGAGDDNG
G2Q011_THIHA/56-448LGRESDFG...IEIPVGDVNESTFIIAPQVDESPDRASAGDDQP..........IHVDYAPLVDQRSDDFNDADL.GEMP
G2R3Q2_THITE/60-455FGRESDLG...IEVPVGDVNDSTFVIAPQVQESPDRPLFADGEP..........GLDNYAPLVDQRSDDYDDEELLGEVP
Q2H4H2_CHAGB/63-448FGRESDFG...LEIPAGEINESTFMIAPQVEESPDRPQVDDDQP..........MYDDFAPLVDQRSDDFDDEDLLGEVP
B2AUG9_PODAN/52-455.GHESDFG...IHVPVDLDDQTSFVINPDVQSSPVRQPPDFDEPDFAPLEDARSDSYDGGDGMDNHNFDDFGDLPDAEMD
F7VUV4_SORMK/70-543LGRDSDFH.IEVPVGMDESTTTTFMIASPTRQFEVEQGQAAEPVARGGQGGGFAELMDRRSDSYD..DDDGNDIGPTTFD
G5EH18_MAGO7/96-512AGRQSDFGTIEVPLGVDSPFRLEPVLQDSSDPAPLPPPDFDNYG....DGSPAPQMNGDEEATEYENVFAEAAHAAGTRF
C7YN20_NECH7/70-475VGRESDFN.FEIPPGVGEQ..TTFMLSDPAVDVPQTSPIVDRSI....AEAMGEDAQERHADVVLGDSDSDVGGG.FDMG
I1RX16_GIBZE/59-455EGRGSDFN.LDMPEGLDDQ..TVFQMSDPA.DVEQTSPIVDQSV....AEARGDEARDPQQNVVFG.SDSDGGAGDFGMD
E9EUR1_METAR/77-484TGRGSEFG.LQIPPGAEE...TTFMMSEPPADGGGTSPLMVEKS....IAETRANNAANQGGIGDVTPIRPSGPDDGASD
G3JMA4_CORMM/68-522IGRESEFT...IGVPPDMGDQTTFMFSEPGGDAPATSPLPGTSATAAAARAGGDTTYGNVSLALDNPDGEDLPPFGDDDE
H6BTF1_EXODN/11-447SGYGLDYD.DHDPLDVGGETEHLGNLGQPSPPLPPPDESTMNIA....PLEESFQLDVSGEEAVSSNARVASAGTLLEGV
A6SS64_BOTFB/43-483PGRSSDIRPYDSPSEERD...ATFVFTVPQPEIPAQFEPSPSPD....DTPTGMPIMDEISSPA.NFQGDDFEIDDEAMN
Q5B3X8_EMENI/64-438................EDLGRFNFDLNFPSPAAQP.DDLDADEP....INDDEGFELPAIDLESEHGPDADPGSDDDEVG
G7XFC4_ASPKW/68-429................EDLGRFNFEFNFPSPPAPG.AELDQEEP....IHDDEGFELS.MDMPMDTGAGSD...DADSVS
Q4WWL8_ASPFU/76-441................EDLGRFNFEFNFPSPPPPGEGDLMQDEP....LDDNEGFELPPVDLGPEIGAESD..MSDSDVG
B6HEI8_PENCW/70-421................EDLGRFHFDLNFPSPAAPPLEDPTGGD.....MNDMEDFELSTAQLPQAPSDDDD.........
B8MMW5_TALSN/60-429................ADLGRFNLEFNFPSPAAPA.AELDDPLP....NDEDDFMLQTDQAEIPYPSSDDDDAAADGFTG
C5FZG9_ARTOC/82-443................EDLGRFNLDFAFPTPEAPHTMPIENDNE....QDTFELDAVPPEFGGPDSPSSGSDFGTAGFEP
C5PIR4_COCP7/46-397................EDLRRFDLNFSFPTPDAPQHIENEHEDF.........VLDTTMPIADDVPVSSDDDFGAGDLEL
C1H556_PARBA/152-504................EDLRRFNIDFSFPTPDATVAGITGHQPV....N.EEDFALDAKLDMDEGFPSFNSVVGGEGIEL
D5G8P1_TUBMM/86-466.................DLDGDEPSFFLPVPEEGGEGFAQDDMG....ESEDGTLLNGHAHEEEEEVEEEYD........
G1XD77_ARTOA/125-537.............GIPDDETDFRLEQVEISPPSEPIGNGEETED....LPEITNEISSPPPPRPDDDMEPVFIGSDFDDD
B6K2P7_SCHJY/48-429.....IFTLPDDLLRDDSLPSIRHEPSIRMSASSAQLSIHLDEA....LAEEQQAERENQHVLEADQLGSPILPPLDDEQ

PF02291

TAF9_YEAST/19-152--------------------------------------------------------------------------------
TAF9_HUMAN/2-130--------------------------------------------------------------------------------
TAF9_DROME/8-136--------------------------------------------------------------------------------
O45784_CAEEL/13-136--------------------------------------------------------------------------------
TAF9_SCHPO/3-133--------------------------------------------------------------------------------

PF15510

B2RVH1_MOUSE/1-86--------------------------------------------------------------------------------
F1S2W8_PIG/1-102--------------------------------------------------------------------------------
G7P379_MACFA/1-103--------------------------------------------------------------------------------
H0VLK4_CAVPO/1-103--------------------------------------------------------------------------------
D3Z8J2_RAT/1-86--------------------------------------------------------------------------------
G1P8B1_MYOLU/1-88--------------------------------------------------------------------------------

PF02969

TAF6_XENLA/9-74--------------------------------------------------------------------------------
TAF6L_HUMAN/9-73--------------------------------------------------------------------------------
TAF6_SCHPO/3-68--------------------------------------------------------------------------------
Q8LRG9_ORYSJ/1-68--------------------------------------------------------------------------------
TAF6_YEAST/9-74--------------------------------------------------------------------------------
Q9MAU3_ARATH/1-68--------------------------------------------------------------------------------
Q9DDC0_PLEWA/11-76--------------------------------------------------------------------------------
TAF6_DROME/18-83--------------------------------------------------------------------------------
TAF6_HUMAN/11-76--------------------------------------------------------------------------------
Q9GZI6_CAEEL/24-85--------------------------------------------------------------------------------

PF07524

SPT7_SCHPO/707-783--------------------------------------------------------------------------------
TAF8_DANRE/32-108--------------------------------------------------------------------------------
TAF3_SCHPO/7-83--------------------------------------------------------------------------------
ST65G_HUMAN/151-230--------------------------------------------------------------------------------
Q8LFR3_ARATH/24-100--------------------------------------------------------------------------------
Q9VP40_DROME/6-77--------------------------------------------------------------------------------
Q9SA19_ARATH/24-100--------------------------------------------------------------------------------
TAF8_HUMAN/29-106--------------------------------------------------------------------------------
Q9NAZ5_DROHY/4-80--------------------------------------------------------------------------------
Q8MSB9_DROME/4-80--------------------------------------------------------------------------------
Q7S5N4_NEUCR/125-200--------------------------------------------------------------------------------
Q7YTH5_CAEEL/66-142--------------------------------------------------------------------------------

PF15630

A3GI04_PICST/11-91--------------------------------------------------------------------------------
A6RJU4_BOTFB/10-85--------------------------------------------------------------------------------
A7RMQ5_NEMVE/23-98--------------------------------------------------------------------------------
A7TEH2_VANPO/17-91--------------------------------------------------------------------------------
B2W5N7_PYRTR/12-87--------------------------------------------------------------------------------
B3DJV8_DANRE/9-84--------------------------------------------------------------------------------
B3RZC1_TRIAD/15-90--------------------------------------------------------------------------------
B6JX09_SCHJY/4-85--------------------------------------------------------------------------------
B6QUS3_PENMQ/14-92--------------------------------------------------------------------------------
B7PXV9_IXOSC/11-86--------------------------------------------------------------------------------
C4Y931_CLAL4/26-101--------------------------------------------------------------------------------
C5DNB5_LACTC/22-96--------------------------------------------------------------------------------
C5G144_ARTOC/13-88--------------------------------------------------------------------------------
C5PFL7_COCP7/14-89--------------------------------------------------------------------------------
C7YTU2_NECH7/15-94--------------------------------------------------------------------------------
D3B378_POLPA/165-243--------------------------------------------------------------------------------
D5GA13_TUBMM/32-107--------------------------------------------------------------------------------
D7FWQ8_ECTSI/32-105--------------------------------------------------------------------------------
E4ZQ21_LEPMJ/13-88--------------------------------------------------------------------------------
E9CD47_CAPO3/14-89--------------------------------------------------------------------------------
E9ECA7_METAQ/10-85--------------------------------------------------------------------------------
F0XLX6_GROCL/7-82--------------------------------------------------------------------------------
F4PRK1_DICFS/235-311--------------------------------------------------------------------------------
F4RWE9_MELLP/40-115--------------------------------------------------------------------------------
F6Y3J5_MONDO/1-76--------------------------------------------------------------------------------
F7DQN4_XENTR/13-88--------------------------------------------------------------------------------
F7VU88_SORMK/11-86--------------------------------------------------------------------------------
F9WY71_MYCGM/13-88--------------------------------------------------------------------------------
G0V9K8_NAUCC/14-94--------------------------------------------------------------------------------
G3BEG3_CANTC/8-83--------------------------------------------------------------------------------
G3MSD4_9ACAR/15-89--------------------------------------------------------------------------------
G3PEU4_GASAC/26-101--------------------------------------------------------------------------------
G3VT77_SARHA/17-92--------------------------------------------------------------------------------
G4LYK5_SCHMA/9-84--------------------------------------------------------------------------------
G4MZ92_MAGO7/9-84--------------------------------------------------------------------------------
G6DRA0_DANPL/11-86--------------------------------------------------------------------------------
G8YL18_PICSO/12-89--------------------------------------------------------------------------------
H1VQ95_COLHI/11-86--------------------------------------------------------------------------------
H2LES2_ORYLA/10-85--------------------------------------------------------------------------------
H2N958_PONAB/17-92--------------------------------------------------------------------------------
H6C6E0_EXODN/12-87--------------------------------------------------------------------------------
H9J6V9_BOMMO/11-84--------------------------------------------------------------------------------
H9KVI3_CHICK/15-90--------------------------------------------------------------------------------
I1FQJ7_AMPQE/21-96--------------------------------------------------------------------------------
Q54PV0_DICDI/238-315--------------------------------------------------------------------------------
Q6BIJ2_DEBHA/13-90--------------------------------------------------------------------------------

PF00125

Q8IL74_PLAF7/27-103--------------------------------------------------------------------------------
H2BWT_HUMAN/75-145--------------------------------------------------------------------------------
Q7PVU9_ANOGA/105-178--------------------------------------------------------------------------------
H4_CAEEL/25-94--------------------------------------------------------------------------------
H2A2_XENLA/18-91--------------------------------------------------------------------------------
H2AB2_HUMAN/22-95--------------------------------------------------------------------------------
O00912_LEIIN/23-92--------------------------------------------------------------------------------
O02612_LEIIN/19-89--------------------------------------------------------------------------------
O02613_CRIFA/18-93--------------------------------------------------------------------------------
O02648_DROSI/58-132--------------------------------------------------------------------------------
O15582_ENTHI/30-100--------------------------------------------------------------------------------
O18643_CHAVR/29-99--------------------------------------------------------------------------------
CENPA_MOUSE/51-127--------------------------------------------------------------------------------
O44009_LEIBR/52-126--------------------------------------------------------------------------------
H2B_CAPAN/52-122--------------------------------------------------------------------------------
O96761_9TRYP/19-89--------------------------------------------------------------------------------
O96955_PLAVI/25-95--------------------------------------------------------------------------------
H2B_EUPCR/20-90--------------------------------------------------------------------------------
HCP3L_CAEEL/180-257--------------------------------------------------------------------------------
HAP5_YEAST/152-225--------------------------------------------------------------------------------
Q19649_CAEEL/40-114--------------------------------------------------------------------------------
Q23429_CAEEL/30-104--------------------------------------------------------------------------------
E2RTQ0_GIAIN/25-101--------------------------------------------------------------------------------
E2RU60_GIAIN/21-90--------------------------------------------------------------------------------
E2RU15_GIAIN/15-88--------------------------------------------------------------------------------
A8BYH2_GIAIC/69-146--------------------------------------------------------------------------------
A8B678_GIAIC/68-148--------------------------------------------------------------------------------
A8B471_GIAIC/102-178--------------------------------------------------------------------------------
Q7RRA6_PLAYO/27-103--------------------------------------------------------------------------------
Q7XV46_ORYSJ/214-290--------------------------------------------------------------------------------
Q7XYY4_PYRLU/77-151--------------------------------------------------------------------------------
Q7Z106_PARTE/51-125--------------------------------------------------------------------------------
CENPA_DANRE/65-140--------------------------------------------------------------------------------
H2AV3_ORYSJ/32-106--------------------------------------------------------------------------------
H2A3_ORYSJ/19-92--------------------------------------------------------------------------------
Q867G5_TRYBB/61-135--------------------------------------------------------------------------------
Q867U7_TRYBB/41-111--------------------------------------------------------------------------------
Q86EU0_SCHJA/18-91--------------------------------------------------------------------------------
CENPA_CANGA/159-236--------------------------------------------------------------------------------
Q8BP16_MOUSE/15-88--------------------------------------------------------------------------------
Q8IDZ1_PLAF7/90-167--------------------------------------------------------------------------------
Q8LK76_MAIZE/76-152--------------------------------------------------------------------------------
Q8NIA3_HUMAN/97-169--------------------------------------------------------------------------------
H3L_ENCCU/57-130--------------------------------------------------------------------------------
H4_ENCCU/27-96--------------------------------------------------------------------------------
H31_ENCCU/59-135--------------------------------------------------------------------------------
Q8T9Z4_DROOR/130-206--------------------------------------------------------------------------------
Q8TA36_HETGL/23-92--------------------------------------------------------------------------------
Q8VEE3_MOUSE/32-99--------------------------------------------------------------------------------
H2BV_BOVIN/29-99--------------------------------------------------------------------------------
Q92646_HUMAN/13-84--------------------------------------------------------------------------------
Q98SC6_GUITH/26-100--------------------------------------------------------------------------------
Q9CQ70_MOUSE/15-88--------------------------------------------------------------------------------
H2BV_MOUSE/30-100--------------------------------------------------------------------------------
Q9DAB5_MOUSE/130-200--------------------------------------------------------------------------------
Q9DAD9_MOUSE/13-86--------------------------------------------------------------------------------
Q9GRH3_STYLE/100-174--------------------------------------------------------------------------------
H3L1_LILLO/70-144--------------------------------------------------------------------------------
H2B_LILLO/48-118--------------------------------------------------------------------------------
H2B2_ARATH/145-215--------------------------------------------------------------------------------
H2A8_ARATH/23-97--------------------------------------------------------------------------------
Q9XG41_GUITH/8-78--------------------------------------------------------------------------------
H2A1_LILLO/18-91--------------------------------------------------------------------------------
CENPA_SCHPO/38-118--------------------------------------------------------------------------------

PF04719

Q20563_CAEEL/236-327--------------------------------------------------------------------------------
Q9M565_ARATH/105-194--------------------------------------------------------------------------------
Q9AW46_GUITH/30-124--------------------------------------------------------------------------------
TAF11_DROME/89-177--------------------------------------------------------------------------------
TAF11_MOUSE/106-194--------------------------------------------------------------------------------
Q9C2R5_NEUCS/200-281--------------------------------------------------------------------------------
TAF11_YEAST/124-213--------------------------------------------------------------------------------
Q9LNS8_ARATH/128-217--------------------------------------------------------------------------------
TAF11_SCHPO/93-181--------------------------------------------------------------------------------
Q21417_CAEEL/221-312--------------------------------------------------------------------------------

PF02269

SUPT3_HUMAN/106-198--------------------------------------------------------------------------------
Q17957_CAEEL/27-116--------------------------------------------------------------------------------
SPT3_YEAST/5-96--------------------------------------------------------------------------------
SPT3_SCHPO/8-99--------------------------------------------------------------------------------
TAF13_YEAST/9-101--------------------------------------------------------------------------------
TAF13_HUMAN/30-119--------------------------------------------------------------------------------

PF03847

TAF12_YEAST/416-488--------------------------------------------------------------------------------
TAF12_SCHPO/344-411--------------------------------------------------------------------------------
TAF12_DROME/93-160--------------------------------------------------------------------------------
Q9VR21_DROME/67-133--------------------------------------------------------------------------------
Q9SR71_ARATH/401-468--------------------------------------------------------------------------------
TAF12_HUMAN/59-126--------------------------------------------------------------------------------
Q9U226_CAEEL/233-297--------------------------------------------------------------------------------
Q9LNR1_ARATH/526-593--------------------------------------------------------------------------------

PF00808

NFYB9_ARATH/62-127--------------------------------------------------------------------------------
HARB_PYRSG/2-65--------------------------------------------------------------------------------
HFO2_METFO/2-65--------------------------------------------------------------------------------
HJA2_METJA/2-65--------------------------------------------------------------------------------
NFYB4_ARATH/6-71--------------------------------------------------------------------------------
Q20237_CAEEL/64-128--------------------------------------------------------------------------------
HMFB_METFE/1-64--------------------------------------------------------------------------------
Q9V452_DROME/18-83--------------------------------------------------------------------------------
NFYB5_ARATH/54-119--------------------------------------------------------------------------------
HAF2_ARCFU/2-65--------------------------------------------------------------------------------
Q9GSP1_DROME/10-74--------------------------------------------------------------------------------
Q9FHS0_ARATH/10-74--------------------------------------------------------------------------------
NC2B_HUMAN/11-75--------------------------------------------------------------------------------
HAP3_KLULA/25-90--------------------------------------------------------------------------------
HAF1_ARCFU/6-69--------------------------------------------------------------------------------
HFOB_METFO/1-64--------------------------------------------------------------------------------
Q9LN09_ARATH/108-172--------------------------------------------------------------------------------
HAP3_SCHPO/10-75--------------------------------------------------------------------------------
O59848_ASPOZ/46-111--------------------------------------------------------------------------------
O93641_9EURY/3-67--------------------------------------------------------------------------------
O76256_SCHMA/27-92--------------------------------------------------------------------------------
NC2B_SCHPO/10-75--------------------------------------------------------------------------------
Q9LHG0_ARATH/7-71--------------------------------------------------------------------------------
O17072_CAEEL/108-174--------------------------------------------------------------------------------
O73745_XENLA/39-103--------------------------------------------------------------------------------
O45550_CAEEL/20-84--------------------------------------------------------------------------------
NC2B_ARATH/14-79--------------------------------------------------------------------------------
O17286_CAEEL/64-129--------------------------------------------------------------------------------

PF15511

H2QBC7_PANTR/25-514DEDASGRAASP...............ESASSTPESLQARRHHQF.IEPAPAPGAAVLSSEPA..EPL.............
G3SYD4_LOXAF/26-492DKDTSNRTASP...............QLASSGPKSLQARRLRQF.LEPVPPRSTADLGTEPL..QSL.............
E2RJV5_CANFA/26-460DEDISDRRASP...............ELASNTTQSPQARRP.QF.LEPAPPSSTAVLSS.....EPL.............
F6PKQ6_HORSE/26-517DCPTSSRRVSP...............ELASSTPEFLQAKRI.QG.LEPAPPPSTAVLPSEPL..EPL.............
F1S2K5_PIG/26-517DEDTSGRTASP...............ELASSTPEFLQARRL.QV.LEPALLPSTAVLPSEP...QPL.............
G1PFK4_MYOLU/26-518DKDTEGRTARP...............ELASSTPEFPRARQL.EF.LEPAPPTSTAVLSSEPL..EPL.............
H0XDJ1_OTOGA/25-517DEDISGRTACP...............ELASNTPAFLQTKQRHQF.LELAPPPGATVLPSEPM..EPQ.............
G1SQR3_RABIT/26-502DEDPSGRAASP...............AMASRTPSFLQAEQPPPF.LEPTPRPGAAVVSS.....EPV.............
H0UV87_CAVPO/26-506QGDSEGQLSSS...............ELASNIPEFLQAEQLDQF.PEPASPPGVGVLSAEPP..EPV.............
CENPT_RAT/26-471DEETSGMPASR...............ELSSSAQDLLLAEEPHQL.FEPPPSPGVAAVSS.....ESV.............
F7C6J3_ORNAN/50-507VQEAGGLRAST...SQVHGMGEIGSPELLPETPAFIQAKRQQAFAPSASPSPARSPPKSFP...................
B2WAR3_PYRTR/18-424ETLALDRNNLI...........EDDGMLGWESDPPEDDDAELAAYREEESAIDRSLQTKSPEQRPPV.............
Q0V6N5_PHANO/18-452VTAALNGDVTS...........EPPGIQGWESEPGL.NDADLAQYREEESAMDRSLQTQSPERPAAA.............
E4ZUA3_LEPMJ/75-488ATMALNGDDPT...........EPGGMLGWESEDAAEDDAALAAYREEASAVDRSLETQSPERPVAA.............
H1V6T6_COLHI/84-483...........................LRSSTPIEPAEATELDDDETKASAHFEQQQQQRSR..KTK.............
G2WXZ9_VERDV/71-445FGEASGDETLN.............................EELPDAEVTAHSEIDSKQRKPR..AGK.............
F0XUM0_GROCL/71-509GGWPDSPEIDI.................EEEDAGEDAAVTTALASIEAASQSKLLARDAQNKDARAI.............
G2Q011_THIHA/56-448ALEDEPVDHPT......................SALQDHDQEQTELGPALARIAATRGSGK...................
G2R3Q2_THITE/60-455PLEEEQMEDPS..........................LRPRDETEIESVAVQRAEVRDGSKK..................
Q2H4H2_CHAGB/63-448GLEDEAVKSRT..........................AALQDETGFETTNITRVEARGPVK...................
B2AUG9_PODAN/52-455DEEPDNTLNET.....................TRMTAGNVTETEVLTHAQRAELRAAAAARK..................
F7VUV4_SORMK/70-543DYENNDD.GMD...........LDNNQDDQDQAAGSDEEMTRLSGYTPTTAMRVSLSAAAARERLGR......FFREEGG
G5EH18_MAGO7/96-512GAVGDVDGFED.........................IDDETEMADDQPDDQVSTKLQSRTGK..KKL.............
C7YN20_NECH7/70-475GWDYDAGGVDD................HSSLDEGPEPIAEPIAEPTVTATVHRAQAEDRLPRGLKARK............
I1RX16_GIBZE/59-455GWD..DEGMDD....................HSSINEEMEPAMEPTATVTTHHIPTEDRLPRGLKANK............
E9EUR1_METAR/77-484NMVDVYNDPDP..VPIIQTEEPEPVGEDDGDDDFEPYIEEIEEQSVDEEEPVEPSSAAKPSR..ERL.............
G3JMA4_CORMM/68-522DNHQEREPIDY..........DEPTNRQHGDEQERDAESGRRRASALADGETLISEGEDSDPADVTIRQHNTSLAVERSA
H6BTF1_EXODN/11-447SELKDPQHVLQ...............ESPSAASPGSEEPTGQDSMVDMDGATDEAVPPTLSR..PRR.............
A6SS64_BOTFB/43-483GENDTGRPLDLEMDDESINGEDDTGRPLDLEMDDESINGEDETRRLSIGAFEDSRLSDGEPLKVSVQKVTSENTKRSSQK
Q5B3X8_EMENI/64-438GTTGGFGLELY......................SPERV....SMSESPGLVGGGLREEDTVV..HGS.............
G7XFC4_ASPKW/68-429IAAGDFGMELQ......................SPPPAPVALSESQSPGIAGGGLRDEDRYV..SGA.............
Q4WWL8_ASPFU/76-441GGAGDFGLELN..........................MPSRVSLSQSPGLIGGGLRDEDSVL..PGA.............
B6HEI8_PENCW/70-421.VGGDFGLGLE..........................FPPAASPSESPGIVGGGLRDEAIPAQG................
B8MMW5_TALSN/60-429FEVNIPDQVSD..........................AGTTGTTGAGAGVVGGGLRDEPSMRTR................
C5FZG9_ARTOC/82-443AMTDRSSNRGV..................VE............EEEEEEQEQQQEDQPEPPQ..................
C5PIR4_COCP7/46-397AVREGSPRPPL....................................QESSPEPPQESRLDQ..................
C1H556_PARBA/152-504AMPDDYSKPAP................................PSSSPEPVPQEQVKGS.....................
D5G8P1_TUBMM/86-466.......................................LPEVISAQEASSSTVPKPASAIK..KRR.............
G1XD77_ARTOA/125-537DDEDDDDGPPP..............................FQPDDNIGLRTTARPNATGKR..RSR.............
B6K2P7_SCHJY/48-429QEIPSLHDINI..........................SPSAFPPVETIAESAAAPQHPNDPP..FPN.............

PF02291

TAF9_YEAST/19-152--------------EVGPDSTQEETPRDVRLLHLL-----LA----------SQSIHQ--YEDQVP------LQLMDFAH
TAF9_HUMAN/2-130--------------ESGKTASPKSMPKDAQMMAQI-----LK----------DMGITE--YEPRVI------NQMLEFAF
TAF9_DROME/8-136--------------KAKISAQIKHVPKDAQVIMSI-----LK----------ELNVQE--YEPRVV------NQLLEFTF
O45784_CAEEL/13-136--------------ASGTDGHS....KEALAVISM-----LH----------ECGIQE--FDPRVV------SMLMDVQY
TAF9_SCHPO/3-133--------------SPGISDESIKGPKDVRLIHLI-----LS----------SLGVPS--YSQTVP------LQLLTFAH

PF15510

B2RVH1_MOUSE/1-86----------------------------MAPSTTV-----TR----------R..VKR--KAPRAF------LKRTLKQK
F1S2W8_PIG/1-102----------------------------MAPTTTV-----SQ----------RKLIKR--KAPRGF------LKRVFKRR
G7P379_MACFA/1-103----------------------------MALSTIV-----SQ----------KKQIKR--KAPRGF------LKRVFKRQ
H0VLK4_CAVPO/1-103----------------------------MALSSTI-----SQ----------RKHIKR--RAPRGF------LRRVFKRQ
D3Z8J2_RAT/1-86----------------------------MVLSTTV-----CR----------R..IRH--KAPCAF------LKRTLKQK
G1P8B1_MYOLU/1-88----------------------------MAVAATI-----SQ----------RKRIKR--KAPRGF------LRRVFKRR

PF02969

TAF6_XENLA/9-74-----------------------NTLLPSESMKVI-----SE----------SVGISQ--MSEETC------QLLAQEVS
TAF6L_HUMAN/9-73-----------------------FVEIPRESVRLM-----AE----------STGL.E--LSDEVA------ALLAEDVC
TAF6_SCHPO/3-68-----------------------LTVWNIESIKDV-----AE----------MLGIGN--LADEPA------AAIAMDLE
Q8LRG9_ORYSJ/1-68-----------------------MSIVPKETIEVI-----GQ----------SVGIAN--LPADVS------AALAPDVE
TAF6_YEAST/9-74-----------------------TIWSPQDTVKDV-----AE----------SLGLEN--INDDVL------KALAMDVE
Q9MAU3_ARATH/1-68-----------------------MSIVPKETVEVI-----AQ----------SIGITN--LLPEAA------LMLAPDVE
Q9DDC0_PLEWA/11-76-----------------------NTLFPTESMKVI-----AE----------SIGISQ--VPEETC------QLLTEEVS
TAF6_DROME/18-83-----------------------GSSISAESMKVI-----AE----------SIGVGS--LSDDAA------KELAEDVS
TAF6_HUMAN/11-76-----------------------NTVLPSESMKVV-----AE----------SMGIAQ--IQEETC------QLLTDEVS
Q9GZI6_CAEEL/24-85-----------------------TPIFTQTA....-----AE----------MLGITS--LNTEAA------ELLEFLSR

PF07524

SPT7_SCHPO/707-783-------------------KPLAHDVLK.KLCTII-----LF----------HAGFES--FQMGAL------DALTEIAA
TAF8_DANRE/32-108-------------------QLARRRTLQ.VVVSAL-----LT----------ECGFDS--AEKAVV------ETLTEMMQ
TAF3_SCHPO/7-83-------------------DELYFSLMR.IFCSQT-----LR----------AAGIDR--TKVSLL------NSFTDITI
ST65G_HUMAN/151-230-------------------WHSCRQLLY.QAVATI-----LA----------HAGFDC--ANESVL------ETLTDVAH
Q8LFR3_ARATH/24-100-------------------YEFSHAAAK.AAVAQV-----CE----------SVGYEN--FKDPAL------ESLSGFAL
Q9VP40_DROME/6-77-------------------EVLATVLDN.LLASKN-----CE----------VVD.DV--LRQSML------ELLRGKF.
Q9SA19_ARATH/24-100-------------------AEFSFSLTK.IAVSQI-----CQ----------SIGYKA--TDASAL------NTLTLTTT
TAF8_HUMAN/29-106-------------------YHLARRRTLQVVVSSL-----LT----------EAGFES--AEKASV------ETLTEMLQ
Q9NAZ5_DROHY/4-80-------------------EKYTSELLG.VVIAQI-----AQ----------TIGYSR--TQSAPL------ELLEDILL
Q8MSB9_DROME/4-80-------------------DRYASDLAL.VVVAQI-----TQ----------TIGYSC--TLSAPL------ELLQDILQ
Q7S5N4_NEUCR/125-200-------------------DGLAKNGLR.RSIALA-----LE----------TVGFDG--ATPEAI------ESFTIMTE
Q7YTH5_CAEEL/66-142-------------------NEAYHNVLE.QIVTAM-----CY----------KSGFDD--IEEGAL------ETLMLLFH

PF15630

A3GI04_PICST/11-91-------------------SQLKSTVYLTVAK.MV-----EE..Q.LAK..HTKNTETVVATPIFI......ASLVDLVY
A6RJU4_BOTFB/10-85-------------------ERLKAALWFSIGK.IV-----EE..E.AV....RLNSN...ATNQFI......GALTEMVW
A7RMQ5_NEMVE/23-98-------------------QRLKAALHYTVGK.IC-----EE..T.GA....EAGLT...FSRQFV......AALTETSY
A7TEH2_VANPO/17-91-------------------AQLKGKLWYCIERQVN-----EE..T.PF....DT..V...CSAKFI......NALVELCY
B2W5N7_PYRTR/12-87-------------------ERLKSALWYSIGQ.FI-----DE..K.SL....ENDLN...ATPQYI......GALTELVY
B3DJV8_DANRE/9-84-------------------QRLKAAVHYTVGS.LC-----QH..I.AE....DCEKQ...ITKQTI......AAIAETAF
B3RZC1_TRIAD/15-90-------------------QRLKAALHYAVGK.KC-----EE..I.GE....ELQVE...FSKQMI......FALTECTF
B6JX09_SCHJY/4-85-------------------ERFKAEIFHVTQQ.VC-----NN..T.AA....ELSES...ESKRVVVDELFCVGVTEMVW
B6QUS3_PENMQ/14-92-------------------ERFKSALWLAIGK.IV-----DE..E.TM....QLGVN...ATPQFI......GALTEMVW
B7PXV9_IXOSC/11-86-------------------MCLKAAVHYTVGQ.IT-----EA..V.GQ....AEGTV...VGRPVV......AALTELVW
C4Y931_CLAL4/26-101-------------------TRLKASIYLSVAK.AV-----EE..K.TA....ELKVA...ASPSFV......ASLVELVF
C5DNB5_LACTC/22-96-------------------PQLKGKLWYCLEQ.LV-----KK....EL....PSDIS...YSPKFI......NALVELCF
C5G144_ARTOC/13-88-------------------KQLKAMLWYTLGN.LT-----RE..H.AD....LFDTE...VTPQFI......AGLVEITW
C5PFL7_COCP7/14-89-------------------RRLKAELWKALRR.MV-----RD..Q.VD....EEDVD...ITPSFL......IAMTEMVW
C7YTU2_NECH7/15-94-------------------HRLKAALWYAVGQ.IV-----DE..Q.SL....IRNRN...ATPQFI......GALTELVW
D3B378_POLPA/165-243-------------------TKLKQSFQFTVAK.IC-----ER.EIEKL....PNKTT...VTPHAI......KTVSELIY
D5GA13_TUBMM/32-107-------------------QRLKSALWFSIGK.IV-----DE..E.IL....QLNVN...ATPQFI......GALTEMVW
D7FWQ8_ECTSI/32-105-------------------LALRAALHYSVGE.VC-----SG..E.......NGKIA...MTGSAV......STLAEVVF
E4ZQ21_LEPMJ/13-88-------------------ERLKSALWYSIGQ.FV-----DE..E.CL....TCDLN...ATPQFI......GALTELVY
E9CD47_CAPO3/14-89-------------------ARIKASVHYTVGK.IC-----QR..E.ES....EMGVK...CSKQFL......AALAELTY
E9ECA7_METAQ/10-85-------------------ERLKSALWFAVGQ.IV-----DE..E.CL....RRNRN...ATPQFI......GALTEMVW
F0XLX6_GROCL/7-82-------------------QELKAALWSVVGE.MV-----DQ..E.SI....KQNRN...TTPQFI......GALADMVW
F4PRK1_DICFS/235-311-------------------TKLKQALQYSVAR.IS-----ER..E.TE....SNHRI...VTHQAI......NALSHLMY
F4RWE9_MELLP/40-115-------------------EALKSAIWYTVAQ.IV-----QE..E.EI....DLQRS...ATEPFV......ASLTDLVY
F6Y3J5_MONDO/1-76-------------------QSLKAAVHYTVGS.LC-----QE..A.AD....AKGVK...FSKPTI......AAISEVTF
F7DQN4_XENTR/13-88-------------------QRLKAAVHYIVGS.LC-----QE..V.AD....DKEVH...FSKQAI......AAISEITF
F7VU88_SORMK/11-86-------------------ERLKSALWFAIGK.MV-----DD..E.SL....RRNMN...ATPQFI......GALTELVW
F9WY71_MYCGM/13-88-------------------ERLKSALWYAVGK.IV-----DE..V.TL....SQGLN...ASPHFI......GGLSELVA
G0V9K8_NAUCC/14-94-------------------TRLKAKIWCSIENQVK-----EE..L.QTMNSGSTRIT...VSNKFI......NSLMELCY
G3BEG3_CANTC/8-83-------------------SQLKSAVFLMVSR.IV-----EQ..E.VA....RLGVH...STPMFT......ASLVELTT
G3MSD4_9ACAR/15-89-------------------ATLKAAVHYTVGR.IC-----ES..M.A.....EKSLP...VTRLTV......AAISKLVY
G3PEU4_GASAC/26-101-------------------QRLKAAVHYTVGC.LC-----QR..M.GD....EHRRP...FSRQVV......AAITETAF
G3VT77_SARHA/17-92-------------------KNLKAALHYTVGS.IC-----QE..A.AE....AKGVR...FTKPTI......AAISEVTF
G4LYK5_SCHMA/9-84-------------------SEYKAELHYRCTK.IA-----QE..I.SN....KEQCE...VNMDII......CLMTELIF
G4MZ92_MAGO7/9-84-------------------ERLKAALWFAVGK.IV-----DE..E.TM....KKQRN...ATPQFI......GALTDMVF
G6DRA0_DANPL/11-86-------------------KKVRVALHRDVNK.IC-----TD..T.CH....YNGFS...INSGPM......AIVAGLVY
G8YL18_PICSO/12-89-------------------SQLKSAVYLSVSR.IV-----EE.EISSL....DGNVS...ATPTFV......AALVDLVY
H1VQ95_COLHI/11-86-------------------ERLKAALWFAVGK.IV-----DE..E.SI....KQDCN...ATPQFI......GALTEMVW
H2LES2_ORYLA/10-85-------------------QRLKAAVHFTTGR.IC-----QK..M.GE....DHRKE...FSRQTV......AAIAETAF
H2N958_PONAB/17-92-------------------QRLKAAVHYTVGC.LC-----EE..V.AL....DKEMQ...FSKQTI......AAISELTF
H6C6E0_EXODN/12-87-------------------KKLRSALWFQIGK.IV-----DE..E.SI....NLGVN...ATPQFI......GSLMELVW
H9J6V9_BOMMO/11-84-------------------QRLRAALKRDVTA.IC-----LE..S.TV....GL..E...ITKPAM......DLILELIY
H9KVI3_CHICK/15-90-------------------QRLRAAVHYTTGA.LA-----QD..V.AE....DKGVL...FSKQTV......AAISEITF
I1FQJ7_AMPQE/21-96-------------------QRLKAALHYSIGK.TY-----EE..I.AS....DHGMK...VSREMM......AAVTEMVY
Q54PV0_DICDI/238-315-------------------DKIKQSLHYSVIK.VS-----EE..Q.AN....KFNVG...ITKETM......SSLSELIF
Q6BIJ2_DEBHA/13-90-------------------SQLKSAIYLMVSK.MV-----EQDLT.NI....DKEIS...ATPTFV......ASLVELVY

PF00125

Q8IL74_PLAF7/27-103-----------------PEDLKIHNLPISRIKKIM-----KEDDEIKS....NQM-----VSADTP------VLLAKACE
H2BWT_HUMAN/75-145-----------------NCRGDSFATYFRRVLKQV-----HQG..........LS-----LSREAV------SVMDSLVH
Q7PVU9_ANOGA/105-178-----------------KSKKKKPVLPVDRVHTLL-----QKEVLQY.......K-----IDSSVS------LFLVAVLE
H4_CAEEL/25-94-----------------DNIQGITKPAIRRLARRG-----GV...........KR-----ISGLIY------EETRGVLK
H2A2_XENLA/18-91-----------------RSSRAGLQFPVGRVHRLL-----RKGNYAE.......R-----VGAGAP------VYLAAVLE
H2AB2_HUMAN/22-95-----------------RTVRAELSFSVSQVERSL-----REGHYAQ.......R-----LSRTAP------VYLAAVIE
O00912_LEIIN/23-92-----------------DNIRGITRGCVRRMARRG-----GV...........KR-----ISTEVY------EEVRRVLK
O02612_LEIIN/19-89-----------------RKPKRSWNVYVGRSLKAI-----NAQ..........MS-----MSHRTM------SIVNSYVN
O02613_CRIFA/18-93-----------------KSAKAGLIFPVGRVGSML-----RRGQYAR.......R-----IGAAGA------VYMTAVVE
O02648_DROSI/58-132-----------------STELLIRKLPFQRLVREI-----AQDFKTD......LR-----FQSSAV------MALQEASE
O15582_ENTHI/30-100-----------------KKNFESYALYISRVLKSV-----FQD..........IG-----ITLPSI------SIMDSFVR
O18643_CHAVR/29-99-----------------RKRRESYSIYVYKVMKQV-----HPD..........TG-----ISSKAM------SIMNSFVN
CENPA_MOUSE/51-127-----------------STDLLFRKKPFSMVVREI-----CEKFSRGV....DFW-----WQAQAL------LALQEAAE
O44009_LEIBR/52-126-----------------STELLMQCAPFQRLVREV-----SSAQKEG......LR-----FQSSAI------LAIQEATE
H2B_CAPAN/52-122-----------------KKSIETYKIYIFKVLKQV-----HPD..........IG-----ISSKSM------GIMNSFIN
O96761_9TRYP/19-89-----------------RRHQATWNVYVSRSLRSI-----NSQ..........MS-----MTSRTM------KIVNSFVN
O96955_PLAVI/25-95-----------------KSRYDSYGLYIFKVLKQV-----HPD..........TG-----ISRKSM------NIMNSFLV
H2B_EUPCR/20-90-----------------KKRTETFSVYIYRVLKQV-----HPE..........TG-----VSKKSM------SIMNSFIN
HCP3L_CAEEL/180-257-----------------SEDLLIPKAPFARLVREI-----MQTSTPFS...SDLR-----IRSDAI------NALQEASE
HAP5_YEAST/152-225-----------------QDDFKSHSLPFARIRKVM-----KTDEDV.......KM-----ISAEAP------IIFAKACE
Q19649_CAEEL/40-114-----------------STELLIPRSRFERLVKEL-----AQDFVTD......LI-----FRKDAI------DALQAAVE
Q23429_CAEEL/30-104-----------------RSTRSGLTFPVGRIHRKL-----RETTRGK......QR-----ISAGAS------VFMAATLE
E2RTQ0_GIAIN/25-101-----------------HKRHETYATYIYKVLRSE-----NIRSEADT....DLG-----ISNKGM------EVMNSLVN
E2RU60_GIAIN/21-90-----------------DTLGGITKPAIRRLARRG-----GV...........KR-----ISSTIY------QQTREVLK
E2RU15_GIAIN/15-88-----------------RSARAGISFPIGRIHRHL-----REGRYAE.......R-----ISSDAP------VYLAAVLE
A8BYH2_GIAIC/69-146-----------------RVTSVIPIACFQRLVRDI-----TCSLPSGG...NEIR-----FQAQAI------GALQEASE
A8B678_GIAIC/68-148-----------------NVDTLIQKLPFARLVQEL-----VEQIAQRDGSKGPYR-----FQGMAM------EALQSATE
A8B471_GIAIC/102-178-----------------STDLLIRKLPFSKLVRDI-----VTSGLSKS....DIR-----FQGAAV------EALQESAE
Q7RRA6_PLAYO/27-103-----------------PEELKTHQLPISRIKKIM-----KEDDKIKN....SQM-----ISADTP------VLLAKACE
Q7XV46_ORYSJ/214-290-----------------ARKSAPTTGGVKKPHRYP-----PWKRCSST....DLR-----FQSHAV------LALQEAAE
Q7XYY4_PYRLU/77-151-----------------STELLLRKICFQRLVRGI-----CMSLKGA......FR-----FEVQAL------LALQEAAE
Q7Z106_PARTE/51-125-----------------SSRLLIRKIPFQRLIREI-----AGVNEKE......MR-----FQSSAI------FALQEATE
CENPA_DANRE/65-140-----------------STGLLLRKAPFSRLVREV-----CQMFSRE.....HMM-----WQGYAL------MALQEAAE
H2AV3_ORYSJ/32-106-----------------RSSRAGLQFPVGRIHRQL-----KQRTQAN......GR-----VGATAA------VYSAAILE
H2A3_ORYSJ/19-92-----------------RSSKAGLQFPVGRIARFL-----KAGKYAE.......R-----VGAGAP------VYLAAVLE
Q867G5_TRYBB/61-135-----------------STDFLIQRAPFRRFLREV-----VSNLKDS......YR-----MSAACV------DAIQEATE
Q867U7_TRYBB/41-111-----------------GKKQQRWDLYIHRTLRQV-----YKR..........GT-----LSKAAV------RVLSSFIE
Q86EU0_SCHJA/18-91-----------------KSNRAGLVISVSRVHRYM-----KKGRYAR.......R-----TSIAAS------VYMSAVIE
CENPA_CANGA/159-236-----------------STALLIQKIPFAKLVKEV-----TEEFAGES...QDLR-----WQSMAI------LALQEASE
Q8BP16_MOUSE/15-88-----------------RSARAGVIFPVGRLMRYL-----KKGTFKY.......R-----ISVGAP------VYMAAVIE
Q8IDZ1_PLAF7/90-167-----------------STQLLIPKIPFVRVVKEI-----TRLFELPD...EQFR-----YTPEAL------LALQTASE
Q8LK76_MAIZE/76-152-----------------STEPLIPFAPFVRVVREL-----TNFVTNGK....VER-----YTAEAL------LALQEAAE
Q8NIA3_HUMAN/97-169-----------------RKRRNPLSLPVEKIHPLL-----KEVLG........YK-----IDHQVS------VYIVAVLE
H3L_ENCCU/57-130-----------------STDLLIRKRPFQRMVRDL-----CKGREG.......VR-----FQASAI------VAFQEAVE
H4_ENCCU/27-96-----------------SLSDSISKPAIRRIARRA-----GV...........RR-----VGGGCF------KEINNAAR
H31_ENCCU/59-135-----------------STDFLIRRLPFQRACRSV-----VKECSNAT....DIR-----FQGPAL------ASIQEALE
Q8T9Z4_DROOR/130-206-----------------HSRALIPKLPFSRLVREF-----IMKYSDGE....PLK-----ISVAAL------VAIQESCE
Q8TA36_HETGL/23-92-----------------DSAKKITKASILRLARRA-----GV...........AR-----INARVY------DEVRAALR
Q8VEE3_MOUSE/32-99-----------------RSRKESYSVYVYKVLKQV-----HPD..........TG-----ISSKAM------GIMNSFVN
H2BV_BOVIN/29-99-----------------ESGLRNYSLYINRVLKEV-----VPQ..........KG-----ISSRTI------DIINTMIN
Q92646_HUMAN/13-84-----------------HSSRAGLQFSVGRVHRLL-----RKGNYAK.......R-----VRAGAP------VYLEAVLE
Q98SC6_GUITH/26-100-----------------STDLLIHRLPFARLVKEI-----SLKYHHS......LN-----WQQVAV------EALQFASE
Q9CQ70_MOUSE/15-88-----------------RSQRAELQFPVSRVDRFL-----REGNYSR.......R-----LSSSAP------VFLAGVLE
H2BV_MOUSE/30-100-----------------NLGHGNYSLYINRVLKEV-----VPN..........RG-----ISSYSV------DIMNILIN
Q9DAB5_MOUSE/130-200-----------------RRRKNSFAIYFPKVLKNI-----HVG..........LS-----LSQRSV------NILDSFVK
Q9DAD9_MOUSE/13-86-----------------RTRSQRGELPLSLVDRFL-----REEFHSS.......R-----LSSSAL------SFLTSVLE
Q9GRH3_STYLE/100-174-----------------STDLLVKKLPFQRLVREI-----ARSSNPE......IR-----FSIQGL------LALQEAAE
H3L1_LILLO/70-144-----------------SNVPLIPHSPFMRLVREL-----AAEFLDD......CR-----FAAETF------IMLKEVVE
H2B_LILLO/48-118-----------------KIPLMKYRVYIRRVLTQV-----RPE..........LG-----ISSKSM------LIMNNFVV
H2B2_ARATH/145-215-----------------DLAGDEYRRYVYKVMKQV-----HPD..........LG-----ITSKAM------TVVNMFMG
H2A8_ARATH/23-97-----------------MIMVEGEMFQVARIHKQL-----KNRVSAH......SS-----VGATDV------VYMTSILE
Q9XG41_GUITH/8-78-----------------KKRNETYSIYIYKVLRQV-----HPK..........IG-----VSSKAM------NIMNSFVN
H2A1_LILLO/18-91-----------------RSEKAALQFSVSRVEYSL-----KKGRYCR.......R-----LGATAP------VYLAAVLE
CENPA_SCHPO/38-118-----------------STDLLIQRLPFSRIVREI-----SSEFVANFSTDVGLR-----WQSTAL------QCLQEAAE

PF04719

Q20563_CAEEL/236-327--------TQVLLSNFSQEQLERYESYRRSSFQKS-----TIRRLISQ...YTGGVN---VGQSVV------IAIAGLAK
Q9M565_ARATH/105-194--------MQTILSQFTEDQMSRYESFRRSALQRP-----QMKKLLIG...VTGSQK---IGMPMI------IVACGIAK
Q9AW46_GUITH/30-124--------DYEKINKLTRFQLMRYGIFRRSDLKKE-----KIKKIISQSNVVLKNIT---SMDPLI------IAIKGLAK
TAF11_DROME/89-177--------MQVLVSNFTEEQLDRYEMYRRSAFPKA-----AVKRLMQT...ITG.CS---VSQNVV------IAMSGIAK
TAF11_MOUSE/106-194--------MQILVSSFSEEQLNRYEMYRRSAFPKA-----AIKRLIQS...ITG.TS---VSQNVV------IAMSGISK
Q9C2R5_NEUCS/200-281--------RGMLINAFSPDQFDRFENWRAANLSKA-----GVRRLINA...TIS.QS---VTENVV------IGMRAVAK
TAF11_YEAST/124-213--------FKLLVTNLDKDQTNRFEVFHRTSLNKT-----QVKKLAST...VAN.QT---ISENIR------VFLQAVGK
Q9LNS8_ARATH/128-217--------MQKILSQFTEEQMSRYESFRRSGFKKS-----DMEKLVQR...ITGGPK---MDDTMN------IVVRGIAK
TAF11_SCHPO/93-181--------TKYLLESFDEEQMQRYEVFRRANLNKT-----NVKKLANQ...ILN.QS---VTPNVA------IVISGFSK
Q21417_CAEEL/221-312--------NQVLVANFSQEQIERYEVYRKSSFKKS-----TIKRLINE...FTGGID---LGKKVD------IAVAGLAK

PF02269

SUPT3_HUMAN/106-198---------------------ISFATELQSMMYSL-----GDARR---------------PLHETA------VLVEDVVH
Q17957_CAEEL/27-116---------------------HVLRRDLRSMVYGF-----GDDKE---------------PYDKTL------DTLEAIVL
SPT3_YEAST/5-96---------------------HKYRVEIQQMMFVS-----GEIND---------------PPVETT------SLIEDIVR
SPT3_SCHPO/8-99---------------------SKYRVEIQQMMFIL-----GEVQD---------------PLPETT------QLVEELIR
TAF13_YEAST/9-101---------------------NLFNKDVSSLLYAY-----GDVPQ---------------PLQATV------QCLDELVS
TAF13_HUMAN/30-119---------------------RLFSKELRCMMYGF-----GDDQN---------------PYTESV------DILEDLVI

PF03847

TAF12_YEAST/416-488-----------------------SKRKLRELVKTVGIDEGDGETV---------------IDGDVE------ELLLDLAD
TAF12_SCHPO/344-411-----------------------SKRKLHDLLQQI.....DSEEK---------------IEPEVE------ELLLEIAD
TAF12_DROME/93-160-----------------------TKPRLTELVREV.....DTTTQ---------------LDEDVE------ELLLQIID
Q9VR21_DROME/67-133-----------------------SKTNMLQFVQKI.....DANSS---------------LDDQGC------DMMARIAD
Q9SR71_ARATH/401-468-----------------------GKRSIHELLQQI.....DPSEK---------------LDPEVE------DILSDIAE
TAF12_HUMAN/59-126-----------------------TKKKLQDLVREV.....DPNEQ---------------LDEDVE------EMLLQIAD
Q9U226_CAEEL/233-297-----------------------...KLDDLMQQI.....SSTTV---------------LEENVK------DVLVEYAD
Q9LNR1_ARATH/526-593-----------------------GKRKIQDLVSQV.....DVHAK---------------LDPDVE------DLLLEVAD

PF00808

NFYB9_ARATH/62-127-----------------------QYMPIANVIRIM-----RKTL---------PSHAK..ISDDAK------ETIQECVS
HARB_PYRSG/2-65-----------------------AELPIAPVDRLI-----RKA.---------.GAQR..VSEQAA------KLLAEHLE
HFO2_METFO/2-65-----------------------AELPIAPVGRII-----KNA.---------.GAQR..ISDDAK------EALAKALE
HJA2_METJA/2-65-----------------------AELPVAPFERIL-----KKA.---------.GAER..VSRAAA------EYLAEAVE
NFYB4_ARATH/6-71-----------------------RLLPIANVGRLM-----KQIL---------PSNAK..ISKEAK------QTVQECAT
Q20237_CAEEL/64-128-----------------------AKIQPTRIKKVM-----QSD.---------EDIGR..MVQSVP------VSIGRAME
HMFB_METFE/1-64-----------------------MELPIAPIGRII-----KDA.---------.GAER..VSDDAR------ITLAKILE
Q9V452_DROME/18-83-----------------------TFLPLSRVRTIM-----KSS.---------MDTGL..ITNEVL------FLMTKCTE
NFYB5_ARATH/54-119-----------------------RLLPIANVGRIM-----KNIL---------PANAK..VSKEAK------ETMQECVS
HAF2_ARCFU/2-65-----------------------AELPMAPVDRLI-----RKA.---------.GAER..VSADAV------EKMVEVLE
Q9GSP1_DROME/10-74-----------------------ARFPAGRIKKIM-----QSD.---------EEIGK..VAQAVP------VIISRTLE
Q9FHS0_ARATH/10-74-----------------------PEFPIGRVKKIM-----KLD.---------KDINK..INSEAL------HVITYSTE
NC2B_HUMAN/11-75-----------------------LTIPRAAINKMI-----KETL---------PNVR...VANDAR------ELVVNCCT
HAP3_KLULA/25-90-----------------------RWLPINNVARLM-----KNTL---------PATTK..VSKDAK------ECMQECVS
HAF1_ARCFU/6-69-----------------------VELPLAPVERLL-----RKA.---------.GASR..VSEDAK------VELAKAIE
HFOB_METFO/1-64-----------------------MELPIAPIGRII-----KNA.---------.GAER..VSDDAR------EALAKALE
Q9LN09_ARATH/108-172-----------------------IKFPMNRIRRIM-----RSD.---------NSAPQ..IMQDAV------FLVNKATE
HAP3_SCHPO/10-75-----------------------NLLPIANVARIM-----KSAL---------PENAK..ISKEAK------DCVQDCVS
O59848_ASPOZ/46-111-----------------------RWLPIANVARIM-----KLAL---------PDNAK..IAKEAK------ECMQECVS
O93641_9EURY/3-67-----------------------VELPKAAIERIF-----RQG.---------IGERR..LSQDAK------DTIYDFVP
O76256_SCHMA/27-92-----------------------RFLPIANVAKIM-----KRAV---------PGNGK..IAKDAK------ECVQECVS
NC2B_SCHPO/10-75-----------------------LSLPKATVQKMV-----SDIL---------PVDLT..FTKEAR------DLLIECCV
Q9LHG0_ARATH/7-71-----------------------TRFPAARIKKIM-----QAD.---------EDVGK..IALAVP------VLVSKSLE
O17072_CAEEL/108-174-----------------------MSVPMARVKKIM-----RID.---------DDVRNFMIASDAP------IFMAQAAE
O73745_XENLA/39-103-----------------------QDLPLARIKKIM-----KLD.---------EDVKM..ISAEAP------VLFAKAAQ
O45550_CAEEL/20-84-----------------------IGLPQKGINQII-----KEVV---------PEMR...IANESR------DMINACCV
NC2B_ARATH/14-79-----------------------ASLPKATMTKII-----KEML---------PPDVR..VARDAQ------DLLIECCV
O17286_CAEEL/64-129-----------------------RFLPIANVVRIM-----KTQM---------DPQAK..LAKDAK------ECAQECVS

PF15511

H2QBC7_PANTR/25-514..........LVRHPPRP.RTTGPRPRQDPHKAGL-----SHYVKL------FSFYAKMPMERKAL------EMVEKCLD
G3SYD4_LOXAF/26-492..........LARLPPRP.RTAGRRPCQDPYKAGL-----NHYMKL------FSFYAKMPMEKAAL------EMVEKCLD
E2RJV5_CANFA/26-460..........STRLPPRA.RAPGSRPRQDPHKTGL-----SHYVKF------FSFCAKMPMEKKAV------EMVEKCLD
F6PKQ6_HORSE/26-517..........SARLPPRA.RTPGPKACQNPYKTGL-----SHYAKL------FSFYAKMPMEKKAL------EMVEKCLD
F1S2K5_PIG/26-517..........LARLPPRP.RIAGPRPRPDPYKAGL-----NHYAKL------FSFYAKMPMERKAV------EMVEECLD
G1PFK4_MYOLU/26-518..........SARLPTRV.QTAGPRRRQDPYKMGL-----SHYAKL------FSFYAKMPMEKKAL------EMVEKCLD
H0XDJ1_OTOGA/25-517..........LARHPPRP.RTTGPRPRQDPYKTGL-----SHYTKL------FSFCAKMPMEKKSL------EIVEKCLD
G1SQR3_RABIT/26-502..........LARRPPRP.RAAGPRPRQDPHKTGL-----NHYAKL------FSFYAKMPMEKAAL------EVVEKCLD
H0UV87_CAVPO/26-506..........LARLPSRP.RTAGSRPHQDPHKAGI-----SYYTKL------FSFYAKMPMERKAL------EVVEKCLD
CENPT_RAT/26-471..........PAKLPSRT.RTAQPRHHQDPYKAGL-----SHYVKL------FSFHTKMPVEKAAL------EMVEKCLD
F7C6J3_ORNAN/50-507..........TKQARARG.PARAPRPPRTPGSALL-----SHYAKI------FGFYAKMPVEKAAY------KVVEKSLD
B2WAR3_PYRTR/18-424..QLKGVRKSKEYMVSAH.GIGYPSFPAASVKKLA-----MGFMK.------.SQGSKGQLNKEAL------DALVRTTN
Q0V6N5_PHANO/18-452..KQANVRKAKELRISQR.GLEYPSFPAASVKKLA-----LGFMK.------.SQGSKGQLNKESL------NALVKVTD
E4ZUA3_LEPMJ/75-488...KQGVRAPKEMRISKR.GLDYPSFPTANVKKLA-----ASFMK.------.SQGSKARLAPDAI------AELVKNTD
H1V6T6_COLHI/84-483..........RGVKLSRY.NVEYPSLPPAVVKRLA-----NTFARS------.SGISKTKISPEAL------AEIQRASD
G2WXZ9_VERDV/71-445..........AGWKRSKH.GHSYPPFPSTVVKRVA-----EQFART------.SGISNPRIGKDTL------AALQQATD
F0XUM0_GROCL/71-509..........KRARLSRH.GIEYPSLPVGVVKRIG-----QMFAQG------.SAAGKTKLSPDTV------AALTTASD
G2Q011_THIHA/56-448..........KVVKVSKY.GIEYPSLPPAVVKRLA-----QNFARA------..SGAKGKITADAM------KAIMQASD
G2R3Q2_THITE/60-455..........KSIKVSKY.GIEYPSLPPAVVKRLA-----QNFAKA------..NGAKGQITPDAM------KAIMQASD
Q2H4H2_CHAGB/63-448..........RTIKISKY.GIEYPSLPPAVVKRLA-----QNFAKA------..GGIKGKITPDAM------KSIMQASD
B2AUG9_PODAN/52-455..........KRINISKH.GIQYPSLPAGVVKRLA-----QNFAKT------..SGAKGRITPDAM------NAIMQASE
F7VUV4_SORMK/70-543EGRGGFSKIKATKKISKH.GIEYTSLPPAMVKRLA-----QTFAKT------..SGAKGNISPEAL------KAIMQASD
G5EH18_MAGO7/96-512...........GLKISKY.GHSCPSLPAPVVKRLA-----ETIART------.SGIGNAKITPETL------QALMQSTE
C7YN20_NECH7/70-475..........KQKRISQH.GIEYPPLPPAFVKRVA-----QTALQS------.SGLSNQRLSAETL------DALIQASE
I1RX16_GIBZE/59-455..........KRKRISQH.GIEYPSLPPAFVKRVA-----QTALQS------.SGLSNQRLSAETL------DALIQSSE
E9EUR1_METAR/77-484......KPKKRQRRVSKH.GIEYPALPPTFVKRVA-----QTALQS------.SGLSNPRVSADTL------TALTQASE
G3JMA4_CORMM/68-522PARRGPKSKKKQKRISRH.GAEYPPLPPAFVRRVA-----HRAVQT------.SGLSNHRITSDVL------AALTQASE
H6BTF1_EXODN/11-447..........KKLKMTRH.GEMVPSLPTSLIKRVA-----IDASSR------.LGIRKPRLGREHM------QALEQATE
A6SS64_BOTFB/43-483..........QVNKVSKH.GLKYKSLPLGVVKKYA-----INLARN------.GAGRGDKLSGDAL------DAIMQATD
Q5B3X8_EMENI/64-438..........KQKKLSRH.GIPVPTLPAGVVKKLA-----TRFARA------.RAGPKAKISKSTL------AAIEQASS
G7XFC4_ASPKW/68-429..........KQKKLSRH.GIPVPNLPVGVVKKLA-----TRFARA------.RNGSKAKISKETL------AAIEQASS
Q4WWL8_ASPFU/76-441..........KQKKLSHH.GIPVPNMPVGVVRKLA-----TRFARA------.RAGSKTKISKATL------AAIEQASA
B6HEI8_PENCW/70-421..........KQKKMSRH.GIPVPNLPAGVVKKLA-----TRFARS------.GAGSKAKINKATL------AAIEQASS
B8MMW5_TALSN/60-429..........KQKKLSRH.GIPVPLLPTGVVKRLA-----ARFART------.GAGTKAKINKETL------AAIEQASE
C5FZG9_ARTOC/82-443..........KKQKLSKH.GIPVPSLPSGVVKKLA-----MRFARS------..GNKKTRINKDTM------AAIQQATD
C5PIR4_COCP7/46-397..........NKERVSKH.GIPVPKLPRGIVKRLA-----TRFART------.GNGSRTRISKEAL------AALEKATD
C1H556_PARBA/152-504..........KQKKLSRH.GIPMPRLPSGVVKKLA-----TRFARS------.GNGGKSRISKETL------AAIEQATE
D5G8P1_TUBMM/86-466..........KPLPLSRH.GIPYPPFPRHTIKKMA-----TKF...------....SGSTISADTL------DALVAASE
G1XD77_ARTOA/125-537..........KELPLSVH.GIPYPSLSTKVIKSII-----ART...------....SKQKISKEAL------AMIASASE
B6K2P7_SCHJY/48-429..........PVFRVPKRTHANDCFLPTIAIRKLA-----HRF...------....SSRKLSASAM------DHLVSISN

PF02291

TAF9_YEAST/19-152RY----TQ-GV-LKDAL-VYN-DYA-GSGN-------SAGSGLGVEDIRLAIAART---QYQFKPTAPKELMLQLAAERN
TAF9_HUMAN/2-130RY----VT-TI-LDDAK-IYS-SHA-KKAT-------VD.....ADDVRLAIQCRA---DQSFTSPPPRDFLLDIARQRN
TAF9_DROME/8-136RY----VT-CI-LDDAK-VYA-NHA-RKKT-------ID.....LDDVRLATEVTL---DKSFTGPLERHVLAKVADVRN
O45784_CAEEL/13-136AV----TS-KI-LQMSS-GLS-RHA-EKAQ-------IE.....AEDVQTAAD.ML---GVLTTNAPDREKILQLANDKN
TAF9_SCHPO/3-133RY----TQ-QL-IQDSQ-VYA-EHS-RGQN-------AP...ISVEDVRLAVASQI---NHSFTGPPPKEFLLELAMERN

PF15510

B2RVH1_MOUSE/1-86KP----HL-GL-GRCCD-LL.-...-....-------..-----.....IHLNCLL--------------FIQRLAEESR
F1S2W8_PIG/1-102KP----HL-RL-TTDSD-LLV-RFC-PFLS-------WQ-----WG.GRVHLNCLL--------------FVHRLAEESR
G7P379_MACFA/1-103KP----QL-RL-EKSGD-LLV-RFH-PFSG-------WE-----WGTGEVHLNCLL--------------FVHRLAEESR
H0VLK4_CAVPO/1-103KP----HL-RL-EKHGD-VLV-SVG-FSSL-------FT-----FSLLKVHLNFLL--------------FVHRLAEEAR
D3Z8J2_RAT/1-86KP----RL-SL-EKRCD-LL.-...-....-------..-----.....IHLNCLL--------------FVQKLAEESR
G1P8B1_MYOLU/1-88KP----HL-RL-EASCD-LL.-...-....-------..-----.....VHLNCLL--------------FIRRLAEEAR

PF02969

TAF6_XENLA/9-74FR----IK-EV-TQDAL-KFM-HVG-KRQK-------LT-----PSDIDAA..LK-------------------------
TAF6L_HUMAN/9-73YR----LR-EA-TQNSS-QFM-KHT-KRRK-------LT-----VEDFNRA..LR-------------------------
TAF6_SCHPO/3-68YR----IH-QV-VQEAT-KFM-VHS-KRTV-------LT-----SADISSA..LR-------------------------
Q8LRG9_ORYSJ/1-68YR----LR-EI-MQEAI-KCM-RHA-KRTV-------LT-----ADDVDSALSLR-------------------------
TAF6_YEAST/9-74YR----IL-EI-IEQAV-KFK-RHS-KRDV-------LT-----TDDVSKA..LR-------------------------
Q9MAU3_ARATH/1-68YR----VR-EI-MQEAI-KCM-RHS-KRTT-------LT-----ASDVDGALNLR-------------------------
Q9DDC0_PLEWA/11-76YR----IK-EI-TQDAL-KFM-SVG-KRQK-------LT-----TCDIDSA..LR-------------------------
TAF6_DROME/18-83IK----LK-RI-VQDAA-KFM-NHA-KRQK-------LS-----VRDIDMS..LK-------------------------
TAF6_HUMAN/11-76YR----IK-EI-AQDAL-KFM-HMG-KRQK-------LT-----TSDIDYA..LK-------------------------
Q9GZI6_CAEEL/24-85EK----LK-EI-VRLSA-KWT-QKS-ARRR-------MA-----VADVEHA..IR-------------------------

PF07524

SPT7_SCHPO/707-783DY----MA-KM-GAVMD-QYL..IY-GKDK-------SQ----.QEIVG.QTLGEL---GVDDVND--------------
TAF8_DANRE/32-108SY----IT-EV-GRCAK-ANC.EHT-ARST-------PT----.LSDVV.ITLVEM---GF.NVDT--------------
TAF3_SCHPO/7-83RY----IR-LL-SETAM-AKA.EVG-RRSC-------CD----.LGDLR.LAMEEI---GL.LNGS--------------
ST65G_HUMAN/151-230EY----CL-KF-TKL.L-RFAVDRE-ARLG-------QT----PFPDVMEQVFHEV---GIGSVLS--------------
Q8LFR3_ARATH/24-100QY----IL-QL-GKTAT-SFA.NLT-GRSQ-------CN----.VFDII.LALDDL---TD.NNGE--------------
Q9VP40_DROME/6-77..----.R-EI-ARQTT-NWS.NHA-GRCA-------PS----.YFDLE.RTFIRM---NI.KVGE--------------
Q9SA19_ARATH/24-100KF----LQ-SL-AELAS-SFS.NTA-NRTE-------VN----.LFDIV.NGLQDI---AL.STSD--------------
TAF8_HUMAN/29-106SY----IS-EI-GRSAK-SYC.EHT-ARTQ-------PT----.LSDIV.VTLVEM---GF.NVDT--------------
Q9NAZ5_DROHY/4-80RF----IQ-EL-ARDLH-RQA.EHA-NRVE-------PN----.LKDVL.LSLKNV---SI.NVLE--------------
Q8MSB9_DROME/4-80KF----VQ-EF-ARDMH-RHM.EHA-NRIE-------PN----.LKDAR.LSIKNL---SI.NVQE--------------
Q7S5N4_NEUCR/125-200TY----LH-SL-TEEVK-VFA.NAA-RRSY-------PI----.PKDFE.NTLKRF---NL..TPT--------------
Q7YTH5_CAEEL/66-142SY----IK-RI-GEQ.S-RFACEVA-GRTI-------VT----.PGDVW.FGLVNM---GI.KVNQ--------------

PF15630

A3GI04_PICST/11-91NQ....IV.NL.GEDLE-LFA-QHA-NRST------.VK-----PDDLYMVTRKND...IL-------------------
A6RJU4_BOTFB/10-85HQ....IE.NV.TMDLE-SFS-RHA-GRST------.IT-----TDDVLLVTRRND...AL-------------------
A7RMQ5_NEMVE/23-98RQ....CE.SF.AVDLE-LFA-KHA-KRST------.IN-----NEDVKLLARKSP...SL-------------------
A7TEH2_VANPO/17-91IQ....LV.EM.GKDLE-MFS-RHA-NRDV------.IN-----NDDLKLLLRKVP...QL-------------------
B2W5N7_PYRTR/12-87TQ....IA.NT.ARDLE-VFS-KHA-GRKT------.IN-----PDDVLLLGRRNE...QL-------------------
B3DJV8_DANRE/9-84RQ....CD.IF.AKDLE-AFA-RHA-KRNT------.VT-----VDDVKLTARRTT...AL-------------------
B3RZC1_TRIAD/15-90KQ....SE.VI.ATDLE-AFA-RHA-KRTT------.IN-----GDDVKLLVRRNK...NV-------------------
B6JX09_SCHJY/4-85EQ....IK.VL.AKDVE-MFA-EHA-GRKT------.VQ-----PQDVVLCSRRNE...GL-------------------
B6QUS3_PENMQ/14-92AQ....IE.SV.SQDLE-AFA-KHA-GRST------.IN-----TNDVMLLARRNEGLESI-------------------
B7PXV9_IXOSC/11-86KH....AA.RT.AADLE-ALA-KHA-KRAT------.VS-----VDDVLLSARHNA...TL-------------------
C4Y931_CLAL4/26-101NQ....LV.SV.GEDLE-LFA-DHA-GRSV------.VN-----SSDVYMVTRRNE...IL-------------------
C5DNB5_LACTC/22-96TQ....LV.DI.GGDLE-AFA-RHA-GRET------.IV-----VEDLMLRLRNSS...DL-------------------
C5G144_ARTOC/13-88AQ....LE.TV.GQDLE-MFA-NHA-GRST------.IN-----ASDVLLLARRNE...GL-------------------
C5PFL7_COCP7/14-89DR....IA.DT.TDDLI-MFA-KHG-RHAQ------.IQ-----PSDVLLLGRRNA...GL-------------------
C7YTU2_NECH7/15-94AQIGRALE.NV.ATDLE-TFS-NHA-GRTT------.VT-----TDDVLLLARKNP...DL-------------------
D3B378_POLPA/165-243QI....AKKEV.SRDLA-MFS-KHA-KRQI------.IN-----GDDVLLMARKND...SV-------------------
D5GA13_TUBMM/32-107AQ....IE.NV.SRDLE-SFA-RHA-GRST------.VS-----TDDVLLLARRNE...GL-------------------
D7FWQ8_ECTSI/32-105KF....SE.SL.ALDLR-VFA-KHG-KRAV------.VG-----VDDVKCAARKDP...KL-------------------
E4ZQ21_LEPMJ/13-88TQ....IA.NT.SHDLE-LFS-AHA-GRSV------.IT-----PADVMLLARRNE...KL-------------------
E9CD47_CAPO3/14-89GK....CG.SL.ASDLE-SFA-KHA-KRST------.IQ-----VEDVKLCARKNP...SL-------------------
E9ECA7_METAQ/10-85TQ....IE.NV.AVDLE-SFA-NHA-SRTN------.IT-----TEDVLLLARKNP...DL-------------------
F0XLX6_GROCL/7-82TQ....IE.SV.ALDLE-SFS-RHA-GRST------.VT-----TDDVLLLARRNG...DL-------------------
F4PRK1_DICFS/235-311RL....LKNNI.SKDLF-LYC-KHA-KRQT------.IT-----MDDVILLSKTNP...TV-------------------
F4RWE9_MELLP/40-115AQ....CE.TL.ALDLK-AFA-AHA-NRNT------.IR-----AEDVKLVARKTT...AL-------------------
F6Y3J5_MONDO/1-76RQ....CG.RW.PQLXX-PFS-RHA-KRST------.IT-----TDDVKLLARRSS...SL-------------------
F7DQN4_XENTR/13-88RQ....CG.GF.CVVLL-VFK-KHA-KRTT------.IN-----MDDVKLLARRSR...SL-------------------
F7VU88_SORMK/11-86TQ....IE.NV.AIDLE-TFS-QHA-GRTT------.VT-----TDDVLLLARRNS...DL-------------------
F9WY71_MYCGM/13-88AK....IS.AV.STDLE-AFA-QHD-GRTT------.IG-----SKDVLLLARNNE...AL-------------------
G0V9K8_NAUCC/14-94LQ....LD.NL.GSDLE-RFA-HHA-GRET------.IT-----QEDMMLFLRKTP...IL-------------------
G3BEG3_CANTC/8-83NQ....LL.NL.GEDLE-AFA-HHA-GRTT------.IK-----PEDMYMVVRKNE...TL-------------------
G3MSD4_9ACAR/15-89GE....VC.CF.ARDLE-MLS-RHA-RRTT------.VS-----VEDVLFATRNSS...QL-------------------
G3PEU4_GASAC/26-101RQ....CD.VF.AKDLE-AFA-RHA-KRST------.VS-----PDDVKLVARRST...AL-------------------
G3VT77_SARHA/17-92RQ....CE.HF.AKDLE-MFA-RHA-KRST------.IN-----MEDVKLLARRSS...SL-------------------
G4LYK5_SCHMA/9-84RF....HQ.IL.ATDLE-TFS-RHA-KRST------.IT-----ADDVFCFVRRNP...QL-------------------
G4MZ92_MAGO7/9-84TQ....IE.NV.AKDLE-SFS-SHA-GRST------.IT-----TDDVLLLARRNE...DL-------------------
G6DRA0_DANPL/11-86KK....LI.TY.GLDLE-AFA-KHA-SRST------.IT-----TDDVKLLVRRNP...SL-------------------
G8YL18_PICSO/12-89NQ....LI.NL.GEDLE-SFA-RHA-GRTT------.ID-----PSDMYMVTRKNS...SL-------------------
H1VQ95_COLHI/11-86AQ....IE.SV.AGDLE-SFS-RHA-RRTT------.VT-----TDDVVLLARKNP...DL-------------------
H2LES2_ORYLA/10-85RQ....CD.IF.AKDLE-AFA-RHA-KRSM------.VS-----AEDVKLVARRSN...AL-------------------
H2N958_PONAB/17-92RQ....CE.NF.AKDLE-MFA-RHA-KRTT------.IN-----TEDVKLLARRSN...SL-------------------
H6C6E0_EXODN/12-87AQ....IG.NA.AIDLE-AFA-KHA-GRSK------.IK-----TDDVMLLTRRNE...GL-------------------
H9J6V9_BOMMO/11-84KK....LS.VY.ASDLE-VFA-RHA-RRCK------.IQ-----GEDVKLLVRRNK...SL-------------------
H9KVI3_CHICK/15-90RQ....AE.NF.ARDLE-MFA-RHA-KRST------.IT-----SEDVKLLARRSN...SL-------------------
I1FQJ7_AMPQE/21-96EQ....CR.LV.SHDLE-LFA-KHA-KRTT------.VN-----TDDVLLMCRRNP...SL-------------------
Q54PV0_DICDI/238-315NV....TK.DLVSKDLV-SFA-QHA-KRPT------KIT-----VDDVKLLARRND...SL-------------------
Q6BIJ2_DEBHA/13-90NQ....LL.NL.GEDLE-LFA-NHA-GRST------.IK-----PADLYMVTRKND...IL-------------------

PF00125

Q8IL74_PLAF7/27-103LF----IM-EL-TSNAW.KYT-EEG-KRRT.-----.LQ-----RQDVVSAACKK-------------------------
H2BWT_HUMAN/75-145DI----LD-RI-ATEAG.RLA-RST-KRQT.-----.IT-----AWETRMAVRLL-------------------------
Q7PVU9_ANOGA/105-178YI----SA-DI-LKLAG.YYV-KNI-RHIE.-----.IT-----REDIEVAMCAD-------------------------
H4_CAEEL/25-94VF----LE-NV-IRDAV.TYC-EHA-KRKT.-----.VT-----AMDVVYALKRQ-------------------------
H2A2_XENLA/18-91YL----TA-EI-LELAWERLP-EIT-KRPV.-----.LS-----PGT.CNSLCND-------------------------
H2AB2_HUMAN/22-95YL----TA-KV-LELAG.NEA-QNS-GERN.-----.IT-----PLLLDMVVHND-------------------------
O00912_LEIIN/23-92AY----VE-DI-VRCST.AYT-EYA-RKKT.-----.VT-----ACDVVTALRKQ-------------------------
O02612_LEIIN/19-89DV----ME-RI-CMEAA.SIV-RAN-KKRT.-----.LG-----AREVQTAVRIV-------------------------
O02613_CRIFA/18-93YL----TA-EL-LELSV.KAA-AQS-GKKPR-----RLS-----PRTVTMAVRHD-------------------------
O02648_DROSI/58-132TY----LV-GL-FEDTN.LCA-IHA-KRVT.-----.IM-----PKDIQLARRIR-------------------------
O15582_ENTHI/30-100DI----FE-RI-ATEAS.SLA-RNY-NKTT.-----.IT-----VKEIETATKLI-------------------------
O18643_CHAVR/29-99DL----FE-RI-ASEAS.RLA-HYN-KRST.-----.IT-----SREIQTAVRLL-------------------------
CENPA_MOUSE/51-127AF----LI-HL-FEDAY.LLS-LHA-GRVT.-----.LF-----PKDIQLTRRIR-------------------------
O44009_LEIBR/52-126AY----IV-SL-LADTN.LAC-IHA-KRVT.-----.IQ-----PKDVQLAMRLR-------------------------
H2B_CAPAN/52-122DI----FE-KL-AQESS.RLA-RYN-KKPT.-----.IT-----SREIQTAVRLV-------------------------
O96761_9TRYP/19-89DL----FE-RI-AAEAA.TIV-RVN-RKRT.-----.LG-----ARELQTAVRLV-------------------------
O96955_PLAVI/25-95DT----FE-KI-ATEAS.RLC-KYT-RRDT.-----.LS-----SREIQTAIRLV-------------------------
H2B_EUPCR/20-90DI----FE-KI-ALEAS.KLV-RYN-KKHT.-----.LS-----SREVQTAVRLL-------------------------
HCP3L_CAEEL/180-257AL----LV-QM-FDGSS.LIS-AHS-KRAT.-----.LT-----TTDVQLYRRLC-------------------------
HAP5_YEAST/152-225IF----IT-EL-TMRAW.CVA-ERN-KRRT.-----.LQ-----KADIAEALQKS-------------------------
Q19649_CAEEL/40-114DY----LV-EL-FRLGN.LCA-IKC-KRVT.-----.IE-----ADNLKFARRIR-------------------------
Q23429_CAEEL/30-104YL----TT-EL-MEMSA.IAA-NES-KKSR.-----.VT-----PRHLHLAIYGD-------------------------
E2RTQ0_GIAIN/25-101DL----FE-RI-ASEAS.NLA-KIS-KRNT.-----.IG-----KKDIESAAKLV-------------------------
E2RU60_GIAIN/21-90AF----LE-VV-LRDSL.TYT-EHG-QRKT.-----.VT-----SQDVVYALKRQ-------------------------
E2RU15_GIAIN/15-88NV----VA-EV-FREAC.NHR-DKK-SQKR.-----.IV-----PNHILTALRKD-------------------------
A8BYH2_GIAIC/69-146AM----LS-QV-LGDCQ.ILA-NHA-HRVT.-----.IM-----DKDIQIYMRIV-------------------------
A8B678_GIAIC/68-148EY----IV-EL-FSTAL.LAT-YHA-NRVT.-----.LM-----SKDILLVLRIQ-------------------------
A8B471_GIAIC/102-178NY----II-SL-FVDTQ.LCA-EHA-KRVT.-----.IM-----KPDMELATRIG-------------------------
Q7RRA6_PLAYO/27-103LF----IM-EF-TKYAW.KYT-EEN-KRRT.-----.LQ-----RQDVIAAACRK-------------------------
Q7XV46_ORYSJ/214-290AY----LV-GL-FEDTN.LCA-IHA-KRVT.-----.IM-----PKDIQLARRIR-------------------------
Q7XYY4_PYRLU/77-151MF----LV-GI-FEDAS.MCA-LHG-RRVT.-----.IM-----RRDIQLSRSFR-------------------------
Q7Z106_PARTE/51-125AF----IV-NL-LEDSV.LCA-HHA-KRMT.-----.VM-----QRDINLARRIR-------------------------
CENPA_DANRE/65-140AF----MV-RL-FSDAN.LCA-IHA-KRVT.-----.LF-----PRDIQLARRIR-------------------------
H2AV3_ORYSJ/32-106YL----TA-EV-LELAG.NAS-KDL-KVKR.-----.IT-----PRHLQLAIRGD-------------------------
H2A3_ORYSJ/19-92YL----AA-EV-LELAG.NAA-RDN-KKTR.-----.IV-----PRHIQLAVRND-------------------------
Q867G5_TRYBB/61-135TY----IT-SV-FMDAN.LCT-LHA-NRVT.-----.LF-----PKDIQLALKLR-------------------------
Q867U7_TRYBB/41-111DM----YG-KI-QAEAV.HVA-CIN-NVKT.-----.LT-----AREIQTSARLL-------------------------
Q86EU0_SCHJA/18-91YL----VA-EV-NELSG.NAA-KAN-KRKT.-----.IT-----PRHIMLGVRND-------------------------
CENPA_CANGA/159-236AY----LV-GL-LEHTN.LLA-LHA-KRIT.-----.IM-----KKDMQLARRIR-------------------------
Q8BP16_MOUSE/15-88YL----AA-EI-LELAG.NAA-RDN-KKAR.-----.IA-----PRHILLAVAND-------------------------
Q8IDZ1_PLAF7/90-167AY----LV-SL-FEDAY.LCS-LHA-NRVT.-----.LM-----PKDIHLARRIR-------------------------
Q8LK76_MAIZE/76-152FH----LI-EL-FEMAN.LCA-IHA-KRVT.-----.IM-----QKDIQLARRIG-------------------------
Q8NIA3_HUMAN/97-169YI----SA-DI-LKLVG.NYV-RNI-RHYE.-----.IT-----KQDIKVAMCAD-------------------------
H3L_ENCCU/57-130NF----LT-SL-MEDAY.RCV-LHA-KRVT.-----.LM-----PKDICLVYKIK-------------------------
H4_ENCCU/27-96EY----IR-DT-LSIAC.IYA-THA-KRKT.-----.IT-----CSDILHSLKRM-------------------------
H31_ENCCU/59-135VY----LV-GL-FEDAM.LCA-YHA-KRVT.-----.VF-----PKDISLVLKLR-------------------------
Q8T9Z4_DROOR/130-206LY----VT-QR-LSDSY.MLT-RHR-NRVT.-----.LE-----VRDMALMAYIC-------------------------
Q8TA36_HETGL/23-92SY----LE-TI-IRDAA.IYC-QHE-RRKT.-----.MK-----SRDVVHALRRQ-------------------------
Q8VEE3_MOUSE/32-99DI----FE-RI-A...G.MKT-PHD-HSTP.-----.IP-----KGMWTHAPRHQ-------------------------
H2BV_BOVIN/29-99DM----FE-RI-STEAC.NLM-YYR-KRCT.-----.LT-----PEDIEKAVYLL-------------------------
Q92646_HUMAN/13-84YL----TA-KI-LELAG.NAA-RD.-KKTR.-----.VT-----PRRLQLAIH.D-------------------------
Q98SC6_GUITH/26-100DY----II-GL-LQDAN.LAA-IHA-KRVT.-----.VM-----PKDLKLAKIIR-------------------------
Q9CQ70_MOUSE/15-88YL----TS-NI-LELAG.EVA-HTT-GRKR.-----.IA-----PEHVCRVVQNN-------------------------
H2BV_MOUSE/30-100DI----FE-RI-ATEAC.QQM-FLR-KRCT.-----.LT-----PGDIQQAVHLL-------------------------
Q9DAB5_MOUSE/130-200DM----FE-RI-ASEAS.FLA-RQA-RNST.-----.IN-----SREIQTAIRLL-------------------------
Q9DAD9_MOUSE/13-86YL----TS-NI-LELAG.EVA-HTT-GRKR.-----.VT-----PEDVRLVVQNN-------------------------
Q9GRH3_STYLE/100-174CF----LV-GL-FEDCH.QCA-IHA-NRVT.-----.VM-----PKDMQLARRLR-------------------------
H3L1_LILLO/70-144DE----LV-NH-FGNVQ.ICS-IHA-KRII.-----.IT-----VKDFKLAKLLK-------------------------
H2B_LILLO/48-118HN----FQ-NI-AKEAS.ILA-QYS-KKKT.-----.IT-----VKELKAAVKLV-------------------------
H2B2_ARATH/145-215DM----FE-RI-AQEAA.RLS-DYT-KRRT.-----.LS-----SREIEAAVRLV-------------------------
H2A8_ARATH/23-97YL----TT-EV-LQLAE.NTS-KDL-KVKR.-----.IT-----PRHLQLAIRGD-------------------------
Q9XG41_GUITH/8-78DL----FE-RL-VSESY.NLS-NSS-RSKT.-----.LT-----AREIQTSVRLV-------------------------
H2A1_LILLO/18-91NL----VA-EV-LDMAA.NVT-EET-SPIV.-----.IK-----PRHIMLAPRND-------------------------
CENPA_SCHPO/38-118AF----LV-HL-FEDTN.LCA-IHA-KRVT.-----.IM-----QRDMQLARRIR-------------------------

PF04719

Q20563_CAEEL/236-327VF----VG-EV-VEEAL-DIRDINE-EEASN.....PLQ-----PHHIRQAFLRL-------------------------
Q9M565_ARATH/105-194MF----VG-EL-VETAR-VVMA..E-RKESG.....PIR-----PCHIRESYRRL-------------------------
Q9AW46_GUITH/30-124IY----IG-EK-IEKAK-QVM..FE-IEDTSRWMSSPIQ-----NNHL...IKSL-------------------------
TAF11_DROME/89-177VF----VG-EV-VEEAL-DVME..A-QGESG.....ALQ-----PKFIREAVRRL-------------------------
TAF11_MOUSE/106-194VF----VG-EV-VEEAL-DVCE..K-WGETP.....PLQ-----PKHMREAVRRL-------------------------
Q9C2R5_NEUCS/200-281VF----IG-DI-IEGAR-RVQA..E-WIEKTG.......-----.....EKQTDL-------------------------
TAF11_YEAST/124-213IY----AG-EI-IELAM-IVKNKWL-TSQMC......IE-----FDKRTKIGYKL-------------------------
Q9LNS8_ARATH/128-217MF----VG-DL-VETAR-VVMR..E-RKESG.....PIR-----PCHIRESYRRL-------------------------
TAF11_SCHPO/93-181VF----VG-EI-VELAR-KIQD..Q-WGDTG.....PLS-----PDHLREAYRLS-------------------------
Q21417_CAEEL/221-312VL----VG-EI-VEEAL-DIRDLDE-KEAKE.....PLQ-----PHHIRQAYLRL-------------------------

PF02269

SUPT3_HUMAN/106-198TQ----LI-NL-LQQAA-EVS-QLR-GARV-------IT-----PEDLLFLMRKDKKKLRRLLKYMFIRDYKSKIVKGID
Q17957_CAEEL/27-116NY----IK-EL-CQLAM-KVG-KPD-...K-------MA-----LEDIHYLIRRDPKKFSRVKDLLSMSEELKKARKQFE
SPT3_YEAST/5-96GQ----VI-EI-LLQSN-KTA-HLR-GSRS-------IL-----PEDVIFLIRHDKAKVNRLRTYLSWKDLR.KNAKDQD
SPT3_SCHPO/8-99GQ----VM-EM-LIQAN-ELA-LRR-GSRS-------IT-----VEDLFFLIRHDRAKVNRLKTYLSWKEVR.KKAKEQD
TAF13_YEAST/9-101GY----LV-DV-CTNAF-HTA-QNS-QRNK-------LR-----LEDFKFALRKDPIKLGRAEELIATNKLITEAKKQFN
TAF13_HUMAN/30-119EF----IT-EM-THKAM-SIG-RQG-...R-------VQ-----VEDIVFLIRKDPRKFARVKDLLTMNEELKRARKAFD

PF03847

TAF12_YEAST/416-488DF----VT-NV-TAFSC-RLA-KHR-KSDN-------LE-----ARDIQLHLERNWNI----------------------
TAF12_SCHPO/344-411EF----VE-SV-TNFAC-RLA-KHR-KSDT-------LD-----VRDVQLHLERNWNI----------------------
TAF12_DROME/93-160DF----VE-DT-VKSTS-AFA-KHR-KSNK-------IE-----VRDVQLHFERKYNM----------------------
Q9VR21_DROME/67-133AF----VN-DI-SMRIV-KLA-KYR-KSD.-------VS-----VLDLKFILKREFNM----------------------
Q9SR71_ARATH/401-468DF----VE-SI-TTFGC-SLA-KHR-KSDI-------LE-----AKDILLHVERNWNI----------------------
TAF12_HUMAN/59-126DF----IE-SV-VTAAC-QLA-RHR-KSST-------LE-----VKDVQLHLERQWNM----------------------
Q9U226_CAEEL/233-297DF----VS-SL-IDKAC-KMI-KNR-EVKK-------IE-----SRDIEFILKNVYNM----------------------
Q9LNR1_ARATH/526-593DF----ID-SV-TSFAC-SLA-KHR-KSSV-------LE-----PKDILLHLEKNLHL----------------------

PF00808

NFYB9_ARATH/62-127EY----IS-FV-TGEAN.ERC-QRE-QRKT-------IT-----AEDILWAM----------------------------
HARB_PYRSG/2-65EK----AL-EI-ARKAV.DLA-KHA-GRKT-------VK-----AEDIKLAI----------------------------
HFO2_METFO/2-65EN----GE-EL-AKKAV.ELA-KHA-GRKT-------VK-----AEDIEMAV----------------------------
HJA2_METJA/2-65EI----AL-EI-AKEAV.ELA-KHA-KRKT-------VK-----VEDIKLAL----------------------------
NFYB4_ARATH/6-71EF----IS-FV-TCEAS.EKC-HRE-NRKT-------VN-----GDDIWWAL----------------------------
Q20237_CAEEL/64-128HF----AE-KF-LQAAA.EAT-QFT-SSKT-------LN-----PQHMKQAV----------------------------
HMFB_METFE/1-64EM----GR-DI-ASEAI.KLA-RHA-GRKT-------IK-----AEDIELAV----------------------------
Q9V452_DROME/18-83LF----VR-HL-AGAAYTEEF-GQR-PGEA-------LK-----YEHLSQVV----------------------------
NFYB5_ARATH/54-119EF----IS-FV-TGEAS.DKC-HKE-KRKT-------VN-----GDDICWAM----------------------------
HAF2_ARCFU/2-65DY----AI-TV-AKKAV.EIA-KHS-GRKT-------VT-----ADDIKLAL----------------------------
Q9GSP1_DROME/10-74LF----VE-SL-LTKTL.RIT-NAR-NAKT-------LS-----PSHMRQCI----------------------------
Q9FHS0_ARATH/10-74LF----LH-FL-AEKSA.VVT-AEK-KRKT-------VN-----LDHLRIAV----------------------------
NC2B_HUMAN/11-75EF----IH-LI-SSEAN.EIC-NKS-EKKT-------IS-----PEHVIQAL----------------------------
HAP3_KLULA/25-90EF----IS-FV-TSEAC.DRC-TSG-KRKT-------IN-----GEDILLSL----------------------------
HAF1_ARCFU/6-69EY----AM-QI-GKKAA.ELA-KHA-GRKT-------VK-----VDDIKLAL----------------------------
HFOB_METFO/1-64EK----GE-TI-ATEAV.KLA-KHA-GRKT-------VK-----ASDVELAV----------------------------
Q9LN09_ARATH/108-172MF----IE-RF-SEEAY.DSS-VKD-KKKF-------IH-----YKHLSSVV----------------------------
HAP3_SCHPO/10-75EF----IS-FV-TGEAS.EQC-TQE-KRKT-------IT-----GEDVLLAL----------------------------
O59848_ASPOZ/46-111EF----IS-FI-TSEAS.EKC-QQE-KRKT-------VN-----GEDILFAM----------------------------
O93641_9EURY/3-67TM----AE-YV-ANAAK.SVL-DAS-GKKT-------LM-----EEHLKALA----------------------------
O76256_SCHMA/27-92EF----IS-FI-TSELP.DKC-QTE-KRKT-------IN-----GEDILCAM----------------------------
NC2B_SCHPO/10-75EF----IH-LV-SSEAN.EIC-EKE-AKKT-------IA-----AEHIIKAL----------------------------
Q9LHG0_ARATH/7-71LF----LQ-DL-CDRTY.EIT-LER-GAKT-------VS-----SLHLKHCV----------------------------
O17072_CAEEL/108-174FF----IE-EM-TAMGW.QYV-SEA-RRRI-------LQ-----KADIASAV----------------------------
O73745_XENLA/39-103IF----IT-EL-TLRAW.IHT-EDN-KRRT-------LQ-----RNDIAMAI----------------------------
O45550_CAEEL/20-84EF----VK-HI-AREAQ.RIA-SQD-QRKT-------IY-----HEHVQKAL----------------------------
NC2B_ARATH/14-79EF----IN-LV-SSESN.DVC-NKE-DKRT-------IA-----PEHVLKAL----------------------------
O17286_CAEEL/64-129EF----IS-FI-ASEAA.EIC-NIT-KRKT-------IT-----ADDLLTAM----------------------------

PF15511

H2QBC7_PANTR/25-514KY----FQ-HL-CDDLE-VFA-AHA.GRKT-------VK-----PED---------------------------------
G3SYD4_LOXAF/26-492KY----FQ-HL-CNDLE-VFA-AHA.GRKT-------VK-----PED---------------------------------
E2RJV5_CANFA/26-460RY----FQ-HL-CDDLE-AFA-AHA.GRKT-------VR-----PED---------------------------------
F6PKQ6_HORSE/26-517KY----FQ-HL-CDDLE-MFA-AHA.GRKT-------VR-----PED---------------------------------
F1S2K5_PIG/26-517KY----FQ-HL-CGDLE-AFA-AHA.GRKT-------VR-----PED---------------------------------
G1PFK4_MYOLU/26-518KY----FQ-RL-CDDLD-VFA-AHA.GRKT-------VR-----LED---------------------------------
H0XDJ1_OTOGA/25-517KF----FQ-HL-CDDLE-VFA-AHA.GRRT-------VK-----PED---------------------------------
G1SQR3_RABIT/26-502KY----FQ-HL-CNDLE-VFA-AHA.GRKT-------VR-----PED---------------------------------
H0UV87_CAVPO/26-506KY----LQ-HL-CNDLD-VFA-AHA.GRKT-------VK-----PAD---------------------------------
CENPT_RAT/26-471EY----FQ-RL-CNDLE-VFA-AHA.GRKT-------VK-----PKD---------------------------------
F7C6J3_ORNAN/50-507RY----FR-QL-GDDLE-VFT-SHA.GRKT-------VE-----AED---------------------------------
B2WAR3_PYRTR/18-424DF----FE-QI-SGDLA-AYA-QHG.GRKM-------IE-----ESD---------------------------------
Q0V6N5_PHANO/18-452DF----FE-QI-GIDLA-AYA-QHG.GRKM-------IE-----ESD---------------------------------
E4ZUA3_LEPMJ/75-488DF----FE-QI-SIDLS-AYA-QHG.GRKI-------IE-----ESD---------------------------------
H1V6T6_COLHI/84-483WF----FE-QL-GDDLS-AYA-RHA.KRKT-------ID-----ESD---------------------------------
G2WXZ9_VERDV/71-445WF----FE-QV-SEDLG-AYA-AHA.GRRT-------IN-----ESD---------------------------------
F0XUM0_GROCL/71-509WF----FE-QV-GVDLE-RYS-KHA.GRKT-------ID-----ESD---------------------------------
G2Q011_THIHA/56-448WF----FE-QL-GEDLQ-AYA-KHA.GRKT-------ID-----ESD---------------------------------
G2R3Q2_THITE/60-455WF----FE-QL-GEDLQ-AYA-KHA.GRKT-------ID-----ESD---------------------------------
Q2H4H2_CHAGB/63-448WF----FE-QM-SEDLQ-AYA-KHA.GRKT-------ID-----ESD---------------------------------
B2AUG9_PODAN/52-455WF----FE-QL-GEDLE-AYS-KHA.GRNT-------IN-----ESD---------------------------------
F7VUV4_SORMK/70-543WF----FE-QL-GDDLS-AYA-KHA.HRKT-------ID-----MSD---------------------------------
G5EH18_MAGO7/96-512WF----FE-QM-GDDLR-ALA-HHA.GRKT-------IE-----QSD---------------------------------
C7YN20_NECH7/70-475WF----FE-QL-GDDLG-AYA-DHA.KRKT-------IE-----ESD---------------------------------
I1RX16_GIBZE/59-455WF----FE-QL-GDDLG-AYA-DHA.KRKT-------IE-----ESD---------------------------------
E9EUR1_METAR/77-484WF----FE-QL-GDDLG-AYA-NHA.KRKT-------IE-----ESD---------------------------------
G3JMA4_CORMM/68-522WF----FE-QL-GDDLG-AYA-DHA.KRTV-------IE-----ESD---------------------------------
H6BTF1_EXODN/11-447WF----FE-QV-GDDLA-AYS-DHARRRKR-------VD-----RSD---------------------------------
A6SS64_BOTFB/43-483WF----FE-QI-SDDLS-TYS-EHA.GRKT-------ID-----ESD---------------------------------
Q5B3X8_EMENI/64-438WY----LE-QA-SEDLE-AYS-KHA.GRKT-------ID-----EAD---------------------------------
G7XFC4_ASPKW/68-429WY----FE-QA-SEDLA-AYS-KHA.GRKT-------ID-----ESD---------------------------------
Q4WWL8_ASPFU/76-441WY----FE-QV-SEDLA-AYS-KHA.GRKT-------ID-----ETD---------------------------------
B6HEI8_PENCW/70-421WY----FE-QA-SQDLA-AYS-KHA.GRKT-------ID-----ESD---------------------------------
B8MMW5_TALSN/60-429WF----FE-QA-SEDLA-AYS-KHA.GRKT-------ID-----ESD---------------------------------
C5FZG9_ARTOC/82-443WF----FE-QA-SGDLS-TYS-KHS.GRKT-------ID-----ETD---------------------------------
C5PIR4_COCP7/46-397WF----FE-QA-NDDLS-AYS-KHS.NRKT-------VD-----ETD---------------------------------
C1H556_PARBA/152-504WY----FE-QA-SDDLL-AYA-KHA.GRKT-------ID-----ETD---------------------------------
D5G8P1_TUBMM/86-466AF----FQ-QA-SEDLA-AYS-KHA.GRKV-------IE-----DSD---------------------------------
G1XD77_ARTOA/125-537AY----FE-NL-GEDLG-SFA-KHA.KRKT-------VE-----EGD---------------------------------
B6K2P7_SCHJY/48-429KF----MS-QM-LHDLE-TYA-DHA.SRKT-------IN-----SED---------------------------------

PF02291

TAF9_YEAST/19-152KKALPQVMGTWGVRLPPEKYCLTAKEWDLE----
TAF9_HUMAN/2-130QTPLPLIKPYSGPRLPPDRYCLTAPNYRLK----
TAF9_DROME/8-136SMPLPPIKPHCGLRLPPDRYCLTGVNYKLR----
O45784_CAEEL/13-136QQPLPQIRHNYGLKLPNDRFCQLQQNFVYK----
TAF9_SCHPO/3-133RKPLPQIQPSYGFRLPPEKYCLTQPNWIVS----

PF15510

B2RVH1_MOUSE/1-86TNA---CESKSRVI--KKDHVLAAGKVILKKSRG
F1S2W8_PIG/1-102ANA---CENKCGVI--KKDHVLAAAKVILKKSRG
G7P379_MACFA/1-103TNA---CESKCRVI--NKEHVLAAAKVILKKSRG
H0VLK4_CAVPO/1-103INA---CENKCGII--KKDHILAAAKVILKKSRG
D3Z8J2_RAT/1-86TNA---GESKSGVI--KKDHVCAAAKVILKKSKG
G1P8B1_MYOLU/1-88TDA---CKNKCGII--KDQHVLAAAKVMLKKSRG

PF02969

TAF6_XENLA/9-74----------------------------------
TAF6L_HUMAN/9-73----------------------------------
TAF6_SCHPO/3-68----------------------------------
Q8LRG9_ORYSJ/1-68----------------------------------
TAF6_YEAST/9-74----------------------------------
Q9MAU3_ARATH/1-68----------------------------------
Q9DDC0_PLEWA/11-76----------------------------------
TAF6_DROME/18-83----------------------------------
TAF6_HUMAN/11-76----------------------------------
Q9GZI6_CAEEL/24-85----------------------------------

PF07524

SPT7_SCHPO/707-783----------------------------------
TAF8_DANRE/32-108----------------------------------
TAF3_SCHPO/7-83----------------------------------
ST65G_HUMAN/151-230----------------------------------
Q8LFR3_ARATH/24-100----------------------------------
Q9VP40_DROME/6-77----------------------------------
Q9SA19_ARATH/24-100----------------------------------
TAF8_HUMAN/29-106----------------------------------
Q9NAZ5_DROHY/4-80----------------------------------
Q8MSB9_DROME/4-80----------------------------------
Q7S5N4_NEUCR/125-200----------------------------------
Q7YTH5_CAEEL/66-142----------------------------------

PF15630

A3GI04_PICST/11-91----------------------------------
A6RJU4_BOTFB/10-85----------------------------------
A7RMQ5_NEMVE/23-98----------------------------------
A7TEH2_VANPO/17-91----------------------------------
B2W5N7_PYRTR/12-87----------------------------------
B3DJV8_DANRE/9-84----------------------------------
B3RZC1_TRIAD/15-90----------------------------------
B6JX09_SCHJY/4-85----------------------------------
B6QUS3_PENMQ/14-92----------------------------------
B7PXV9_IXOSC/11-86----------------------------------
C4Y931_CLAL4/26-101----------------------------------
C5DNB5_LACTC/22-96----------------------------------
C5G144_ARTOC/13-88----------------------------------
C5PFL7_COCP7/14-89----------------------------------
C7YTU2_NECH7/15-94----------------------------------
D3B378_POLPA/165-243----------------------------------
D5GA13_TUBMM/32-107----------------------------------
D7FWQ8_ECTSI/32-105----------------------------------
E4ZQ21_LEPMJ/13-88----------------------------------
E9CD47_CAPO3/14-89----------------------------------
E9ECA7_METAQ/10-85----------------------------------
F0XLX6_GROCL/7-82----------------------------------
F4PRK1_DICFS/235-311----------------------------------
F4RWE9_MELLP/40-115----------------------------------
F6Y3J5_MONDO/1-76----------------------------------
F7DQN4_XENTR/13-88----------------------------------
F7VU88_SORMK/11-86----------------------------------
F9WY71_MYCGM/13-88----------------------------------
G0V9K8_NAUCC/14-94----------------------------------
G3BEG3_CANTC/8-83----------------------------------
G3MSD4_9ACAR/15-89----------------------------------
G3PEU4_GASAC/26-101----------------------------------
G3VT77_SARHA/17-92----------------------------------
G4LYK5_SCHMA/9-84----------------------------------
G4MZ92_MAGO7/9-84----------------------------------
G6DRA0_DANPL/11-86----------------------------------
G8YL18_PICSO/12-89----------------------------------
H1VQ95_COLHI/11-86----------------------------------
H2LES2_ORYLA/10-85----------------------------------
H2N958_PONAB/17-92----------------------------------
H6C6E0_EXODN/12-87----------------------------------
H9J6V9_BOMMO/11-84----------------------------------
H9KVI3_CHICK/15-90----------------------------------
I1FQJ7_AMPQE/21-96----------------------------------
Q54PV0_DICDI/238-315----------------------------------
Q6BIJ2_DEBHA/13-90----------------------------------

PF00125

Q8IL74_PLAF7/27-103----------------------------------
H2BWT_HUMAN/75-145----------------------------------
Q7PVU9_ANOGA/105-178----------------------------------
H4_CAEEL/25-94----------------------------------
H2A2_XENLA/18-91----------------------------------
H2AB2_HUMAN/22-95----------------------------------
O00912_LEIIN/23-92----------------------------------
O02612_LEIIN/19-89----------------------------------
O02613_CRIFA/18-93----------------------------------
O02648_DROSI/58-132----------------------------------
O15582_ENTHI/30-100----------------------------------
O18643_CHAVR/29-99----------------------------------
CENPA_MOUSE/51-127----------------------------------
O44009_LEIBR/52-126----------------------------------
H2B_CAPAN/52-122----------------------------------
O96761_9TRYP/19-89----------------------------------
O96955_PLAVI/25-95----------------------------------
H2B_EUPCR/20-90----------------------------------
HCP3L_CAEEL/180-257----------------------------------
HAP5_YEAST/152-225----------------------------------
Q19649_CAEEL/40-114----------------------------------
Q23429_CAEEL/30-104----------------------------------
E2RTQ0_GIAIN/25-101----------------------------------
E2RU60_GIAIN/21-90----------------------------------
E2RU15_GIAIN/15-88----------------------------------
A8BYH2_GIAIC/69-146----------------------------------
A8B678_GIAIC/68-148----------------------------------
A8B471_GIAIC/102-178----------------------------------
Q7RRA6_PLAYO/27-103----------------------------------
Q7XV46_ORYSJ/214-290----------------------------------
Q7XYY4_PYRLU/77-151----------------------------------
Q7Z106_PARTE/51-125----------------------------------
CENPA_DANRE/65-140----------------------------------
H2AV3_ORYSJ/32-106----------------------------------
H2A3_ORYSJ/19-92----------------------------------
Q867G5_TRYBB/61-135----------------------------------
Q867U7_TRYBB/41-111----------------------------------
Q86EU0_SCHJA/18-91----------------------------------
CENPA_CANGA/159-236----------------------------------
Q8BP16_MOUSE/15-88----------------------------------
Q8IDZ1_PLAF7/90-167----------------------------------
Q8LK76_MAIZE/76-152----------------------------------
Q8NIA3_HUMAN/97-169----------------------------------
H3L_ENCCU/57-130----------------------------------
H4_ENCCU/27-96----------------------------------
H31_ENCCU/59-135----------------------------------
Q8T9Z4_DROOR/130-206----------------------------------
Q8TA36_HETGL/23-92----------------------------------
Q8VEE3_MOUSE/32-99----------------------------------
H2BV_BOVIN/29-99----------------------------------
Q92646_HUMAN/13-84----------------------------------
Q98SC6_GUITH/26-100----------------------------------
Q9CQ70_MOUSE/15-88----------------------------------
H2BV_MOUSE/30-100----------------------------------
Q9DAB5_MOUSE/130-200----------------------------------
Q9DAD9_MOUSE/13-86----------------------------------
Q9GRH3_STYLE/100-174----------------------------------
H3L1_LILLO/70-144----------------------------------
H2B_LILLO/48-118----------------------------------
H2B2_ARATH/145-215----------------------------------
H2A8_ARATH/23-97----------------------------------
Q9XG41_GUITH/8-78----------------------------------
H2A1_LILLO/18-91----------------------------------
CENPA_SCHPO/38-118----------------------------------

PF04719

Q20563_CAEEL/236-327----------------------------------
Q9M565_ARATH/105-194----------------------------------
Q9AW46_GUITH/30-124----------------------------------
TAF11_DROME/89-177----------------------------------
TAF11_MOUSE/106-194----------------------------------
Q9C2R5_NEUCS/200-281----------------------------------
TAF11_YEAST/124-213----------------------------------
Q9LNS8_ARATH/128-217----------------------------------
TAF11_SCHPO/93-181----------------------------------
Q21417_CAEEL/221-312----------------------------------

PF02269

SUPT3_HUMAN/106-198E---------------------------------
Q17957_CAEEL/27-116D---------------------------------
SPT3_YEAST/5-96A---------------------------------
SPT3_SCHPO/8-99A---------------------------------
TAF13_YEAST/9-101E---------------------------------
TAF13_HUMAN/30-119E---------------------------------

PF03847

TAF12_YEAST/416-488----------------------------------
TAF12_SCHPO/344-411----------------------------------
TAF12_DROME/93-160----------------------------------
Q9VR21_DROME/67-133----------------------------------
Q9SR71_ARATH/401-468----------------------------------
TAF12_HUMAN/59-126----------------------------------
Q9U226_CAEEL/233-297----------------------------------
Q9LNR1_ARATH/526-593----------------------------------

PF00808

NFYB9_ARATH/62-127----------------------------------
HARB_PYRSG/2-65----------------------------------
HFO2_METFO/2-65----------------------------------
HJA2_METJA/2-65----------------------------------
NFYB4_ARATH/6-71----------------------------------
Q20237_CAEEL/64-128----------------------------------
HMFB_METFE/1-64----------------------------------
Q9V452_DROME/18-83----------------------------------
NFYB5_ARATH/54-119----------------------------------
HAF2_ARCFU/2-65----------------------------------
Q9GSP1_DROME/10-74----------------------------------
Q9FHS0_ARATH/10-74----------------------------------
NC2B_HUMAN/11-75----------------------------------
HAP3_KLULA/25-90----------------------------------
HAF1_ARCFU/6-69----------------------------------
HFOB_METFO/1-64----------------------------------
Q9LN09_ARATH/108-172----------------------------------
HAP3_SCHPO/10-75----------------------------------
O59848_ASPOZ/46-111----------------------------------
O93641_9EURY/3-67----------------------------------
O76256_SCHMA/27-92----------------------------------
NC2B_SCHPO/10-75----------------------------------
Q9LHG0_ARATH/7-71----------------------------------
O17072_CAEEL/108-174----------------------------------
O73745_XENLA/39-103----------------------------------
O45550_CAEEL/20-84----------------------------------
NC2B_ARATH/14-79----------------------------------
O17286_CAEEL/64-129----------------------------------

PF15511

H2QBC7_PANTR/25-514----------------------------------
G3SYD4_LOXAF/26-492----------------------------------
E2RJV5_CANFA/26-460----------------------------------
F6PKQ6_HORSE/26-517----------------------------------
F1S2K5_PIG/26-517----------------------------------
G1PFK4_MYOLU/26-518----------------------------------
H0XDJ1_OTOGA/25-517----------------------------------
G1SQR3_RABIT/26-502----------------------------------
H0UV87_CAVPO/26-506----------------------------------
CENPT_RAT/26-471----------------------------------
F7C6J3_ORNAN/50-507----------------------------------
B2WAR3_PYRTR/18-424----------------------------------
Q0V6N5_PHANO/18-452----------------------------------
E4ZUA3_LEPMJ/75-488----------------------------------
H1V6T6_COLHI/84-483----------------------------------
G2WXZ9_VERDV/71-445----------------------------------
F0XUM0_GROCL/71-509----------------------------------
G2Q011_THIHA/56-448----------------------------------
G2R3Q2_THITE/60-455----------------------------------
Q2H4H2_CHAGB/63-448----------------------------------
B2AUG9_PODAN/52-455----------------------------------
F7VUV4_SORMK/70-543----------------------------------
G5EH18_MAGO7/96-512----------------------------------
C7YN20_NECH7/70-475----------------------------------
I1RX16_GIBZE/59-455----------------------------------
E9EUR1_METAR/77-484----------------------------------
G3JMA4_CORMM/68-522----------------------------------
H6BTF1_EXODN/11-447----------------------------------
A6SS64_BOTFB/43-483----------------------------------
Q5B3X8_EMENI/64-438----------------------------------
G7XFC4_ASPKW/68-429----------------------------------
Q4WWL8_ASPFU/76-441----------------------------------
B6HEI8_PENCW/70-421----------------------------------
B8MMW5_TALSN/60-429----------------------------------
C5FZG9_ARTOC/82-443----------------------------------
C5PIR4_COCP7/46-397----------------------------------
C1H556_PARBA/152-504----------------------------------
D5G8P1_TUBMM/86-466----------------------------------
G1XD77_ARTOA/125-537----------------------------------
B6K2P7_SCHJY/48-429----------------------------------

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window