Sequence alignment for CL0018

PF00170

CREM_HUMAN/300-359----------------------------EATRKRELRLMKNREAAKECRRRKKEYVKCLESRVAVLEVQNKKL---IEEL
BZLF1_EBVB9/170-230----------------------------ECDSELEIKRYKNRVASRKCRAKFKQLLQHYREVAAAKSSENDRL---R...
GCN4_YEAST/223-279----------------------------ESSDPAALKRARNTEAARRSRARKLQRMKQLEDKVEELLSKN...---....
TAF1_TOBAC/192-255----------------------------ERELKREKRKQSNRESARRSRLRKQAEAEELAIRVQSLTAENMTL---KSEI
JUNB_HUMAN/266-329----------------------------QERIKVERKRLRNRLAATKCRKRKLERIARLEDKVKTLKAENAGL---SSTA
HBP1A_WHEAT/250-313----------------------------ERELKKQKRKLSNRESARRSRLRKQAECEELGQRAEALKSENSSL---RIEL
GBF3_ARATH/257-320----------------------------ERELKRERRKQSNRESARRSRLRKQAETEELARKVEALTAENMAL---RSEL
GBF1_ARATH/220-283----------------------------ERELKRQKRKQSNRESARRSRLRKQAECEQLQQRVESLSNENQSL---RDEL
CREBA_DROME/439-502----------------------------EKSLKKIRRKIKNKISAQESRRKKKEYMDQLERRVEILVTENHDY---KKRL
CPC1_NEUCR/214-270----------------------------DPSDVVAMKRARNTLAARKSRERKAQRLEELEAKIEELIAER...---....
GBF2_ARATH/247-310----------------------------EKEVKREKRKQSNRESARRSRLRKQAETEQLSVKVDALVAENMSL---RSKL
ATF4_HUMAN/276-339----------------------------EKLDKKLKKMEQNKTAATRYRQKKRAEQEALTGECKELEKKNEAL---KERA
GBF4_ARATH/185-248----------------------------KAAAQRQKRMIKNRESAARSRERKQAYQVELETLAAKLEEENEQL---LKEI
JRA_DROME/210-273----------------------------QEKIKLERKRQRNRVAASKCRKRKLERISKLEDRVKVLKGENVDL---ASIV
CPRF1_PETCR/267-330----------------------------DRDLKRERRKQSNRESARRSRLRKQAEAEELAIKVDSLTAENMAL---KAEI
ATF1_HUMAN/211-270----------------------------DPQLKREIRLMKNREAARECRRKKKEYVKCLENRVAVLENQNKTL---IEEL
JUN_CHICK/233-296----------------------------QERIKAERKRMRNRIAASKCRKRKLERIARLEEKVKTLKAQNSEL---ASTA
CPRF3_PETCR/194-257----------------------------ERELKRQRRKQSNRESARRSRLRKQAKSDELQERLDNLSKENRIL---RKNL
ACA1_YEAST/382-445----------------------------AKAWKRARLLERNRIAASKCRQRKKMSQLQLQREFDQISKENTMM---KKKI
EMBP1_WHEAT/248-311----------------------------ERELKRERRKQSNRESARRSRLRKQQECEELAQKVSELTAANGTL---RSEL
CREB1_BOVIN/265-324----------------------------EAARKREVRLMKNREAARECRRKKKEYVKCLENRVAVLENQNKTL---IEEL
YAP4_YEAST/235-294----------------------------GKPLRNTKRAAQNRSAQKAFRQRREKYIKNLEEKSKLFDGLMK..---..EN

PF07716

Q7PSQ9_ANOGA/217-270----------------------------GTDEYRRRRE.RNNIAVRKSREKAKVRSREVEEKVKTLLKEKDVL...IRKI
Q7SHF0_NEUCR/119-173----------------------------EKEQRRVERVLRNRRAAQSSRERKRLEVEGLERRNKELETLLMQA...QQIN
NFIL3_HUMAN/72-125----------------------------KDAMYWEKRR.KNNEAAKRSREKRRLNDLVLENKLIALGEENATL...KAEL
Q7QG95_ANOGA/75-129----------------------------TWEEKIQRKKLKNRVAAQTSRDRKKAKMEEMEKTIQEQSEQIEQL...QNRC
Q7PYD2_ANOGA/449-502----------------------------KDSAYYERRK.KNNAAAKKSRDRRRIKEDEIAIRAAFLERENIEL...KFEL
Q7ZW50_DANRE/200-253----------------------------HSPEYRQRRE.RNNIAVRKSRDKAKQRNLDMQQKMIELGAENERL...HKTI
Q7Q787_ANOGA/12-65----------------------------EDDEYRRKRD.RNNQAVKRSRVKSKMKTEETQQRVNDLRLKNQLL...EDKI
CEBP_DROVI/364-417----------------------------GTEEYRRRRE.RNNIAVRKSREKAKVRSKEVEERVKSLLKEKDAL...LRQL
CEBPA_BOVIN/276-329----------------------------NSNEYRVRRE.RNNIAVRKSRDKAKQRNVETQQKVLELTSDNDRL...RKRV
O18660_DROME/238-291----------------------------KDESYWDRRR.RNNEAAKRSREKRRYNDMVLEQRVIELTKENHVL...KAQL
Q8SB38_ORYSA/91-148----------------------------TENNASKKRPSGNRAAVRKYREKKKAHTASLEEEVVHLRALNQQLMKKLQNH
Q9NAE4_CAEEL/102-155----------------------------KDEAYLDRRR.RNNEAARKSRESRKKVDQDNSVRVTYLERENQCL...RVYV
CEBPD_BOVIN/177-230----------------------------GSPEYRQRRE.RNNIAVRKSRDKAKRRNQEMQQKLVELSAENEKL...QQRV
CEBPG_RAT/61-114----------------------------NSDEYRQRRE.RNNMAVKKSRLKSKQKAQDTLQRVNQLKEENERL...EAKI
CES2_CAEEL/115-168----------------------------KDSAYFERRR.KNNDAAKRSRDARRQKEEQIASKAHALERENMQL...RGKV
CYS3_NEUCR/98-151----------------------------RLAAEEDKRK.RNTAASARFRIKKKQREQALEKSAKEMSEKVTQL...EGRI
Q8MY13_CRAGI/189-242----------------------------KDQKYWSRRK.KNNVAAKRSREARRIKENQIALRAAYLEKENSTL...KDEL
ZIP1_SCHPO/263-316----------------------------RTAAEEDKRR.RNTAASARFRIKKKLKEQQLERTAKELTEKVAIL...ETRV
Q98TD6_PAROL/194-247----------------------------DSVEYRQRRE.RNNIAVRKSRDKARRRILLTQQRAMQLQEENQKL...QLRI
Q90ZW4_DANRE/96-149----------------------------DSAEYRQRRE.RNNIAVRKSRDKARRRIQMTQQRALQLQDENHRL...QVHI
Q8GTS2_ARATH/72-129----------------------------TSESSGKKRPLGNREAVRKYREKKKAKAASLEDEVMRLKAVNNQLLKRLQGQ
Q9M2Y2_ARATH/67-121----------------------------NTDERKKKRKLSNRESAKRSREKKQKHLEEMSIQLNQLKIQNQEL...KNQL
Q21148_CAEEL/241-294----------------------------SSSDYRHKRD.KNNLASQKSRQKRQAKIRESKEERERLEKRKVQL...QAMV
CEBPE_HUMAN/203-256----------------------------DSLEYRLRRE.RNNIAVRKSRDKAKRRILETQQKVLEYMAENERL...RSRV
VGA2_ALHV1/23-77----------------------------LTEEQKERRRSINRRASKNFLKRRRIFEEQQEKGLINLKYENSRL...RCQV
O16213_CAEEL/115-168----------------------------KDVAYWERRR.KNNDAAKRSRDQRRMKEDEMAHRATSLERENMLL...RVEL
Q7KKI2_DROME/203-256----------------------------KDDKYWARRR.KNNIAAKRSRDARRQKENQIAMRARYLEKENATL...HQEV
Q17801_CAEEL/340-397----------------------------QPDERRNTILERNKAAAVRYRKRKKEEHDDMMGRVQAMEAEKNQLLAIQTQN
CRBL2_HUMAN/24-75----------------------------IDLKAKLERS...RQSARECRARKKLRYQYLEELVSSRERAICAL...REEL
Q9XUK2_CAEEL/241-295----------------------------SPEEILRRKRIQNNLAAARYRKRQREARESAESELGDLTRRNDEL...RDQV
MET28_YEAST/103-157----------------------------ELDKIKQERRRKNTEASQRFRIRKKQKNFENMNKLQNLNTQINKL...RDRI
Q8GTS1_ARATH/92-149----------------------------HSDSSNKKRLCGNREAVRKYREKKKARTAYLEDEVMRLQSLNEQFLRKLQSQ
O70192_MOUSE/52-105----------------------------LSDEYKMRRE.RNNIAVRKSRDKAKMRNLETQHKVLELTAENERL...QKKV
DBP_HUMAN/254-307----------------------------KDEKYWSRRY.KNNEAAKRSRDARRLKENQISVRAAFLEKENALL...RQEV
HLF_HUMAN/224-277----------------------------KDDKYWARRR.KNNMAAKRSRDARRLKENQIAIRASFLEKENSAL...RQEV
YLX9_CAEEL/64-117----------------------------RSPKYLEKRM.KNNEAAKKSRASRKHREQKNQTENELLKRKNAAL...EEEL
Q23272_CAEEL/418-472----------------------------SVDEETDRRRMLNRIAAVRYREKKRAEKKGRKMEFQEVADRNRIL...LQKE
Q9Y8B4_EMEND/186-239----------------------------RIAADEDKRR.RNTAASARFRVKKKMREQALEKTVKDTTEKNAAL...EARV
Q9LEZ2_ARATH/426-480----------------------------TDEEKRLRRMASNRESARRTRMRERMMKEGLQMQVKQLMAYNQFL...YNKY
Q91295_LITCT/203-256----------------------------FSPEYRQRRE.RNNIAVRKSRDKAKKRNMDMQQKLLELSSENEKL...HKRI
HAC1_EMENI/85-139----------------------------EKEQRRIERVLRNRAAAQTSRERKRLEMEKLESEKIDMEQQNQFL...LQRL
GIANT_DROME/383-436----------------------------KDAAYYERRR.KNNAAAKKSRDRRRIKEDEIAIRAAYLERQNIEL...LCQI
Q9VTE8_DROME/24-77----------------------------DDPAYKEKRK.KNNEAVQRTREKTKKSAEERKKRIDDLRKQNDAL...KVQI
A8BWY2_GIAIC/48-102----------------------------KPDLDTDKRKENGRLAAKRYRERVKEDQILLKEDLQKLREDNLRL...REEN
Q91654_XENLA/87-140----------------------------KDDSYWDKRR.KNNEAAKRSREKRRAGDLVLEGRIIALLEENARL...RAEL
Q9SKF8_ARATH/146-200----------------------------ALDPKEVRRILKNRESAAHLKQKKLQYMINLEHRINFVENENASI...FEKI
Q8IG69_CAEEL/16-69----------------------------DEDDYSTKRK.RNNEAVNRTRQKKRQEENDTAEKVDELKKENETL...ERKV
Q9SKG1_ARATH/114-168----------------------------VSDPKKVRRILKNRELAASSKQRKLKYMIDLEHRIKFLENKNALI...FEKI

PF03131

MAF_RAT/257-348FSDEQLVTMSVRELNRQL...RGVSKEEVIRLKQKRRTLKNRGYAQSCRFKRVQQRHVLESEKNQLLQQVDHL---KQEI
MAFF_MOUSE/24-115LSDEALMGLSVRELNRNL...RGLSAEEVTRLKQRRRTLKNRGYAASCRVKRVCQKEELQKQKSELEREVDKL---AREN
Q7JS61_DROME/395-486LNDDMLTTLTVRELNKRL...HGCPREEVVRLKQKRRTLKNRGYAQNCRSKRLHQRHELEKANRVLNQDLHRL---KLEY
E9G1H7_DAPPU/567-660MTVDDIINLPMDEFNERLSK.YDLTEPQLSLIRDIRRRGKNKVAAQNCRKRKLDQILTLADEVKRARERKIRL---NKER
Q98UK2_DANRE/204-295FSDQQLVSMSVRELNRHL...RGMSKDDIIRLKQKRRTLKNRGYAQSCRHKRVQQKHLLEHEKTSLATQVEQL---KHEL
F2TX64_SALS5/1136-1228WP.EEWLNMKVVDFNRFAKS.KRLTPDEIEDLKRARRRKKNRLYAKRSRQRKTQKLEDTLTKYEELQRTLSPG---ANTG
A9V7C3_MONBE/3089-3180YSDEEIASLSLQDFRRLL...EHETSEQQAELRKRRRRTQNRSAAKTSALRRKTNSLSTHAKLAKFEEENRSL---QQQL
Q6IRI7_RAT/24-115LSDDELVSMSVRELNQHL...RGLTKEEVTRLKQRRRTLKNRGYAASCRIKRVTQKEELERQRVELQQEVEKL---AREN
NRL_HUMAN/132-223FSDAALVSMSVRELNRQL...RGCGRDEALRLKQRRRTLKNRGYAQACRSKRLQQRRGLEAERARLAAQLDAL---RAEV
Q7PRH4_ANOGA/36-129ISDDELVSITVRDLNRTLKM.RGLTREEIVRMKQRRRTLKNRGYAASCRIKRIEQKDELETEKSQEWRDMELM---HEET
Q7T3H0_DANRE/24-115LSDSELMSLSVRELNMHL...RGLSREEVQKLKQRRRTLKNRGYAASCRVKRVSQREALEQQKKELQQEVERL---GAEN
A9V799_MONBE/43-135VT.EEILAAERAEFRRFLAQ.DRWTEEQRIQIKQLRRRRQNSFYARRNRRRQLSDTNGDASFDSYASPSQNLT---VQQL
F2U6C8_SALS5/589-679WD.EHLLTMPRAEFVHFTRTNKHLTADQLQDLRQTRRRMKNRLYQKDARDRRFIR...VARERELTRHQLQAS---VRRL
Q9PUA5_XENLA/150-241FSDEQLVGMSVRELNRQL...RGFSKEEALRLKQRRRTLKNRGYAQSCRYKRVQQRHVLETEKCHLSRQLQQL---QQEV
C4LUT9_ENTHI/97-180LSEEDLSSMTVEEF...........EDYVNELKDRRTITKSEKATLNKIKRKLKNKESARKSRQKSKEAFLNL---QQQL

PF00170

CREM_HUMAN/300-359ETLKDICS....PKT---
BZLF1_EBVB9/170-230LLLKQMCPSLDVDSI---
GCN4_YEAST/223-279YHLENEVARLKKLVG---
TAF1_TOBAC/192-255NKLMENSEKLKLENA---
JUNB_HUMAN/266-329GLLREQVAQLKQKVM---
HBP1A_WHEAT/250-313DRIKKEYEELLSKNT---
GBF3_ARATH/257-320NQLNEKSDKLRGANA---
GBF1_ARATH/220-283QRLSSECDKLKSENN---
CREBA_DROME/439-502EGLEETNANLLSQLH---
CPC1_NEUCR/214-270DRWKNLALAHGASTE---
GBF2_ARATH/247-310GQLNNESEKLRLENE---
ATF4_HUMAN/276-339DSLAKEIQYLKDLIE---
GBF4_ARATH/185-248EESTKERYKKLMEVL---
JRA_DROME/210-273KNLKDHVAQLKQQVM---
CPRF1_PETCR/267-330NRLTLTAEKLTNDNS---
ATF1_HUMAN/211-270KTLKDLYS....NKS---
JUN_CHICK/233-296NMLREQVAQLKQKVM---
CPRF3_PETCR/194-257QRISEACAEVTSENH---
ACA1_YEAST/382-445ENYEKLVQKMKKISR---
EMBP1_WHEAT/248-311DQLKKDCKTMETENK---
CREB1_BOVIN/265-324KALKDLYC....HKS---
YAP4_YEAST/235-294SELKKMIESLKSKLK---

PF07716

Q7PSQ9_ANOGA/217-270EEKNNE------------
Q7SHF0_NEUCR/119-173QTLLQA------------
NFIL3_HUMAN/72-125LSLKLK------------
Q7QG95_ANOGA/75-129SALDTE------------
Q7PYD2_ANOGA/449-502AAARKQ------------
Q7ZW50_DANRE/200-253DQLTRE------------
Q7Q787_ANOGA/12-65DNQKKE------------
CEBP_DROVI/364-417SEMTNE------------
CEBPA_BOVIN/276-329EQLSRE------------
O18660_DROME/238-291DAIRDK------------
Q8SB38_ORYSA/91-148ATLEAE------------
Q9NAE4_CAEEL/102-155QQLQLQ------------
CEBPD_BOVIN/177-230EQLTRD------------
CEBPG_RAT/61-114KLLTKE------------
CES2_CAEEL/115-168SSLEQE------------
CYS3_NEUCR/98-151QALETE------------
Q8MY13_CRAGI/189-242KNLKLE------------
ZIP1_SCHPO/263-316RELEME------------
Q98TD6_PAROL/194-247GQLTQE------------
Q90ZW4_DANRE/96-149QRLLHE------------
Q8GTS2_ARATH/72-129AALEAE------------
Q9M2Y2_ARATH/67-121RSSNCA------------
Q21148_CAEEL/241-294LTLETQ------------
CEBPE_HUMAN/203-256EQLTQE------------
VGA2_ALHV1/23-77EKRKDE------------
O16213_CAEEL/115-168DQLRAE------------
Q7KKI2_DROME/203-256EQLKQE------------
Q17801_CAEEL/340-397QVLRRE------------
CRBL2_HUMAN/24-75EMYKQW------------
Q9XUK2_CAEEL/241-295SRMERE------------
MET28_YEAST/103-157EQLNKE------------
Q8GTS1_ARATH/92-149EMVETE------------
O70192_MOUSE/52-105EQLSRE------------
DBP_HUMAN/254-307VAVRQE------------
HLF_HUMAN/224-277ADLRKE------------
YLX9_CAEEL/64-117KQAKCE------------
Q23272_CAEEL/418-472RQLKRE------------
Q9Y8B4_EMEND/186-239TALELE------------
Q9LEZ2_ARATH/426-480ISLLEY------------
Q91295_LITCT/203-256DMLTRD------------
HAC1_EMENI/85-139AQMEAE------------
GIANT_DROME/383-436DALKVQ------------
Q9VTE8_DROME/24-77ETSEKH------------
A8BWY2_GIAIC/48-102AALQKI------------
Q91654_XENLA/87-140LALRFR------------
Q9SKF8_ARATH/146-200KLLEND------------
Q8IG69_CAEEL/16-69EQLQKE------------
Q9SKG1_ARATH/114-168KLLEKD------------

PF03131

MAF_RAT/257-348SRLVRERDAYKEKYEKLV
MAFF_MOUSE/24-115AAMRLELDALRGKCEALQ
Q7JS61_DROME/395-486SRVCQERDALMQRLQRAA
E9G1H7_DAPPU/567-660EFLSAEKTRIKDRFAQLY
Q98UK2_DANRE/204-295GRLVRERDAYKLKCERLV
F2TX64_SALS5/1136-1228TVHHHSTDAPGGGGGGGG
A9V7C3_MONBE/3089-3180SLARQEKEDLLLANRILR
Q6IRI7_RAT/24-115SSMRLELDALRSKYEALQ
NRL_HUMAN/132-223ARLARERDLYKARCDRLT
Q7PRH4_ANOGA/36-129GRLQEENDSLRNKYEALR
Q7T3H0_DANRE/24-115AGMRRELEGLGARLAALQ
A9V799_MONBE/43-135QLQQQQQQQQQQQQQQMH
F2U6C8_SALS5/589-679SARCLRLEAIIRAHCPEQ
Q9PUA5_XENLA/150-241ARITRERDGWRARYEKLL
C4LUT9_ENTHI/97-180DELRKQYDDVLRINCQLI

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window