Sequence alignment for CL0040

PF00587

SYG_YEAST/76-406------------------------FQ-NNIIDAWRKHFI..LEE-D---MLEVD-CTMLTP-Y--EVLKT.S-----GHV
SYP_ZYMMO/49-218------------------------VL-RRIEKIIREEQA...RA-G---ALELL-MPTLQT-A--DLWRE.S-----GRY
SYTM_SCHPO/78-251------------------------IY-NRLVDFLRAQYQ...IH-G---FEEII-TPLIFK-K--DLWEK.S-----GHW
SYSM_SCHPO/220-399------------------------LE-MAITNYAMDFAI...SK-G---WCPVI-PPTIVR-T--DIALA.C-----GFQ
SYG_HUMAN/157-453------------------------LK-NNIIQTWRQHFI..QEE-Q---ILEID-CTMLTP-E--PVLKT.S-----GHV
SYT2_BACSU/275-439------------------------VR-NELERFSRELQT...NA-G---YDEVR-TPFMMN-Q--RLWEQ.S-----GHW
SYS_AERPE/198-368------------------------LD-LALLMYAIDFMT..SK.-G---YVLVL-PPYMLR-Y--NVMSR.V-----.ID
SYT1_AERPE/51-229------------------------IR-YALAEVLAKFHA...RR-G---YYVVE-TPIIAS-T--ELFKV.S-----GHI
SYH_ECOLI/21-188------------------------IW-QRIEGTLKNVLG...SY-G---YSEIR-LPIVEQ-T--PLFKRAI-----GEV
SYH_STREQ/19-188------------------------KW-QYVEGVARETFK...QY-H---YGEIR-TPMFEH-Y--EVISRSV-----GDT
SYH_ORYSJ/369-529------------------------IR-EHAFSIITGVFK...MH-G---AVSLD-TPVFEL-R--ETLMGKY-----GE.
SYP_SYNY3/49-222------------------------VL-EKVKRIVQEEMN...RT-G---AQECL-LPQLQP-S--ELWKM.S-----GRW
SYG_THET8/42-301------------------------LK-NNLKQAWWRRNV.YERD-D---MEGLD-ASVLTH-R--LVLHY.S-----GHE
SYH_HAEIN/21-187------------------------LW-QWIEAQVRNVLN...SY-G---YSEVR-MPIVES-T--PLFARAI-----GEV
SYSC_HUMAN/203-386------------------------LE-QALIQYALRTLG...SR-G---YIPIY-TPFFMR-K--EVMQE.V-----.AQ
SYG_DEIRA/42-302------------------------LK-NNIKAAWWRSNV.YERD-D---MEGLD-ASIIMH-R--MVLRH.S-----GHE
SYH_PORPU/20-187------------------------YW-QFIHEKVASLLK...YA-N---YKEIK-TPIFEN-S--DLYDRGI-----GEN
SYP_HELPJ/49-219------------------------VL-DKIENVTHKRMQ..EH.-G---AQNIL-MSFVVL-A--SLWEK.S-----GRL
SYPC_CANAX/59-225------------------------IQ-NKISQIIRQRMD...EI-Q---FEEVS-LSLISH-K--ELWKL.T-----NRW
SYSM_YEAST/191-366------------------------LE-QALVAYALKKAN..EN.-G---FSSCV-PPSITK-K--ELIDA.C-----GFN
SYP_AQUAE/49-219------------------------VL-KKVESIIRKEMD..RS.-G---AQELL-LTVLNP-K--ELWEE.T-----GRW
SYG_CAEEL/167-463------------------------LK-ANMLQEWRKHFI..LEE-G---MLEVD-CTSLTP-E--PVLKA.S-----GHV
O94025_CANAX/62-240------------------------IL-NKLIQFMKNQQT...KY-G---FQEVV-TPLIFK-T--KLWKK.S-----GHW
SYTM_YEAST/68-246------------------------IF-NKLIEFMKLQQK..FKF-G---FNEVV-TPLIYK-K--TLWEK.S-----GHW
SYS_COXBU/172-344------------------------AH-RALAQFMLDLHT..DQH-G---YEEVY-VPYLVH-E--ECLYG.T-----.GQ
SYS_BUCAP/172-346------------------------LH-RALSQFMLDLHT..IKH-G---YTETY-VPYLVN-H--DSLYG.T-----.GQ
SYS_HALMA/177-355------------------------LE-HALIQFMLDVHR..EQ.-E---YVDVL-PPIPVN-S--DSMEG.T-----.GQ
SYH_METJA/21-183------------------------KR-RFVENKLREVFE...RY-G---YKEIL-TPTFES-F--ELIAKKT-----GEE
SYPM_HUMAN/97-268------------------------AM-EKLVRVIDQEMQ...AI-G---GQKVN-MPSLSP-A--ELWQA.T-----NRW
SYT_HELPY/249-413------------------------LR-KRIEDLLSQALL...LR-G---YEPVK-GPEILK-S--DVWKI.S-----GHY
SYP_RICPR/49-219------------------------VL-KNIENVVRSNMN..KV.-G---ALEVL-MPCIQP-A--HLWIE.S-----GRF
SYS_THEMA/175-346------------------------LE-RALINFMLDVHT..KEH-G---YTEVW-VPHLVK-R--ETITI.T-----.GQ
SYS_BORBU/171-341------------------------LE-IALINFSLNKLR..DK.-G---FDVFI-TPDVAR-E--FIVDG.I-----GFN
SYS_BACSU/173-344------------------------LE-RALYNFMLDLHV..DEY-N---YTEVI-PPYMVN-R--ASMTG.T-----.GQ
SYT_METTH/225-383------------------------IR-DLLADYVYMLVT...SE-G---AMPVE-TPIMYD-L--EDEAI.R-----VHA
SYG_ARCFU/39-308------------------------LR-RKIENIWRKYFV..INE-R---AAEID-TPTIGI-E--EVFIA.S-----GHA
SYT_BORBU/216-382------------------------IR-ALIEDFWREEHS...KN-G---YDILF-TPHIGK-S--WLWQT.S-----GHL
SYH_MYCPN/20-187------------------------YF-NWTVHQITNLAW...KW-G---FSEVK-TPLLEY-A--EAFKR.T-----NAN
SYT_AQUAE/274-440------------------------YR-KVLEDYLREEHL...KR-G---YQLVY-TPHVGK-S--KLWET.S-----GHL
Q9VUK8_DROME/189-485------------------------LK-SNILALWRQYFA..LEE-Q---MLEVD-CSILTP-E--PVLKA.S-----GHV
SYH_ARCFU/19-179------------------------RR-REIEKRMRKIAE...SF-G---YREVA-TPTFEY-L--ELFTRKS-----GEG
SYH_YEAST/71-233------------------------IR-EAIFSTLSGLFK...KH-G---GVTID-TPVFEL-R--EILAGKY-----GE.
Q9VF85_DROME/153-322------------------------LE-QAIIQYALQAVT..EH.-G---FKLIS-VPDILP-K--EVIES.C-----GMR
SYH_STAAW/18-186------------------------KW-RYIENQLDELMT...FY-N---YKEIR-TPIFES-T--DLFARGV-----GDS
SYS_SYNY3/181-351------------------------LE-RALINFMLERHI...GV-G---YQEIM-PPILVN-S--DSLLG.T-----.GQ
O65395_ARATH/266-437------------------------LE-MALLNWTLSQVM..KK.-G---YTPLT-TPEIVR-S--SIVEK.C-----GFQ
SYT_CHLTR/267-432------------------------VW-NALVDYWKRLHQ...RA-G---YQQIQ-TPQLMN-R--ELWEI.S-----GHW
SYS_PYRHO/195-365------------------------LD-LALIRFALDRLI..EK.-G---FTPVI-PPYMVR-R--FVEEG.S-----.TS
SYG_METTH/42-319------------------------LK-NKIMNRWREFYV..VRE-G---FYEIE-SPTIMP-E--EALKA.S-----GHV
SYH_BACSU/19-187------------------------RW-QFVEQIMRDTCR...TY-Q---YKEIR-TPIFEH-T--ELFARGV-----GES
SYS_SULSO/195-365------------------------LD-FSLLLFAIDYIT..QQ.-G---YTLVL-PPYMLR-G--EVIQS.V-----.ID
SYS_STRCO/173-343------------------------LE-LALVNAAIAQAT..AA.-G---FTPML-TPALVR-P--QSMAG.T-----GF.
YHI0_YEAST/227-403------------------------IW-ENIQKWFDDKIK...AI-G---VQNAY-FPMFVS-S--RVLEKEK-----DHV
SYH_THET8/19-186------------------------MH-QRIVATARKVLE...AA-G---ALELV-TPIFEE-T--QVFEKGV-----GAA
SYT_PYRAB/237-399------------------------IK-SLLEQYVTEKVI...EY-G---AMEVE-TPIMYD-F--EHPAL.E-----KYL
SYT_METJA/228-387------------------------MR-DLLADYVYNLVV...NM-G---AMPVE-TPIMYD-L--GNPAI.R-----EHA
SYP_MYCTU/51-221------------------------VL-RNIERVIRDEMN..AI.-G---GQEIL-FPALLP-R--APYET.T-----NRW
SYH_AQUAE/19-186------------------------KF-RKISDTARKILK...LY-N---FEEII-LPVVEY-A--ELFQRSV-----GET
SYTC_YEAST/359-523------------------------IY-NTLVDLLRTEYR...KR-G---YEEVI-TPNMYN-S--KLWET.S-----GHW
SYH_DEIRA/28-196------------------------AH-EWLIAQAREVLE...RA-G---AQRID-TPMFEE-A--ELVKRGV-----GGS
SYS_MYCPN/169-338------------------------LL-RAIASLMIDLNK..N..-K---YQEWN-VPVIVN-E--TSLTG.T-----.GQ
SYP_BACSU/49-219------------------------VI-QNIQQIVREEME..KI.-D---AVEML-MPALQQ-A--ETWQE.S-----GRW
SYT_SYNY3/228-403------------------------IR-TILEDFLKQEQI...KR-G---YLPVV-TPHIAR-V--DLFKQ.S-----GHW
SYT_THEMA/271-435------------------------VL-NELMKFSRELHR...ER-G---YQEIF-TPLIMN-E--QLWKI.S-----GHW
SYP_TREPA/47-217------------------------VR-HKIEAIIREELE..AI.-G---CLECT-APVVTP-A--ELWKE.S-----GRW
SYHM_HUMAN/73-235------------------------VR-EKILDLVISCFK...RH-G---AKGMD-TPAFEL-K--ETLTEKY-----GE.
SYT_RICPR/272-437------------------------IY-NTIEQYIRKKIR...KN-G---YIEVK-TPVLVD-K--SLWEA.S-----GHW
SYP_ECOLI/49-219------------------------VL-KKVENIVREEMN..NA.-G---AIEVS-MPVVQP-A--DLWQE.S-----GRW
SYS_ARATH/179-353------------------------LN-QALINFGLTFLK..KR.-G---FTGLQ-PPFFMR-K--DVMAK.C-----.AQ
SYP_CHLTR/49-221------------------------VI-LKMTEIIREELN..AI.-G---GQEVC-LPLLQP-A--ELWEK.T-----GRW
SYG_AERPE/42-324------------------------LK-RRIIEKWRRYFVLMHQD-H---VVEIE-TPVIGP-E--KVYIA.S-----GHV
SYH_CHLPN/28-193------------------------LW-HSVEKAIHTVCM...LY-G---FCEIR-TPIFEK-S--EVFLH.V-----GEE
SYT_HAEIN/273-438------------------------IF-RELETFVRTKLK...QY-D---YQEVK-GPFMMD-R--VLWEK.T-----GHW
SYH_TREPA/25-187------------------------ER-ALLVEKLTVALR...QM-G---FVPID-TPALEY-T--EVLLRKS-----EGD
SYH_RICPR/21-188------------------------IH-NYIINKARDVGA...LY-G---YKQMS-TPILEY-T--KVFNRSM-----GES
SYS_ARCFU/192-362------------------------LD-FALTMYALDFLR..KE.-D---FTIVS-PPYMMR-R--EAYSG.V-----.TA
O45869_CAEEL/49-223------------------------VI-DKLCRILDVEFQ..NS.-G---ALKIA-MPIVGT-Q--QLWEK.T-----GRW
SYS_HELPJ/174-344------------------------IY-RALIHLMLDFNE...KN-G---FEIIY-TPALVN-E--KMLFG.T-----.GQ
SYH_SCHPO/79-242------------------------LR-EHIFSTVTEIFK...RH-G---GVTLD-TPVFEL-K--EILSGKY-----GE.
SYG2_YEAST/45-343------------------------LQ-NNLIRLWREHFI..MEE-N---MLQVD-GPMLTP-Y--DVLKT.S-----GHV
SYHC_HUMAN/72-234------------------------VR-EKVFDVIIRCFK...RH-G---AEVID-TPVFEL-K--ETLMGKY-----GE.
SYT_MYCLE/310-489------------------------VR-REMEEYSRRKHI...EA-G---YQFVN-TPHITK-A--QLFHT.S-----GHL
SYS_THET2/168-340------------------------YE-LALLRFAMDFMA..RR.-G---FLPMT-LPSYAR-E--KAFLG.T-----.GH
SYP_THEMA/49-219------------------------VL-LKIENIVREEMN..RI.-G---AQEIL-MPILQP-A--ELWKQ.S-----GRW
SYT_DEIRA/279-448------------------------LR-EELTNFMKEQQF...QR-G---YQGVV-TPNIGN-L--DLYRT.S-----GHY
SYS_AQUAE/174-344------------------------LE-RALINFMLDLHT..KK.-G---YKEIC-PPHLVK-P--EILIG.T-----.GQ
SYT_ARCFU/227-389------------------------VK-TLLEQFITRKCI...DY-G---AMEVE-TPIMYD-R--NHPTL.R-----RYL
SYS_MYCTU/169-339------------------------LQ-LGLLQLALKLAV..DN.-G---FVPTI-PPVLVR-P--EVMVG.T-----GF.
SYG_MYCTU/45-278------------------------LK-ENIKRQWWRSVV.TGRD-D---VVGID-SSIILP-R--EVWVA.S-----GHV
SYTC_HUMAN/352-516------------------------IY-NALIEFIRSEYR...KR-G---FQEVV-TPNIFN-S--RLWMT.S-----GHW
SYT_MYCPN/198-368------------------------LK-KIIGDFVHYQQL...MF-G---FKTVS-SPVLAN-L--ELYKI.S-----GHY
SYPM_YEAST/56-225------------------------SL-NKVSNAIRNRMD..SDG-G---AIEVS-LSAISS-K--ALWQA.T-----DRW
SYH_MYCGE/20-187------------------------YF-NWIVKKIRSLAF...NW-G---FSEVK-TPLFEN-A--QLFQR.S-----NAN
SYH_THEMA/19-186------------------------YW-RYVEETFRNVCE...SA-G---IEEIR-TPIFEQ-T--ELFVRSV-----GEE
SYG_PYRAB/44-320------------------------IK-RKIEKKIREAFI...RE-G---FFEIE-TPDITP-E--QVFIA.S-----GHV
SYG_METJA/42-324------------------------LK-NNIISKFREQYI..IKE-G---FYEIE-SPTVTP-Y--EVLKA.S-----GHV
SYS_RICPR/171-341------------------------LE-RALINFMIDIHT..KEF-D---FFEIS-PPFLVR-D--RAMYN.A-----.GQ
SYH_METTH/19-182------------------------NR-KEVEGVLRRTFE...TY-G---YHEIK-TPIFEE-L--KLFTVKS-----GEE
SYH_MYCLE/30-193------------------------VR-DGLLTAAR.......RA-G---YGDIE-LPVFED-T--ALFARGV-----GES
SYS_DEIRA/170-342------------------------LE-MAVLMFALDFLS..QR.-G---FTPLS-TTALVR-R--ETLVN.S-----.GH
SYS_HAEIN/173-348------------------------MH-RALAQFMLDLHT..EQH-G---YLETY-VPYLVN-H--ATLYG.T-----.GQ
SYPM_SCHPO/54-224------------------------VQ-NKICDLLHISMR..SL.-G---ASAIS-LAHLSS-K--EIWEK.S-----GRW
SYT1_BACSU/276-446------------------------IR-RVIERYIVDKEI...SL-G---YEHVY-TPVLGS-K--ELYET.S-----GHW
SYT_TREPA/223-390------------------------LY-VAIQQYLRRVMH...ED-G---YAEVH-TPFVMP-Q--SLWER.S-----GHW
SYS_TREPA/171-342------------------------LE-QALIMFGLQFLQ..ER.-G---FVPFL-TPDIAR-E--GMVCG.L-----GFN
SYTM_ARATH/346-510------------------------VY-NRLMDFIKNQYW...HR-G---YTEVI-TPNMYN-M--ELWQT.S-----GHA
SYSC_SCHPO/179-353------------------------FN-LALIQYGLDFLE..KR.-G---YIALQ-APTMLN-K--DVMAK.T-----.AQ
SYS_STAA8/173-344------------------------LE-RALMNYMITKHT..TQH-G---YTEMM-VPQLVN-A--DTMYG.T-----.GQ
SYH_CHLTR/28-193------------------------LW-KRVEHAAHRICN...LY-G---FDEIR-TPVFEK-T--ETFLR.V-----GEY
O82413_ARATH/85-250------------------------LR-NWLFNHFKEVSR...LY-G---YEEVD-YPVLET-E--ALFIRKA-----GEE
SYS_CHLPN/172-344------------------------LE-WALLTYMLQKQA...AH-G---FQLWL-PPLLVK-K--EILFG.S-----.GQ
SYH_SYNY3/20-187------------------------YW-QWVEAIAKSILD...RA-L---YQEIR-TPIFEQ-T--SLFERGI-----GEA

PF13393

Q1K3M2_DESAC/22-332GVKDFLPL-------------NSVKI-EHLKSCLHDVFK---QW-G---FQPIT-PPSLEF-L..DVLEQGL.....GN.
B5JRM1_9GAMM/12-323GIEEILPE-------------RALEL-ESLRRQLLDLYH---SW-G---YDLVM-PPFIEF-L..ESLLGDL.....GK.
C0N861_9GAMM/12-325GIDELMPE-------------EASQL-EILHRSLVDRMR---SW-G---YQLVV-PPLVEY-L..DSLLTGT.....AK.
HISZ_PSEU5/12-321GIEEVLPP-------------EAARI-ETARRRVLDLFQ---RW-G---YELVI-TPHVEF-L..ESLLTGS.....GQ.
B0SA16_LEPBA/18-333GFHFLGPE-------------ESKNR-RNLLQSFSELFE---KE-G---YSEIT-LPSFDY-S..NSFRSQL.....QD.
HISZ_ANAD2/9-318GLRDLLPD-------------HSAHL-AELSSKLHDVFS---RF-G---YRRVF-LPTLER-L..DVVERGL.....SP.
HISZ_ALHEH/17-328GVDELLPP-------------RAAQM-ETLRRQLLDQFG---AW-G---YELVM-PPFIEY-L..DSLLTGT.....GH.
HISZ_MICAN/8-319GTRDLLPL-------------EVTQK-GWINDRLQSVFQ---RW-G---YQRIV-TSTIEW-L..DTLTAGG.....AI.
C8WUX4_ALIAD/25-356GMQDGYPD-------------FAKRR-RAVETRLLSFVE---DA-G---YEPVT-SGLFEY-V..DTLLRAR....SPE.
HISZ_THISH/12-323GIEEALPP-------------LAERL-ETCRRQLLDLYH---RW-G---YELVM-PPMIEY-L..ESLLTGT.....GS.
HISZ_ANADF/9-318GLRDLLPD-------------HSAHL-AELSAKLQEVFS---QF-G---YRRLF-LPTLER-L..DVVERGL.....SA.
Q2BIN1_9GAMM/12-324GVQELLPP-------------QARRV-ELLRRRLLDLYQ---HW-G---YEQVM-PPVLEH-L..ESLLTGV.....GR.
HISZ_HAHCH/12-320GVEELLPP-------------EATRI-EELRRQLLDLYH---SW-G---YEMIV-PPLLEF-L..DSLLIGV.....GR.
E6W5Z4_DESIS/15-323GFRASIGP-------------QARTI-FSLEKDMVDIFQ---SW-G---YQPIL-TPSLEY-E..DVIARAL.....DE.
C9YB19_9BURK/9-313HIADVLPS-------------EARHI-EEIRRDLLDMAR---CY-G---YELVM-PPMLEH-L..ESLLSGT.....GE.
C6XEF7_METSD/9-315YIEDVLPA-------------EAARM-EHLRRQLLDLFA---VH-G---YQFVI-PPLLEY-L..ESLITGV.....GH.
A1WUT1_HALHL/12-323GVDELLPP-------------EAAQA-EALRRRLLDLFD---SW-G---YELIM-PPFIEY-L..EALLTGT.....GR.
C4KMP4_BURPE/9-313NIADVLPS-------------EARKI-EELRRRLLDRFR---SY-G---YEMVM-PPLLEY-L..ESLLTSG.....GN.
HISZ_LARHH/9-314HIADILPA-------------TARQL-ESAKAAMLERFR---RY-G---YELVS-PPLIEY-T..DSLLTNA.....DP.
HISZ_METFK/9-315YIEDVLPA-------------EAARV-EQLRRSLLDLFK---VH-G---YLYVI-PPMMEY-M..ESLTTGI.....GH.
HISZ_RALME/10-314NIADVLPS-------------EARKI-EELRRRMLDLFR---TY-G---YELVM-PPMLEY-L..ESLLTGT.....GH.
B6C6F9_9GAMM/12-321GVGELLPI-------------EAEQM-ERARRVLIDLFH---SW-G---YDLVV-PPLIEY-L..ESLLTGV.....GT.
D5CRS6_SIDLE/8-314YIQDMLPE-------------EAWRI-EVMRRDVLELLR---RS-G---YQLVA-PPLLEY-V..ESLLISE.....SQ.
D0LNQ8_HALO1/14-324GVRDFLPR-------------ATARR-RSIAERLLGEFE---SW-G---YARII-TPLYEC-A..DVLERGL.....GV.
HISZ_CELJU/17-327GVEEILPG-------------EAKAI-DSLRRKLLDLYS---AW-G---YDMVI-PPLLEY-T..DSLLTGS.....GR.
HISZ_CHRSD/12-323GMDEVLPP-------------QATRM-EQLRRALLDLYD---RW-G---YDLVI-PPTVEF-L..DSLLTGT.....GT.
HISZ_TERTT/12-323GISELLPD-------------DALQV-ETLRRRLVDVFQ---RW-G---YEYVI-TPMIEF-T..DSLLTGS.....GG.
A0Y7Z9_9GAMM/12-323GVEELLPE-------------QAGQV-ESLRRKLLDLYQ---SW-G---YLLVI-PPLIEY-T..ESLLVGL.....GH.
Q0VMF2_ALCBS/13-322GVEEVLPG-------------RARAI-EQLRRQTLDLYQ---RW-G---YELVF-PPLIEF-M..ESLLNGG.....GR.
A3RVD4_RALSL/9-313SIADVLPS-------------EARKI-EELRRRMLDLFR---TY-G---YELVM-PPMLEY-I..ESLLSGT.....GH.
C6WV54_METML/9-315YIEDVLPA-------------EALRI-EVLRRKLLDLFK---VH-G---YQYVI-PPMLEY-M..ESLITGA.....GH.
B9Z696_9NEIS/9-315HIADILPA-------------TARQV-ESAKAAMLELFR---TA-G---YELVL-PPLIEY-A..DALVSEG.....DS.
HISZ_NITEU/9-320YIEDVLPR-------------DAYRI-EKIRRLIMDMLF---AH-G---YQFVM-PPLLEY-V..ESLLAGS.....GS.
A4BLP9_9GAMM/17-328GVDEILPP-------------QAFAL-ERLRRELLDCYY---RW-G---YDLVM-PPTIEY-L..EALLTGA.....AH.
HISZ_SACD2/12-323GIEEVLPE-------------EASRV-EGLRRRLVDLFQ---SW-G---YDYVI-PPMVEF-I..DSLLTGS.....GE.
Q1YRY2_9GAMM/12-321GVDEVLPE-------------RAQVV-EHLRRQLLDLYN---CW-G---YDLVI-PPMVEF-T..DSLLSGS.....GS.
HISZ_JANMA/9-313NIADVLPS-------------EARKI-EELRRVILDNFH---LY-G---YELVM-PPMLEY-L..DSLLAGA.....GH.
HISZ_METCA/17-328GIEELLPE-------------EAERL-ELLRRRVLDRFA---AW-G---YRLVM-PPLIEF-I..DSLLTGA.....GH.
HISZ_MARMS/12-324GVDEALPE-------------QAAKI-EHLRRTLLNLHE---SW-G---YHLVI-PPLLEY-L..DSLLTGA.....GS.
HISZ_POLNS/9-318DITDVMPA-------------EACKV-ESLRRAVLDLYQ---SY-G---YELVA-PPILEF-L..DSLLTGT.....GS.
HISZ_VARPS/9-317HIADVLPS-------------EARHI-EELRRQLLDTAR---GY-G---YELVM-PPLLEH-L..ESLLSGT.....GE.
B7RW37_9GAMM/12-322GIEEVLPA-------------QAATV-EQLRRRLLDMFR---SW-G---YELVI-PPLVEF-T..DSLLSGL.....GQ.
HISZ_NITMU/11-321YIEDILPA-------------EALKI-EMMRRRVLDWLF---VN-G---YELVG-PPLLEY-V..ESLLTGS.....GG.
D3RSK9_ALLVD/11-321GIEEVLPP-------------QARIV-EGLRRELLDLYA---SW-G---YELVI-PPFIDY-L..DSLLTGT.....GQ.
Q1N278_9GAMM/12-321GIEELLPP-------------EANKL-ETTRRTLLDTFH---RW-G---YELVV-PPQLEF-L..ESLLTGV.....GK.
HISZ_MARAV/12-322GVEDILPP-------------LAGRI-ESLRRDVMDTCQ---RW-G---YQLVI-PPLIEY-L..ESLFTGT.....GH.
HISZ_AROAE/8-312HIQDALPA-------------EADKI-ERLRRRLLDAFR---SH-G---YQLVV-PPLLEY-L..DSLTTGA.....GQ.
D1YNU9_9FIRM/9-314GFRDDIGI-------------VAERK-DDVSQYVLGLCR---NR-Q---YTKIS-TPLVEY-K..DVFNGYA.....MG.
C7RU27_ACCPU/8-312HIADALPL-------------EAAHI-ERLRRLLLDLFR---VH-G---YELVM-PPLLEH-L..ESLLTGS.....GQ.
A3YHH2_9GAMM/12-323GVDEALPE-------------QAEKI-EQLRRVLLNLHG---RW-G---YDLVI-PPLLEY-L..DSLLTGA.....GS.
D9SFI4_GALCS/9-316YIQDMLPV-------------EAWRV-EKMRAQVLDLLK---KS-G---YQLVA-PPLLEY-E..ESLLIAD.....SA.
HISZ_THICR/11-322GIEDLLPE-------------EAKKL-EFYRRQLLDGFE---LS-G---YDLVL-PPIAEF-T..DSLLTGK.....GR.
HISZ_DECAR/8-312YLADALPA-------------EAARI-ERLRRTVLDHFR---SR-G---FELVM-PPMLEY-L..ESLLTGA.....GQ.
HISZ_THIDA/9-313NVEDVLPP-------------QAWRL-EAMRRALLDLFR---ER-G---YQLVI-PPLIEY-V..ESLLTGV.....GA.
D3SBT1_THISK/12-326GLDEALPD-------------AARRL-EGLRRRVLDQFD---TW-G---YDLVM-PPLAEY-L..ESLLVGA.....GH.
HISZ_RHOFD/9-313HIADVLPS-------------EARHI-EELRRSLLDTAR---CY-G---YELVM-PPLLEH-L..ESLLTGA.....GA.
B8KW68_9GAMM/12-325GIDELLPE-------------RAATV-EALRRSLLDTCA---SW-G---YQYVI-PPLVEF-T..DSLLVGL.....GA.
A6GNJ9_9BURK/9-322SVADVLPS-------------EARRI-EELRRSLLDRFR---VY-G---YELVM-PPMLEY-T..ESLLGNA.....DA.
B7X1H5_COMTE/9-313HIADVLPS-------------EARHI-EELRRGLLDTAR---SY-G---YELVM-PPMLEY-L..ESLLTGT.....GE.
A0Z0R0_9GAMM/12-324GIDELLPE-------------RAASV-EALRRALLDDCA---RW-G---YRYVI-PPLVEF-T..DSLLVGL.....GA.
HISZ_ACIAC/9-313HIADVLPS-------------EARHI-EELRRGLIDTAR---GY-G---YELVM-PPMLEH-L..ESLLSGT.....GE.
B5EJB1_ACIF5/15-325GFEDVLPA-------------RTEAL-ERCRRALLDLYA---QW-G---YRQVI-PPLVEH-L..ESLLTGS.....AA.
A3EWA4_9BACT/25-339GVGPVFSR-------------IASFR-RETTARLLRLFS---LW-G---YTEIT-LPVFEY-L..DSLAPGL.....DP.
Q12AC8_POLSJ/13-319QIADVLPS-------------EARHI-EELRRLFLDTAR---SY-G---YELVM-PPLLEH-L..ESLLTGT.....GE.
HISZ_BORPA/9-316GLADVLPA-------------EARRI-EELRRELLDLYR---TY-G---FELVA-PPLVEY-I..DSLLSST.....GS.
HISZ_VEREI/9-313HIADVLPS-------------EARHI-EELRRGLLDTAR---CY-G---YELVM-PPLMEH-L..ESLLTGT.....GE.
HISZ_ACISJ/9-313HIADVLPS-------------EARHI-EELRRGLLDTAR---SY-G---YELVM-PPLLEH-L..ESLLTGT.....GE.
D4DMZ4_NEIEG/10-317YIADILPS-------------GARQL-ESAKEKLLALFR---SH-G---YELVH-PPLMEY-S..DSLLIHI.....DS.
A4A6K0_9GAMM/15-328GIDELLPE-------------AAAQV-EALRRTLLDCAS---RW-G---YRLVT-PPMVEF-T..DSLLVGV.....GE.
HISZ_AQUAE/8-290GERFYSLE-------------ESNLV-KEIFKKAVKIFE---AF-G---YDYIN-LSHFEP-Y..EFQELTF.....GE.
HISZ_THET2/5-297GTRFLLPP-------------EARLK-AEVVGKLQHLFR---RH-G---YEPVE-LPALEL-Y..DPDHPL.........
C1CVJ4_DEIDV/29-323GTRDVLPP-------------EWAQR-EHLRARLSALFR---GW-G---YRGVE-LPSLEF-A..DPAHP..........
Q1J099_DEIGD/30-328GTRDVLPP-------------EWAWR-EHLRTRLAGVFA---AW-G---YRGVE-VPALEF-A......SEA.....HP.
A6G000_9DELT/27-343GARDLLPT-------------TSRRR-RSNRERLLRVFE---GW-G---YREIT-PPLLEY-F..EVHARGL.....SA.
D0KVK0_HALNC/13-326GIDELLPE-------------QARRV-EQLRTALLHQFH---VA-G---YDLVI-PPLVEF-V..DSLLVGS.....GR.
A4BEB8_9GAMM/12-323GIEEILPP-------------QAARI-EALRRSLLDEYR---AW-G---YDLLQ-PPMAEY-L..ESLLTGV.....GH.
HISZ_DEIRA/31-328GVRDVLPA-------------EWERR-EHLRSHLSALLR---SW-G---YRGVD-LPALEL-A..DPAHPQG........
HISZ_LEPIC/17-331GFHFLGPE-------------DSKYR-RTLLETISGVLK---KK-G---YSEVF-LPAFDY-S..STFIQTV.....SAP
A3Z6V4_9SYNE/8-318GARDLNPQ-------------QVEHN-HRLRERLAAVYR---RW-G---YEEVA-PPRVER-L..DTLKAGG.....GI.
HISZ_PROMT/8-318GARDLNPQ-------------QVRKN-HLIASKLSSLYQ---LW-G---YERIS-PPHIER-L..DTLTAAG.....GI.
A2SHA5_METPP/10-318HIADVLPS-------------EARRI-EELRRTVLDAAR---VY-G---YELVM-PPLLEH-L..ESLLTGT.....GH.
C6NXF6_9GAMM/15-326GFEDLGPA-------------RAEAL-EKHRRALLDLFA---RW-G---YRLVI-PPMLEH-L..ESLLTGS.....AA.
Q067E0_9SYNE/8-318GARDLNPR-------------QVETN-RNLTERLARVFR---LW-G---YDEVS-PPRVER-M..KTLMAGG.....AI.
HISZ_PROM4/8-318GSKELNPR-------------QVEEN-NLLATKLSEIYK---KW-G---YQEVA-PPQVEG-L..KTLMAGG.....GI.
D0SC52_ACIJO/12-322GVADVLPE-------------QAQVI-ETLRRQALDFLA---TR-G---YQLVY-TPFIEY-I..ESLSSLS.....ES.
HISZ_SYNPX/8-318GARDLNPR-------------QVESN-RALSERLASVFR---LW-G---YDEVS-PPRVER-L..DTLMAGG.....AI.
HISZ_BORA1/9-316GLADVLPA-------------EARRI-EELRRELLDLYR---TY-G---FELVA-PPLVEY-I..DSLLSGM.....GG.
B1XXK3_LEPCP/10-318HIADVLPH-------------EARRI-EELRRIMLDAAR---TC-G---YELVM-PPLLEY-I..ESLLSGT.....GH.
B5IJM2_9CHRO/8-318GARDLNPR-------------EVERN-RRICADLAAVYR---RW-G---YQEVA-PPGFER-L..DTLAAGG.....GI.
D0CJ76_9SYNE/8-318GAKDLNPR-------------QVETN-RQLTERLASVYR---LW-G---YDEVS-PPRVER-L..ATLMAGG.....AI.
B0VFH4_CLOAI/7-312SFHEFMPD-------------KVWKW-KILEEKVEKVLS---LH-D---FQEIR-LSVLQD-S..QVLQDGITALIQGQ.
B6BTN9_9PROT/10-316KVEDLYPQ-------------KALEL-EKNRRVLVDFFL---KN-K---FELIS-PAMIEY-A..DNVSFNG.....KS.
HISZ_PSYA2/5-314GVADVLFE-------------DAHKQ-EVLRHQLTQQLI---TH-G---YQLVS-PPMIEF-T..ESLLSGA.....SE.
HISZ_SYNR3/8-318GARDLLPR-------------DVGVN-RWIAEQLAAVYQ---RW-G---YEEVT-PPSLER-I..DTLEAGG.....AI.
A5WGG0_PSYWF/34-354GVSDLLSE-------------EAQKQ-EWLRYKLTRLLV---SR-G---YELIC-PPMIEF-T..ESLLGNA.....SE.
D1KE67_9GAMM/9-315GIDELTGA-------------EALAF-EFVRRQLLDLYA---DK-G---FGLVI-PPMVEY-V..KSLLLTS.....DS.
Q0IAC0_SYNS3/25-335GARDLNPK-------------QVQQN-QYLREQLATVYR---HW-G---YDEVS-PPQVER-L..DTLIAGG.....AI.
D3P4X4_AZOS1/14-318GLHDVLPS-------------EAAHE-AAAVERLLAEFA---AQ-G---YRRVD-PPLVEF-E..ENLLSGA.....GA.
A8TQZ8_9PROT/17-319GLRDILPP-------------SAGNE-ARLIELLVARTV---AH-G---YERVK-PPLIEF-E..TSLLEGP.....GAA
D2Z2L9_9BACT/13-312GCRSTGGR-------------MAIAM-ERCRHRFISLFN---RH-G---YRLFW-SSGLQL-L..ETSWDLL.....PR.
B1X3U7_PAUCH/8-318GSRDLNPQ-------------QVEIN-HRLCEKLAAVYK---LW-G---YQEVS-PPRVER-L..ATLLAGG.....AI.
C7JCL4_ACEP3/27-328GFVDFLTP-------------DARTE-AEGVATLMDVFA---SH-G---YDRVR-PPLIEF-E..DTYLAGA.....GA.
Q0BTV8_GRABC/14-327GLRDLLPP-------------EAEAE-AVCVATLMGVFS---AH-G---YRRVK-PPLIEF-E..ETLFAGA....GGA.
HISZ_RHOCS/16-317GLRDLLPP-------------DAEHE-ARVVGRLMKEFT---RH-G---YERVK-PPLIEF-E..EGLLSGP.....GR.
D3L2N6_9BACT/7-310GCKNVGGD-------------VALNV-EELRRDFMEAFV---PY-G---YRPFW-PSGLQL-L..EAITDKI.....SP.
A9HLQ2_GLUDA/27-327GFVDLLPS-------------DAEAE-AAGMEDLMRVFA---TH-G---YSRVK-PPLLEF-E..DTLLSGS.....GA.
HISZ_RHORT/16-319GLRDVLPP-------------DAAFE-VATVERLVSVFA---AN-G---YERVK-TPLIEF-E..EGLLTGA.....SR.
C8PZK1_9GAMM/30-351GVVDLLST-------------EAVKQ-ETLRYQLTRILI---SH-G---YEFIS-PPMIEY-T..ESLLGYA.....SE.
D3DJN8_HYDTT/9-286EERFFSFE-------------DSEKL-KNSFLVACEVLK---DY-.---.RFVI-LPTVEK-YQPEL....Y.....TD.
Q2G4V6_NOVAD/12-320GLEDRLPR-------------DAATA-TRVMRAIHGVMH---GH-G---YDRVM-PPSIEY-E..RSFAARM....AGI.
C8WED5_ZYMMN/11-310GLRDRLPP-------------QAEAA-SRLLHHVIVAIN---RH-G---YERVS-PPLAEF-E..ESLLGRL.....KS.
D3SMU8_THEAH/10-286GERFFNFE-------------DSRKL-KESFLVACRVFE---D.-.---FQFIM-LPTIEN-YQPEYYEGFG........
Q5UF78_9PROT/11-312GTEDFVGV-------------KAEEL-EKLRSLFLNFFY---KN-N---CELVV-PSLIEF-S..EIIGGNF.....NE.
A5VFF4_SPHWW/22-321GLRDRLPP-------------QAEAG-SRLLHRVIVAIG---RH-G---YARVS-PPLAEF-E..EGLVGQL.....KS.
C4L169_EXISA/13-302GWYELQSG-------------DVIRP-KRWMLSFLEKAE---SS-G---YAVID-PPLLEY-Y..SHYQNLA.....LF.
Q1NEW5_9SPHN/12-315GLSDRLPP-------------QAEAS-ARLVRRVLDTVA---TH-G---YERVM-PPLAEF-E..DTLTQRL.....TS.
Q2NCV4_ERYLH/16-312GLEDRLPA-------------EARKA-THAMRAALGAMD---SH-G---YDRVR-PPLIEF-E..RSLAGRM....DGV.
A3W9X6_9SPHN/22-321GLEDRLPA-------------SAARI-TAAMRACLDALG---SH-G---YDRVR-PPLLEF-E..TALAARM....EGV.
A5PDB1_9SPHN/11-307GLEDALPV-------------RASTI-TRTMRDILLAMD---SH-G---YDRVR-PPLIEF-E..QSLAGRM....EGV.
Q1GVI6_SPHAL/11-307GLRDRLPR-------------QAEAA-SRVTRALVDAMR---AH-G---YGRVS-PPLAEF-R..ETLGSDD.....DR.
A6Q5H3_NITSB/10-275GARLYFGQ-------------TAKIK-RDIEKIASEILY---EE-G---FEEIA-TPLFSY-H..Q..HKFI......A.
A7I327_CAMHC/12-273GSRLYFGK-------------SAQIK-RKIENTASEILL---KN-G---FNEIL-TPYFSY-H..QNLSV..........
HISZ_WOLSU/12-276GSQLYFGK-------------SARLK-RRIEERASQILY---TA-G---FEEII-TPSFSF-L..EHQRDT.........
A5LME0_STRPN/14-307GFFDLDEM-------------QFKKY-CDIENHLRSIAS---IN-G---FELIK-VSSAVY-S..RLNE.YT.....HA.
A8ER44_ARCB4/10-275GSRLYFGK-------------LAKAK-RVLENQVCDILD---KA-G---FEEIL-TPNFSY-S..QHQAI........A.
B6BHN3_9PROT/10-276GSKLYFGK-------------SAKAK-RDIENIASDILD---AN-G---FEEIV-TPLFSY-H..QHLSI........A.
C5EYR6_9HELI/22-286DSKLYFGK-------------SAKIK-RDFENLVSKTFY---EN-G---YEEIL-TPSFTY-L..QHQRD........T.
C3XLA7_9HELI/10-286GCKLYFGK-------------SARLK-REIETLASTILY---KN-G---YEEII-TPAFAY-L..EYQR.DI........
HISZ_HELHP/10-274GSKLYFDM-------------SARLK-RDIESCAIKAFY---EN-D---YREIV-TPSFAF-L..EHQGDM.........

PF00152

Q7NBK8_MYCGA/10-341MYEDFRKNFIKTIKNERYSN.LLKLF-SVINKLTYIWME---NN.N---VEIVN-LPITTQ-SVTSPMGLGS-----DS-
SYK_HUMAN/222-575DKETRYRQRYLDLILNDFVRQKFIIR-SKIITYIRSFLD---EL.G---FLEIE-TPMMNI-IPGGA.....-----VA-
Q6BRH4_DEBHA/177-668PKDLPPQFRYLQLRTPFYQN.ALRTR-SKVANLIRNIFV---EKHD---FVEIE-TPLLFK-STPEG.....-----.A-
Q6BZ12_DEBHA/190-549DRGLINSNRVLDYLVNADSKQRLMIK-SIVIQAIRQFFV---KR.D---FMEVQ-TPILGG-YGTGA.....-----NA-
Q6C814_YARLI/181-540DVHKRLANRVVDFSTSPESREMIYAR-ATVIAYVRRFFS---DR.G---FLEVE-TPILSD-VAGGA.....-----SA-
SYK_RHIME/154-495DIETRYRKRYLDIMVNEESKLRFQQR-SRIVSSLRRFLE---DE.G---FMEVE-TPMLQP-IYGGA.....-----TA-
SYD_SYNPX/123-576REELRLRHRYLDLRRKRMND.NLRLR-AQTIQAARRFLE---DE.G---FIEVE-TPVLTR-STPEG.....-----.A-
SYD_AQUAE/128-577SEETKLKYRYIDLRRESMKN.NLIFR-HRVYQITRNFFT---KE.G---FIEIE-TPFLTK-STPEG.....-----.A-
SYD_BDEBA/162-604NEMLRLKYRYLDLRSARLSS.HLITR-HKVAQLVRRFLS---DN.G---FLEVE-TPILYK-STPEG.....-----.A-
SYNC_ENCCU/175-498SVNAILTNGHLGLRTKKRQL.FLKAR-GHLLKIIRDFYF---EG.E---YTEVT-PPTMVQ-TQVEG.....-----GS-
Q6F944_ACIAD/4-329EHHSNHYQPTCSIE.......ALQAR-AKLYQTIRTFFA---ER.G---VLEVE-TPIISQ-AGVTDVHLAS-----VK-
Q7UK37_RHOBA/210-545NQDLRQRMRYADLAFNDGVMQTFLDR-TKIIKSIRSTLD---DQ.G---FCEVE-GPTLHT-VPGGA.....-----AA-
SYD_CAMJE/119-554NEELRLKYRFLDLRNPKLYE.NFALR-SKACIAARNSLA---NM.G---FLEVE-TPILTK-ATPEG.....-----.A-
SYD_THEAC/112-424DLETRLNSRFMDLRKRNISA.IFRIE-SALLWGIRQYLH---SQ.K---FIEVH-TPKIVA-AATEG.....-----GS-
Q6C700_YARLI/128-469KQEFLRTLPALRWRTSVNSS.TLRYR-SFCMAQMTNFFA---EN.D---FVQTN-PPLLTS-SDCEG.....-----AG-
Q6CLY6_KLULA/143-620DGAFPPEYRYLQLRLPKYQN.NLKLR-YEASKNVRTVLD---SL.N---FTEVE-TPLLFK-STPEG.....-----.A-
SYD_SULSO/113-425DIDTRLRERLLDLRRLEMQA.VLKIQ-SVAVKSFRETLY---KH.G---FVEVF-TPKIIA-SATEG.....-----GA-
SYD_TREPA/137-576HEDIRLKYRYLDLRSQRMQE.RIALR-SRVALAIRQFLS---MK.G---FIEIE-TPTFIC-STPEG.....-----.A-
SYD_PSESM/120-560GEETRLRYRFIDLRRPEMAE.KLRLR-SRITTSIRRYLD---EN.G---FLDVE-TPILTR-ATPEG.....-----.A-
SYKM_SCHPO/182-530NYEKRFEKRFVDMMSNTKSLELLEKR-YRIIESIRKFFS---ER.G---FLEVE-TPILSH-HFGGA.....-----TA-
SYD_BRAJA/121-561PEDIRLKYRFLDLRREKLHQ.NIMTR-VEIIKSMRRRME---GQ.G---FFEFN-TPILTA-SSPEG.....-----.A-
Q7NBS8_MYCGA/119-554LEEVRLKYRYLDLRRPVLQK.NMKLR-SDFFLIVRNFLT---SQ.G---FIEIE-TPILSK-TTPEG.....-----.A-
SYK1_MYCTU/156-502SEESRVRQRYVDLIVRPEARAVARLR-IAVVRAIRTALQ---RR.G---FLEVE-TPVLQT-LAGGA.....-----AA-
Q6CX40_KLULA/145-470SLPTLRKLPEFKHRTTYLSN.LLRFR-HKVESQLTKTLD---GL.D---FTMVR-PPILTS-IDCEG.....-----AG-
SYD_METTH/121-433EIDTRLDARFLDLRKPSVSA.IFKIK-SRMLHSVRVFLE---EQ.G---FLEIN-TPKLVA-SATEG.....-----GT-
SYD_HALVO/113-429ELSTRLDNRTLDLRKDEVKA.IFEIR-AEVQRAVRDKFR---DL.R---ATEIN-TPKIVA-TGTEG.....-----GT-
SYK_CHLTR/170-520DKEIRYRKRWADLISSEDVRKTFLTR-SRILKLIREYMD---QQ.S---FLEVE-TPILQT-IYGGA.....-----EA-
SYD_TREDE/124-564NEDLRLKYRYLDLRSKAMQE.HIMLR-SKFTFAVREFLT---SK.D---FLEIE-TPTFIK-STPEG.....-----.A-
SYD_MYCLE/116-559GEELRLKYRYLDLRRDGPGS.AIRLR-SKVNATARAVLA---RH.D---FVEIE-TPTITR-STPEG.....-----.A-
SYD_HALSA/115-432DLSTRLDERHLDVRKPSTKA.VFSLR-SKAMGAMTDWFY---DN.R---FEEVD-TPELST-AGAEG.....-----GA-
SYD_GEOSL/128-566AENLRLKHRYLDLRRTPLQQ.NLILR-SRVSQVTRQYLT---EN.G---FLEIE-TPFLTK-STPEG.....-----.A-
SYD_BORBU/118-557SENSKLEYRYLDLRRDSLKN.KIILR-CQATHLIRNFLI---KR.K---FLELE-TPTFVK-STPEG.....-----.A-
SYD_ENTFA/122-560NDELRMKYRYLDLRRPSMTN.NIKLR-HQVTKTIRHYLD---NH.D---FLDIE-TPYLGK-STPEG.....-----.A-
SYD_MYCGE/108-524LEEVRLKYRYLDLRRRLMQK.RLLLR-HQFILAIRNWFN---QQ.G---FIEIE-TPTLSK-STPEG.....-----.A-
SYK_SULSO/147-487SPEFRYAHRYVDFLYNDNARKAMEIR-YTIIREIREFLY---SK.G---FIEVE-TPIVQP-VYGGA.....-----LA-
SYD_MYCPE/119-554LEDLRLKYRYLDLRRPVMQN.NIINR-GKIINLFRSFLV---KN.N---FNEIE-TPYLSK-QTPEG.....-----.A-
SYN_MYCGE/116-452SQEFFRSNAHLRVRAKTYFA.VMKIR-SVLSHAIFEYFF---KN.D---FILVQ-SPILTS-NDCEG.....-----AG-
SYD1_STRMU/118-557GEDIRQKYRYLDLRREKMTA.NLKLR-HQVTKAIRDYLN---QA.D---FIDVE-TPYLTK-STPEG.....-----.A-
SYNM_MOUSE/135-473PLEYLRQYPHLRCRTNALGS.ILRVR-SEATAAIHSYFK---DN.G---FVHIH-TPVLTS-NDCEG.....-----AG-
SYD_THEMA/117-552KEEMRLKYRYIDLRSERMKR.NIILR-YRISKIIRDYFD---EL.G---FLEIE-TPFLTR-STPEG.....-----.A-
Q98QM9_MYCPU/122-552KEETKLQYRFLDLRKPINTK.KIIFR-SKFINALRTFLI---EN.D---FVEIE-TPILSK-STPEG.....-----.A-
SYD_BACTN/119-557GDDIRMKYRYLDLRRNAVRS.NLELR-HKMTIEVRKYLD---SL.G---FIEVE-TPVLIG-STPEG.....-----.A-
SYD_RHOBA/122-563GEDLRLKYRFLDLRRKEMQQ.ALIRR-SEIIKCMRDYFA---EH.D---FIDVE-TPILGR-STPEG.....-----.A-
SYD_VIBCH/117-559SEEQRLKYRYLDLRRPEMSD.RIKLR-AKASSFVRRFLD---TH.G---FLDIE-TPVLTK-ATPEG.....-----.A-
SYD_BLOFL/118-566IEENRLKYRYLDLRRPIMFH.NIQTR-SRVMALTHRFME---LE.G---LLNID-TPVLAK-STPEG.....-----.A-
SYN_BACHD/109-426GTEFLMDHRHLWIRSRKQHA.VLRIR-NEIIRATYEFFH---EN.G---FVKVD-PPILTG-SAPEG.....-----TT-
SYD_THETN/128-566SEAVRLKYRYLDLRRPSMQR.NLITR-FKLTQAVREFLN---DN.G---FIEIE-TPMLIK-STPEG.....-----.A-
Q6KI16_MYCMO/110-541NEELRLKYRFLDLRSKKLQE.NIRLR-HKVTRSMRNFLD---RN.N---YINIE-TPNLGR-ITPEG.....-----.A-
Q7P704_FUSNV/123-564SENMRLTYRYLDIRRSKMLN.NLKMR-HRMIMSIRNYMD---KA.G---FLDVD-TPVLTK-STPEG.....-----.A-
SYDM_SCHPO/138-579GMRIQLANRHIQLRAPKYNS.YLRQR-SRLAYQVHSFFN---DR.E---FCEVE-TPLLFK-STPEG.....-----.A-
SYD_STRR6/120-554NDDTRLRYRYLDLRRPEMLE.NLKLR-AKVTHSIRNYLD---EL.E---FIDVE-TPFLSK-STPEG.....-----.A-
SYD_STRCO/121-557NEERRLEYRFLDLRRERMHR.NIMLR-TSVISSIRSKMV---AL.G---FNEMA-TPILTA-TSPEG.....-----.A-
SYD_DESPS/140-579SENLRLQYRYLDLRRPAMAR.NLLLR-HKAVQAIRNYLN---DN.E---FLDIE-TPMLTR-STPEG.....-----.A-
Q6NEX1_CORDI/708-1045NPHTRAKFRHIDFTMNSQARSIFSAR-SRAITAVRSVLV---SQ.G---YLEAE-TPILQT-IHGGA.....-----NA-
SYD_BIFLO/126-568GEDVRLKYRYLDLRRPSMQY.NLKLR-SDMAKAARHALE---DM.D---FTEVE-TPTFIK-STPEG.....-----.A-
YJEA_BUCBP/1-322MNCNYLWKSSALLK.......NLHRR-AKIIFEIRNYFF---NL.G---ILEVE-TPILSN-YSVTD....V-----NF-
SYN_THEAC/109-425GEEFLLDNRHLWLRSREFTS.VLKIR-STIFRSFADFFY---EN.G---YYQVQ-TPFMVS-TAVEG.....-----GS-
Q7UH30_RHOBA/67-394SEMNASSKPSLAVR........LRQR-AEMLREIRRFFD---DR.G---FIEVQ-PPCLSR-DCVVD....A-----FL-
SYK_PORGI/163-502DPEQRYRQRYVDLVVNSHVKDIFLKR-TMVFNSMRSFFN---EC.G---YIEVD-TPVLQS-IPGGA.....-----AA-
SYD_NEIMA/118-568SENVRLTNRVIDLRRPVMQR.NLRLR-YQVAMGVRRYLD---AQ.G---FIDIE-TPMLTR-STPEG.....-----.A-
Q97DB5_CLOAB/160-475NIDTLIENRILSMRNSRVNS.VFKIE-TEIAHGFSEFLV---KN.G---FTEIY-TPKIVS-EGAEG.....-----GT-
Q7Q3E7_ANOGA/129-574KENLRLEHRYIDLRNRDLQH.NLRLR-SQIIMRMRECMI---NDYG---FVEVE-TPTLFR-RTPGG.....-----.A-
SYK_UREPA/150-490DEEIKARQRYLDLIVNDETKNTFIKR-SLIIREMRNWLD---NK.G---FFEVE-TPVLQD-ILSGA.....-----AA-
SYD_LACJO/120-559AEQTRLKYRYLDLRRPTLQR.AIILR-SKILKAVHEYFD---EQ.G---FIDIE-TPILGK-SSPEG.....-----.A-
SYD_UREPA/115-551NEEIRFRYRYLDLRRDVNLK.IFELR-SKVYQAFRNYLY---SQ.D---FIETE-TPILAK-PTPEG.....-----.A-
SYK_BUCAI/162-503NQEIRYRKRYLDLISNNKLYSIFKNR-SNIITAIRNFMI---EN.D---FLEVE-TPMLQN-IPGGA.....-----NA-
Q74MV5_NANEQ/94-400TPKKRFDYRIIDLKLPERQT.LFRLR-AKVQKFFRDWFM---EN.G---FVEIN-TPKIVI-IGAES.....-----GA-
SYD_CHLTR/123-558NEELRLTYRYLDMRRGDILD.RLMCR-HKVMLACRQYLD---EQ.G---FTEVV-TPILGK-STPEG.....-----.A-
SYD_BUCAI/117-559NDDSRLKYRYLDLRSFDILE.NLKIR-NKITYLIRNFMT---KK.N---FLDIE-TPILTK-STPEG.....-----.A-
SYD_AERPE/118-438SLPTRLKYRWLDIRNPMVSA.IFELE-AMVAKVFRDYYW---SQ.G---FVEIF-TPKIVA-AGTES.....-----GA-
Q8PAB4_XANCP/1-324MS.TLPGELPVDLE.......ALRLR-ARLNALIRGFFA---ER.A---VLEVE-TPVLSA-AGNTEPNIES-----FS-
SYD_BACSU/123-562SEDVRLKHRYLDLRRPAMFQ.TMQLR-HNVTKAVRSFLD---EN.G---FLDIE-TPILTG-STPEG.....-----.A-
SYK_DEIRA/167-507DEELRARRRYVDLMVTEGAREKFQAR-SRMIRYIRNELD---ER.G---FMEVE-GPTLQV-TAGGA.....-----EA-
Q8D388_WIGBR/116-550SEEKYLKFRYLYIRRSKLFK.ILKLR-SKITNYIRKVME---KR.K---FIDIE-TPILSH-STTEG.....-----.A-
SYD_THETH/123-553SEELRLKYRYLDLRRRRMQE.NLRLR-HRVIKAIWDFLD---RE.G---FVQVE-TPFLTK-STPEG.....-----.A-
SYD_COXBU/119-561SEEVRLKFRYLDLRRPEVAQ.RLKMR-SYIIREIRRFLD---ER.G---FLDIE-TPMLTK-STPEG.....-----.A-
SYN_LEPIN/113-431GIDFLISQRHLWLRSSKQLA.ILRVR-DSLSFAIRKYFH---ER.D---FLLID-TPILTG-SVGES.....-----AG-
SYD_BRUSU/121-565PEDIRLKYRFLDLRRETLHK.NIMSR-TKIIAAMRRRMT---EI.G---FNEFS-TPILTA-SSPEG.....-----.A-
SYD_DESVH/142-576SENLRLAWRYLDLRRPRMAR.NFMLR-HRAAQSARRYLD---EL.D---FLEIE-TPYLTK-ATPEG.....-----.A-
SYD_PARUW/129-567NEELRLKYRYLDIRRGDVAK.KLITR-HQAMLAVRNYLN---NQ.G---FLEIS-TPILGK-STPEG.....-----.A-
O81892_ARATH/198-611KEEIRLRFRCLDLRRQQMKN.NIVLR-HNVVKLIRRYLE---DRHG---FIE..-......-...SG.....-----..-
SYD_PYRAE/116-424DLATRLKWRSVDLKRPRNLV.VFTVA-SAMLRSIREVLY---GE.G---FVEVF-TPKIIV-TSTEG.....-----GA-
Q7SFD2_NEUCR/259-590TMLTHLDNIIMHKRAPVQQA.IADIR-MEVKDLFRSYLK---SH.G---FKEFE-PPCLIG-AASEG.....-----GA-
SYD_PROMP/123-570KEELRLKYRYLDLRRGKLLK.NLKTR-HKIIKAVREYLD---NS.G---FTEVE-TPLLTK-STPEG.....-----.A-
SYD_NITEU/118-561SEAIRLEYRYLDLRRPVMQR.NIRLR-HQVTMAVRIFLD---QH.G---FIDVE-TPMLTK-STPEG.....-----.A-
Q8ZUX9_PYRAE/23-343MLEEWLKYSWRWAVNEKYKL.VFKVQ-ASILRALREFLD---SK.G---FVEVL-SPIIGP-VTDPGI...R-----GA-
Q9VJH2_DROME/521-960GERLRLTHRYLDLRFNDMQH.NLRLR-SAVIMKMREYLI---NYLG---FVEVE-TPTLFR-RTPGG.....-----.A-
Q8EX85_LEPIN/1-330MIALLNRRKSTKSKMNELSQEVLIQR-AKFLSVLRKFFE---KR.N---YLEMD-TPCLKP-VPSME....P-----YL-
Q8ZWD4_PYRAE/145-481DSPFYMRYRSVAMVLDLQLRWRIAAR-AKLIQAFREAMW---KR.G---FLEIP-TPVLQP-IYGGA.....-----AA-
SYD_BUCBP/117-561IEETRLKFRYLDLRHPNMIR.NIIIR-NDITIIIRNFMK---KN.K---FLDIE-TPILTK-STPEG.....-----.A-
SYD_GLOVI/120-563DEKLRLKFRYLDLRRGRMQK.LLRLR-HRVMQIMRRHLD---ER.G---FTEIE-TPVLVK-STPEG.....-----.A-
SYD_LEPIN/129-574SEELKLKYRYLDFRREELKN.RMIKR-HEFIFAIRNYLN---KR.K---FVEIE-TPILNK-STPEG.....-----.A-
SYD_CLOTE/126-566AENIRLKYRYLDLRRPDMQK.ILKIR-HKTAKAVRDFLD---KE.E---FLEVE-TPMLTK-STPEG.....-----.A-
SYNC_HUMAN/225-544DVDVQLNNRHMMIRGENMSK.ILKAR-SMVTRCFRDHFF---DR.G---YYEVT-PPTLVQ-TQVEG.....-----GA-
Q9LCY8_THETH/104-418NPDTLLEYRYVTLRGEKARA.PLKVQ-AALVRGFRRYLD---RQ.D---FTEIF-TPKVVR-AGAEG.....-----GS-
Q9HKI9_THEAC/20-325EINTLIEEISEHLEKPELYH.ALKVQ-SSIRSITSEFLK---ER.G---FIEV.-PPVIIS-VLTDPL..NH-----PV-
SYK2_METMA/169-509DVETRYRKRYLDLIVNAEKREIFVMR-SKLISEIRRFLT---DR.E---FLEFE-TPILQT-VYGGA.....-----NA-
SYD_STAAS/123-562DENIRLKYRYLDLRRQELAQ.TFKMR-HQITRSIRQYLD---DE.G---FFDIE-TPVLTK-STPEG.....-----.A-
SYK_CHRVO/160-501DQETKYRQRYADLIMSEESRETFIKR-SKIVQKVRDVMV---GE.G---YLEVE-TPMMHP-IPGGA.....-----SA-
SYD_MESFL/115-551SEETRMSYRYLDLRRQKIQN.NMLLR-AKVNSIIRKEFE---AD.N---FVEVE-TPYFGK-STPEG.....-----.A-
Q6MPY6_BDEBA/81-404PQ.......KQSLPNRSYNKELTQNW-GTYLQSLREFFV---SK.G---FVELK-TPSLVV-CPGTE....P-----SL-
SYD_WOLPM/133-574PENMRFKYRFLDLRREKVRN.NIILR-SQIIAELRKLMI---ER.G---FLEIQ-TPILTA-SSPEG.....-----.A-
SYD_CHLTE/133-572SEELRLKYRFLDLRREKLHE.NIIFR-SKLTAAVRKYLT---DL.D---FIEIQ-TPILTS-SSPEG.....-----.A-
SYN_PYRHO/114-430SPELLLDYRHLHIRTPKASA.IMKVK-ETLIMAAREWLL---KD.G---WHEVF-PPILVT-GAVEG.....-----GA-
SYD_XYLFA/120-560GEDIRLKYRYLDLRRPEMQR.MQRTR-IKLVQALRRHLD---MH.G---FQDIE-TPILTK-ATPEG.....-----.A-
SYDM_YEAST/144-629SAIYPPEFRYLQLRNPKYQD.FLKKR-SSISKEIRNSFN---NF.D---FTEVE-TPMLFK-ATPEG.....-----.A-
Q9F112_RHIRD/4-352SNETMSPWWTPDVHADRRA..FLLGR-NAIQSAFRGYFA---RA.D---FLEVD-TATLQV-SPGNE....A-----HL-

PF01409

SEPS_METJA/103-348P.DVGLGNEKVEIIKNL----GIDID-EEKKERLREVLH---LY-K---KGAID.GDDL..----VFEIAKALNVSNEMG
SYFA_YEAST/212-492PYNFNSQ...GVQISSG----ALHPL-NKVREEFRQIFF---SM-G---FTEMPSNQYVET----GFWNFDALYVPQQHP
SYFA_CHLMU/94-340KVDVSLP...GEDAPLG----GKHII-KKVLDDVVDIFV---RF-G---FCVRE.APNIES----EKNNFSLLNFEEDHP
SYFA_COXBU/92-328KVDITLR...GRYDHLG----AIHPI-SRVSERVSQLFS---ML-G---FQIAE.GPEIEN----EYYNFEALNIPADHP
SYFA_HALSA/219-498DYNVAAD...AADHTPG----KTHVL-RQAAERVTDVLV---GM-G---FQEMA.GPHVDA----DFYINDCLFMPQDHP
SYFA_NITEU/97-344SLDVSLP...GRGLGMG----GVHPV-TRTLIRIESLFH---SI-G---FGVAT.GPEIET----DFYNFTALNIAENHP
SYFA_CLOAB/92-339IIDISMP...GKRQTIG----HRHPT-YLTLNKVENIFR---DM-G---FVIEE.GPEVEY----DKYNFEMLNIPKNHP
Q9GYS8_CAEEL/265-545KYNFDSL...GVVPSSG----HLHPL-MKVRSEFRQIFF---SM-G---FSEMATNRYVES----SFWNFDALFQPQQHP
SEPS_METTH/101-347P.DIGLGTGRIQMIEDM----GIDVS-DEKLENLKEVFR---SY-K---KGDLSGDDLV..----.LEVSNALEVESHDG
SYFA_AQUAE/91-337WVDLSIP....PARTVG----SLHPI-TVTLERIVTIFR---GM-G---FEVEE.GPEVER----EEYNFDMLNIPKEHP
SYFA_BACHD/92-341TIDVTLP...GRPVLKG----GAHPL-TATITEVEDLFI---GL-G---FSVAE.GPQIET----DYYNFEALNLPKDHP
SYFA_BUCAI/91-326TIDISLP...GRRTEHG----GFHPI-TNTIDYIKNFFL---KL-G---FQSIN.SPEIED----EYHNFDALNISKYHP
SYFA_NEIMA/91-328ALDITLP...GRAQEGG----SLHPV-TLTLQRVVELFH---GM-G---FEVAD.GPEIED----DFHNFQALNIPANHP
SYFA_PSEAE/91-337RIDVTLP...GRGQLSG----GLHPV-TRTLERIEQCFS---RI-G---YEVAE.GPEVED----DYHNFEALNIPGHHP
SYFA_RICPR/92-334KIDLTIP...ARRYKQG----SIHPI-TQCMDELIQVFS---QF-G---FTIEN.GPNIEN----DFYNFTALNFEYDHP
SYFA_PYRAB/223-496PFNIKAP...VKRIYPG----KKQPY-RVFLDKIRRRLI---EM-G---FIEMTVDSLIET----QFWNFDALFQPQNHP
SYFA_STAAW/94-343TIDVSLP...GRHIEIG----SKHPL-TRTIEEIEDLFL---GL-G---YEIVN.GYEVEQ----DHYNFEMLNLPKSHP
SYFA_UREPA/86-332T.NKTLF...APFINNG----HHHIL-NSIIDDIASFFK---KL-N---FEIVS.GSEVVS----PIYNFDHLNIDENHP
SYFA_METTH/232-503GYNIDAE...YPLVYPG----KMHPL-RRIIDEIRSIFL---KL-G---FTESR.GPIVES----AFWNFDCLFQPQDHA
SYFA_ARATH/198-478EYNFKAK...GAPVDAG----HLHAL-LKVRKQFKDIFV---QM-G---FEEMPTNNYVES----SFWNFDALFQPQQHP
SYFA_CAMJE/84-329ALNFNYF...DESITTG----ALHPV-MSTMDKIIEYFI---AL-N---FSIEK.GPLIED----DFHNFEALNLPKSHP
SYFA_THETH/85-346RVDVSLP...GASLFSG----GLHPI-TLMERELVEIFR---AL-G---YQAVE.GPEVES----EFFNFDALNIPEHHP
SYFA_DEIRA/85-334AIDVTLP...GLPLPAG----GLHPI-SRVLDDLIGIYR---QM-G---YAVIE.GPEVEE----EHYNFEALNVPWYHP
SYFA_HELPJ/84-328KIDVSLF....NAIKTS----SSHPL-NYTKNKIIEFFT---PL-G---YKLEI.GSLVED----DFHNFSALNLPPYHP
SYFA_XYLFA/93-332RVDVTLP...GRRGERG----GLHPV-TRTLERITEIFA---RL-G---YELVE.GPEIED----DWHNFEALNFPLHHP
Q98QL3_MYCPU/81-313NEDPFLF.....SSIES----SNHPI-SLVEKRFRSWFL---QN-G---YYSTL.ASEIES----DEYNFERLNIAFDHP
SYFA_THEMA/90-325RIDVTVP...GARRKLG----HSHPV-LKVMEEIERIFV---SM-G---FDVVE.GPEIET----TWHNFDALNTPEWHP
SYFA_BACAN/92-341TIDVTLP...GRPVETG----CHHPL-TAVVEQIEDVFI---GM-G---YEVAE.GTEVEK----DYYNFEALNLPKDHP
SYFA_THEVO/209-478KYDLDAP...VSPTKSY----AKHPL-VYFINEIRRIFL---DM-G---FTEMS.GHYIES----ALWDMDALFIPQDHP
SYFA_ECOLI/91-326TIDVSLP...GRRIENG----GLHPV-TRTIDRIESFFG---EL-G---FTVAT.GPEIED----DYHNFDALNIPGHHP
SYFA_SYNY3/96-331TLDVTMA...GSYRPQG----RRHPL-NSTVDRVLDIFV---GL-G---YTVAT.GPQVET----DYYNFEALNIPADHP
SYFA_AERPE/218-483PYNVKAE...PPRVLPA----RRHFL-AEFIERLRDILR---EL-G---FREVR.GPLVEL----ELFNFDVLFQAQDHP
SYFA_ARCFU/200-469KYDITIP...AKEIYGG----KIHPY-ERIIEECRKVFL---EM-G---FTEIK.GHYVQP----AFWNFDALFQPQDHP
SYFA_MYCGE/88-339SLDVMLP...ATEFTNG----SNNAL-YQVIDNLVEYFK---SF-L---FTINF.DSELTS----ISDCFDLLNIPKDHS
SYFA_TREPA/280-552RYNVHIP...PARIIPG----RSNAY-ADFLEHIKDRLV---AL-G---FQEFD.GPLVET----DFWNADALFMPQFHP
SYFA_SCHPO/208-490SYNFAAE...GIPPAGG----CLHPL-MKVREEFRKFFF---EL-G---FEEMPTNNFVES----GFWNFDALFVPQQHS
SYFA_CAUCR/91-342TLDLSLP...APYRRKG----SVHPT-MQTMDEVVAIFA---EM-G---FAVAE.GPDIED----DFHNFTALNFPEKHP
SYFA_STRPN/97-347SIDVTLP...GRPVATG----HRHVL-TQTSEEIEDIFI---GM-G---YQVVD.GFEVEQ----DYYNFERMNLPKDHP
SYFA_ENTFA/94-344SLDVTLP...GKQMPQG----TRHIL-TQVMEEIEDIFL---GM-G---YQVVE.GYEVES----DHYNFERMNLPKDHP
SYFA_RHILO/95-349KVDVTLPV.RQSPAERG----RIHPI-SQVIDEIAAIFG---DL-G---FAIAE.GPDIET----DYYNFTALNFPEGHP
SEPS_ARCFU/103-355P.NVGISAEKIRQIEAI----TKREV-DS..KPLQEIFH---RY-K---KGEIDGDDLS..----.YLIAEVLDVDDITA
SYFA_TROWT/94-333TLDITAL...PTRIFPG----ARHPI-HVLQDKILDFFL---MR-G---WSVVE.GPELES----EWLNFDALNIGPFHP
SYFA_MYCLE/94-337RIDVTLP...STRQPTG----ARHPI-TILAEHIADTFI---AM-G---WELVD.GPEVET----EQFNFDALNFPADHP
SYFA_METJA/212-480PYDVKVP...TKPIYPA----KVHPL-TRIIREVKEILL---AM-G---FKEVK.SPIVET----EFWNFDMLFEPQDHP
SYFA_STRCO/93-354AVDVTLP...HDRVPAG----ARHPL-TTLSERIEDIFV---AM-G---YEVAE.GPEAEA----EWFNFDALNIGPDHP
SYFA_SULSO/200-463KYNVEAF...PPYYTIS----KKHYF-REFLEKVKDIMI---SL-G---FKEIN.TGYIEM----EFYNFDLLFQPQDHP

PF02091

SYGM2_ARATH/73-356-------------------------F-QQAIQRLQEYWA---SV-G---CAVMQ--PSNTE-VGAGTMNPCTFLRVLGP-
SYG_CHLPN/8-291-------------------------L-QSMIATILRFWS---EQ-G---CVIHQ--GYDLE-VGAGTFNPATFLRALGP-
SYG_CHLTR/8-291-------------------------L-QTMMAAILNFWS---EQ-G---CIIHQ--GYDLE-VGAGTFNPATFLQSLGP-
SYGA_MORCA/9-296-------------------------F-QALILTLQNYWA---SR-G---CVVLQ--PYDME-VGAGTFHTATFLRALTP-
SYGA_ECOLI/9-298-------------------------F-QGLILTLQDYWA---RQ-G---CTIVQ--PLDME-VGAGTSHPMTCLRELGP-
SYGA_COXBU/9-296-------------------------F-QQMILALQEYWA---SQ-G---CVLLQ--PFDME-VGAGTFHPATFLRAIGP-
SYGA_BACSU/3-286-------------------------I-QDMILTLQKHWS---SQ-G---CVLMQ--AYDVE-KGAGTMSPYTFLRSIGP-
SYGA_HELPY/4-291-------------------------F-SSLLLKLQEYWK---NQ-G---CLVIQ--PYDIP-AGAGTFHPATLLRSLDK-
SYGA_SYNY3/5-288-------------------------F-QAVIAKLNEFWA---QQ-G---CLIAQ--PFDTE-KGAGTMNPHTFLRAIGP-

PF03590

ASNA_STRPN/3-246KSFIHQ---------------.QEEI-SFVKNTFTQYLK---DKLE---VVEVQ-GPILSK-VG-DGMQDNL-----SGV
ASNA_TREPA/3-246KSFILQ---------------.QQGI-SFAKHTFTQKLM---EHLG---LIEVQ-GPLLSQ-VG-DGIQDGL-----SGR
ASNA_HAEIN/3-246KTFILQ---------------.QQEI-SFVKNTFTQNLI---EQLG---IIEVQ-GPILSQ-VG-NGMQDNL-----SGI
ASNA_UREPA/6-240KAKINQ---------------TQKAI-VEIKNSFQKHFA---KNLN---LSRVT-APLFVE-GQ-SGLNDHL-----DHK
ASNA_PASMU/3-246KSFILQ---------------.QQEI-SFAKNTFTEKLA---EHLG---IVEVQ-GPILSQ-VG-NGIQDNL-----SGA
ASNA_ECOLI/3-246TAYIAK---------------.QRQI-SFVKSHFSRQLE---ERLG---LIEVQ-APILSR-VG-DGTQDNL-----SGC

PF01411

SYA_YEAST/38-617----------------------------NVRNTFLDYFK---.SKE...HKFVKSSPVVPF.DDPTLLFANA-----GMN
SYAC_HUMAN/9-597----------------------------EIRQRFIDFFK---.RNE...HTYVHSSATIPL.DDPTLLFANA-----GMN
SYA_SCHPO/14-598----------------------------EIRRTFLKYFE---.DHG...HTIVPSSSVIPY.DDPTLLFANA-----GMN
SYA_CHLPN/5-550----------------------------TIRSNFLKFYA---.NRH...HTILPSSPVFPH.NDPSILFTNA-----GMN
SYA_SYNY3/12-554----------------------------EIRQQFLNFFA---.DRQ...HQILPSASLVP..EDPTVLLTIA-----GML
SYA_ARATH/63-638----------------------------RVRDTYVDFFR---.GKG...HKFWPSSPVVPH.NDPTLLFANA-----GMN
SYA_PYRHO/61-605----------------------------EMREKFLRFFE---.KHEIYPHGRVKRYPVLPR.WRDDVLLVGA-----SIM
SYA_HAEIN/6-555----------------------------EIRQSFLDFFH---.SKG...HQVVESSSLVPE.NDPTLLFTNA-----GMN
SYA_THIFE/5-557----------------------------AIRQAFLEYFV---.EQG...HQIVPSSPLIPR.NDPTLLFTNA-----GMV
SYA_METTH/58-581----------------------------EIQDKFMEFFA---.ERG...HEPIRRYPVLAKRWRDDVFLVGA-----SIY
SYA_METJA/61-582----------------------------EMVKEFINFFK---.EHG...HEPIKRAPVTARRWRDDILLTIA-----SIA
SYA_MYCGE/7-560----------------------------KVRQTWLDYFA---.KKD...HLVLASKSLIPI.NDPSLLWINS-----GVA
SYA_AQUAE/7-551----------------------------EIRELFLSFFE---.KKG...HTRVKSAPLVPE.NDPTLLFVNA-----GMV
SYA_CHLTR/5-553----------------------------TLRSNFLKFYA---.NRN...HTPVASSPVFPH.NDPSILFTNA-----GMN
SYA_RICPR/8-559----------------------------EVRSKFITYFK---.ANN...HTHVPASSLIPD.NDPSLMFVNS-----GMV
SYA_BARBA/6-556----------------------------NIRSTFLDYFH---.RNG...HEVLSSSPLVPR.NDPTLMFTNA-----GMV
SYAC_BOMMO/9-597----------------------------EIRKTFIDFFI---.KKG...HKYVHSSSTIPL.DDPTLLFANA-----GMN
SYA_THET8/5-566----------------------------EIREKFLSFFE---.GKG...HLRLPSFSLIPE.DDPSLLFTSA-----GMA
SYA_MYCTU/5-576----------------------------EIRKRFLDHFV---.KAG...HTEVPSASVIL..DDPNLLFVNA-----GMV
SYA_ARCFU/64-592----------------------------EMREYYLNFFE---.RRG...HGRIERYPVVAR.WRTDIYLTIA-----SIA
SYAC_CAEEL/8-598----------------------------EVRSTFINFFR---EKKE...HTYVHSSSVIPH.DDPTLLFANA-----GMN
SYA_ECOLI/7-556----------------------------EIRQAFLDFFH---.SKG...HQVVASSSLVPH.NDPTLLFTNA-----GMN
SYA_MYCPN/7-559----------------------------KVRQTWLDYFT---.AKG...HLALPSKSLIPV.NDPSLLWINS-----GVA
SYA_HELPY/2-546----------------------------DIRNEFLQFFQ---.NKG...HAVYPSMPLVP..NDATLLFTNA-----GMV
SYA_BACSU/8-558----------------------------EVRQMFLDFFK---.EKG...HAVEPSASLVPH.EDPSLLWINS-----GVA

PF03099

LPLA_YEAST/163-273---------------------IGKNQ.NLW.........----------.QEVD-LAKLKS-------------------
Q9ZIU6_BORPT/40-170---------------------WVGST.GSTNA.....DL----------LARAR-AGGGAR-------------------
Q9Z7T6_CHLPN/47-157---------------------LGISR.NLN.........----------.QDVH-ISRAQA-------------------
Q9ZD17_RICPR/16-161---------------------VFDEI.DSTSS.....EA----------MRIAR-HNKVYA-------------------
O66622_AQUAE/46-165---------------------LGRNQ.............----------.....-..EEKE-------------------
Q9R9L1_RHIML/22-149---------------------LAETV.STNSE.....CL----------L..RA-REGDPG-------------------
Q49107_MYCCA/44-154---------------------VGRNQ.NAF.........----------.AEIN-LEAAQK-------------------
O69817_STRCO/180-302---------------------IGSFQ.SLR.........----------.NEVD-AEGAAR-------------------
O27938_METTH/23-148---------------------CFDEV.DSTNN.....VA----------K.RMA-EDGATE-------------------
BPL1_YEAST/386-536---------------------YGEVV.TSTSTI...LNN----------NKSLL-SSIPES-------------------
Q9Z740_CHLPN/7-132---------------------EIEEI.PSTNT.....MA----------KSYMH-LWDPYA-------------------
O45303_CAEEL/54-165---------------------IGRHQ.NPW.........----------.IEVN-IPYANK-------------------
LIPB_RICPR/47-164---------------------AGTNY.KQ..........----------.....-EELLNY-------------------
LIPM_BACSU/51-189---------------------VGYFQ.NIK.........----------.KEIN-FEAVHK-------------------
LIPB_CYACA/47-160---------------------LGHRA.NK..........----------..EYI-SFCSNN-------------------
O67557_AQUAE/109-224---------------------IGYHQ.AVE.........----------.QEVR-LEYVQR-------------------
O84507_CHLTR/46-156---------------------LGISR.KPE.........----------.RDLH-VEHLKE-------------------
LIPB_KLULA/132-268---------------------GGKRV.KKQITDEQIARY----------EGFIP-SKQKYN-------------------
O73952_9EURY/15-131---------------------YYREV.TSTNE.....VA----------K....-LGNFEE-------------------
O57883_PYRHO/15-131---------------------YFQEI.TSTNE.....FA----------K....-TSYLEE-------------------
O84730_CHLTR/7-132---------------------EIART.ESTNT.....TA----------KEGLS-LWDPYA-------------------
BPL_METJA/5-126---------------------HLSEI.DSTND.....YA----------K..EL-AKEGKR-------------------
O83376_TREPA/20-139---------------------FAPKT.ASTMD.....EA----------A..SR-AQGCEE-------------------
LPLA_AERPE/43-154---------------------VGYTS.DVG.........----------.REVN-IEQARA-------------------
LPLA_MYCGE/47-159---------------------VGRNQ.NTY.........----------.AEVN-LKELES-------------------
O66837_AQUAE/7-123---------------------WLKEV.DSTQE.....RL----------K....-EWNVSY-------------------
LIPB_HAEIN/48-159---------------------QGQAG.KP..........----------.....-EHLLQR-------------------
BPL1_SCHPO/358-503---------------------VAPVI.RSTQTL....LD----------KNYRF-LDSTNT-------------------
P72816_SYNY3/40-164---------------------APACT.DSTNQ.....IL----------W.DLR-HQGYHP-------------------
LIPB_ECOLI/49-159---------------------QGQAG.KA..........----------.....-EHILMP-------------------
LPLA_SCHPO/66-176---------------------IGRNQ.NPW.........----------.VEAN-VKLCRD-------------------
O32511_DEIRD/91-219---------------------YQGTV.TSTQDE...VRF----------WADSE-RGPAPH-------------------
Q9WZG7_THEMA/43-167---------------------LGRFQ.KE..........----------.DGIN-VP....-------------------
LIPB_PSEAE/48-158---------------------QGQAG.KA..........----------.....-EHVLFP-------------------
Q9WY67_THEMA/8-130---------------------SFESI.DSTNR.....FL----------K..EN-YRFYPD-------------------
P96884_MYCTU/32-158---------------------VVAQT.GSTNA.....DL----------LARAA-SGADID-------------------
Q9SL92_ARATH/116-244---------------------WSPRL.SSTHD.....VV----------S..HN-FSELPV-------------------
O25760_HELPY/8-130---------------------VFDSL.PSTQT.....YL----------LEKLK-SNELKA-------------------
Q9V2B8_PYRAB/79-190---------------------YCLKV.RST.........----------.MDSA-WRNFGT-------------------
Q8SX78_DROME/101-210---------------------IGRHQ.NPF.........----------.TEAN-VSQLVE-------------------
O30162_ARCFU/85-200---------------------FYDVT.DSTNS.....RA----------K....-.EYGKP-------------------
LIPT_BOVIN/74-185---------------------IGRHQ.NPW.........----------.QECN-LNLMRE-------------------
LIPB_YEAST/125-262---------------------GGKRI.KKTMTPDQIAAY----------ESFIP-ETQKDN-------------------
O84287_CHLTR/47-181---------------------YGCFI.KP..........----------.ERFL-KANWES-------------------
BIRA_BACSU/88-214---------------------YHDVL.SSTQK.....TA----------H.ELA-NNNAPE-------------------
BIRA_PARDE/1-127---------------------MLART.DSTNA.....EA----------L..KL-APGLSG-------------------
LIPL_BACSU/62-186---------------------LGIQDTRLP.........----------FLQDG-ISLLES-------------------
LIPB_DEIRA/141-265---------------------LGRKA.QE.G.......E----------NIVVT-REYLAA-------------------
Q52660_RHOCA/5-131---------------------VLGQT.DTTMA.....EA----------A..RL-APHLAG-------------------
O67765_AQUAE/41-157---------------------VGYFD.KTQ.........----------.EILD-LEKCKK-------------------
LPLJ_BACSU/44-155---------------------IGKNQ.NTI.........----------.EEIN-TKYVEE-------------------
LIPB_SYNY3/51-164---------------------LGTGS.QT..........----------..KYL-KFDPAY-------------------
LIPB_MYCLE/54-171---------------------AGRRT.QP..........----------...HE-RPNPSL-------------------
BPL1_HUMAN/471-603---------------------FAEVT.PTTMR.....LL----------DGLMF-QTPQEM-------------------
P74052_SYNY3/32-161---------------------LGYLQKSWP.........----------.DHWR-QLTWQG-------------------
Q9Y9E5_AERPE/44-177---------------------LGRRQ.SV..........----------.EDVN-LAEAEK-------------------
BIRA_HAEIN/74-192---------------------YQPII.SSTNE.....WI----------L..QN-ILSLKK-------------------
BIRA_ECOLI/83-208---------------------VLPVI.DSTNQ.....YL----------L..DR-IGELKS-------------------
LIPB_MYXXA/48-170---------------------LGRAA.KRE.........----------NIVAS-DAQLAK-------------------
Q9V2C7_PYRAB/15-131---------------------YFQEV.ASTND.....YA----------K....-AENLEE-------------------
Q9UX52_SULSF/9-132---------------------RLNKV.TSTQD.....FA----------E..AI-SNMLFE-------------------
LIPB_SCHPO/60-172---------------------LGRRE.SS..........----------....I-NFTKGF-------------------
Q9Z8A7_CHLPN/47-181---------------------YGHFM.RP..........----------.EKFL-LSNYAD-------------------
O59156_PYRHO/46-163---------------------IGRFQ.SVR.........----------.YDVN-LEKAKE-------------------
LIPT2_DROME/56-171---------------------VGLRT.KD..........----------YTAQD-EDRLRR-------------------
LPLA_ECOLI/46-158---------------------IGRAQ.NPW.........----------.KECN-TRRMEE-------------------

PF04424

FA63A_HUMAN/143-268---------------------MNILFLQWKVK........LPPQ-----KEVITSDELMAH-LGNCLLSIKPQEK..SEG
FA63B_HUMAN/272-397---------------------LNVLLLAWKVK........LPPM-----MEIITAEQLMEY-LGDYMLDAKPKEI..SEI
YP191_YEAST/34-157---------------------ANILILSPDHTRFSNELIRLVNK-----GSQISLKELIEV-LADIALQVTDK.......
Q9T054_ARATH/67-194---------------------CNVLLLRNNLN........LNPD-----CYEVSQERLMSL-VVDRLIDSNSKVNNKDEG
O82744_ARATH/44-169---------------------CNVLILKHGIN........LDTY-----NSQVSEEDLVNL-VIDVL.............
YGI2_YEAST/34-157---------------------ANVLLISPAHARYAQEISRLVRG-----KETVTLNELVQT-LADMGVQNPN........
Q9N370_CAEEL/82-206---------------------INALVLKGKLT........IP.S-----SYVVTSTNLLNL-LTNVILARAPPEN..DEK
YAGB_SCHPO/65-177---------------------SNALILKSNVDRP....FELP.K-----KRYITPDELTEY-LVEFA.............

PF00587

SYG_YEAST/76-406DKFS-D------W...MCR...D...........LKTGEIFRADHLVE............E......VLEARLKGDQEAR
SYP_ZYMMO/49-218DAYG-P------E...MLR...I...........KDRHN........R............E......L............
SYTM_SCHPO/78-251QNYE-K------E...IFR...V...........EESRNVED.EHSNA............T......Y............
SYSM_SCHPO/220-399PRDE-E------GQ.QIYE...L...........DSYTSPL...VSSP............K......Q............
SYG_HUMAN/157-453DKFA-D------F...MVK...D...........VKNGECF....RAD............H......LLKAHLQKLMSDK
SYT2_BACSU/275-439DHYR-D------N...MYF...S...........EVDDT........R...................F............
SYS_AERPE/198-368LETF-K------D..AIYE...I...........AG...........E............D......L............
SYT1_AERPE/51-229EFYR-N------N...MYL...F............DIEG........H............E......F............
SYH_ECOLI/21-188TDVV-E------K..EMYT...F...........EDRNG........D............S......L............
SYH_STREQ/19-188TDIV-T------K..EMYD...F...........YDKGD........R............H......I............
SYH_ORYSJ/369-529...D-S------K..LIYD...L...........ADQGG........E............L......C............
SYP_SYNY3/49-222DTYT-E------SEGIMFA...L...........RDRLE........R............E......L............
SYG_THET8/42-301ATFA-D------P...MVD...N...........RITKKRYRLDHLLK....................EQPEEVLKRLYR
SYH_HAEIN/21-187TDVV-S------K..EMYT...F...........WD.ND........E............Q......L............
SYSC_HUMAN/203-386LSQF-D------E..ELYK...V...........IGKGS........EKSDD....NSYDE......K............
SYG_DEIRA/42-302ATFS-D------P...MID...N...........KKNNKRYRLDHLLK............DQKADVQAKVAEIMGESADN
SYH_PORPU/20-187TDIV-N------K..EMYR...F...........NDRSN........R............D......I............
SYP_HELPJ/49-219DKYG-K------E...LLV...F...........KDRKD........N............D......F............
SYPC_CANAX/59-225DQ..-E------E...IFK...L..............VG........D............E......Y............
SYSM_YEAST/191-366PRDM-N------NERQIYA...L...........QD...........T............N......L............
SYP_AQUAE/49-219ETYG-E------E...LFK...L...........KDRNG........R............E......Y............
SYG_CAEEL/167-463DRFA-D------W...MVK...D...........MKNGECFRADHLIKNSIE....KLLN........DKKTSAAVKQDG
O94025_CANAX/62-240DNYK-D------D...MFK...VVGNDITKEEYTDNIEE........H............E......Y............
SYTM_YEAST/68-246ENYA-D------D...MFK...VE.........TTDEEK........E............E......Y............
SYS_COXBU/172-344LPKF-R------E..EQFQ...V...........AGD..........R............N......F............
SYS_BUCAP/172-346LPKF-T------D..DLFHINSI...........DK...........K............K......Y............
SYS_HALMA/177-355LPKF-A------E..DAYR...V...........GARQDDD...YDSD............D......L............
SYH_METJA/21-183...I-R------K..QLYV...F...........KDHGG........R............E......M............
SYPM_HUMAN/97-268DLMG-K------E...LLR...L...........RDRHG........K............E......Y............
SYT_HELPY/249-413DNYK-E------N...MYF...............TTIDE........Q............E......Y............
SYP_RICPR/49-219EHYG-K------E...MLK...F...........QDRHD........N............T......L............
SYS_THEMA/175-346LPKF-E------E..ELYL...A...........ER...........D............D......L............
SYS_BORBU/171-341PRGN-E------S..NIYK...I...........ED...........T............D......K............
SYS_BACSU/173-344LPKF-E------E..DAFK...I...........RE...........E............D......Y............
SYT_METTH/225-383EKFG-E------R...QYR...M...........KN.RK........E...................L............
SYG_ARCFU/39-308TSFT-D------V...AIE...C...........ENCGRVYRADHYVK....................EKLGIEVDETVE
SYT_BORBU/216-382DFYK-D------S...MFE...K...........IEMDK........S............D......Y............
SYH_MYCPN/20-187ADIV-K------K..ELYE...F...........HDKSN........R............L......L............
SYT_AQUAE/274-440ECYK-Q------N...MFP...S...........MKIDE........E............E......Y............
Q9VUK8_DROME/189-485ERFA-D------L...MVK...D...........VKTGECFRLDHLIKQALE....KLSK........AKDATPALQAEC
SYH_ARCFU/19-179...I-I------E..EMYV...F...........KDKSG........R............D......L............
SYH_YEAST/71-233...D-S------K..LIYN...L...........EDQGG........E............L......C............
Q9VF85_DROME/153-322TEGE-R------T..QVYK...L...........D............T............G......E............
SYH_STAAW/18-186TDVV-Q------K..EMYT...F...........KDKGD........R............S......I............
SYS_SYNY3/181-351LPKF-A------E..ESFQ...C...........RG...........D............D......L............
O65395_ARATH/266-437PRGD-N------T..QVYS...I...........DG...........T............D......Q............
SYT_CHLTR/267-432ENYK-E------N...MYT...............LTVDE........E............D......Y............
SYS_PYRHO/195-365FEDF-E------D..VIYK...V...........ED...........E............D......L............
SYG_METTH/42-319DHFN-D------P...MTQ...C...........KECMDVYRADHIIE....................DATGRDVEGLEN
SYH_BACSU/19-187TDIV-Q------K..EMYT...F...........EDRKG........R............S......L............
SYS_SULSO/195-365LDTF-K------D..AIYK...I...........EN...........E............D......L............
SYS_STRCO/173-343LGQA-A------Q..DVYH...L...........DK...........D............D......L............
YHI0_YEAST/227-403EGFA-P------E...VAW...V..............TRAGSSELEEP...................I............
SYH_THET8/19-186TDIV-R------K..EMFT...F...........QDRGG........R............S......L............
SYT_PYRAB/237-399NRFP-A------R...QYI...V...........LSGDK........R...................Y............
SYT_METJA/228-387DKFG-E------R...QYR...F...........RQGNK........E...................L............
SYP_MYCTU/51-221TQYG-D------S...VFR...L...........KDRRG........N............D......Y............
SYH_AQUAE/19-186TDIV-Q------K..EMFV...F...........EDRKG........R............K......L............
SYTC_YEAST/359-523ANYK-E------N...MFT...............FEVEK........E............T......F............
SYH_DEIRA/28-196TDIV-R------K..EMFTVYYF...........GDHGG............................Y............
SYS_MYCPN/169-338LPKF-K------D..DVFK...L...........EN...........T............R......Y............
SYP_BACSU/49-219YTYG-P------E...LMR...L...........KDRHG........R............E......F............
SYT_SYNY3/228-403QKYQ-E------D...MFP...M...........MAESP........E............EAAQEMGF............
SYT_THEMA/271-435DHYA-E------N...MYF...............IEKDE........E............R......Y............
SYP_TREPA/47-217YRMG-A------E...LLR...A...........KNRLD........H............E......L............
SYHM_HUMAN/73-235...D-S------G..LMYD...L...........KDQGG........E............L......L............
SYT_RICPR/272-437AKFR-C------D...MF....T...........LETDD........K............T......L............
SYP_ECOLI/49-219EQYG-P------E...LLR...F...........VDRGE........R............P......F............
SYS_ARATH/179-353LAQF-D------E..ELYK...V...........TGEG.........D............D......K............
SYP_CHLTR/49-221KAFL-S------EK.LLYV...L...........KDREN........K............A......M............
SYG_AERPE/42-324EHFT-D------P...IVR...C...........TSCGRTFRADHLVE....................EALGINAEGLSV
SYH_CHLPN/28-193SDVV-K------K..EVYS...F...........LDRKG........R............S......M............
SYT_HAEIN/273-438QNYA-D------L...MFT...............TQSEN........R............E......Y............
SYH_TREPA/25-187...T-E------K..QMFR...F...........VDKGG........R............D......V............
SYH_RICPR/21-188SDVM-S------K..EIYS...F...........VDKSN........N............A......V............
SYS_ARCFU/192-362FSDF-E------E..VIYK...V...........ED...........E............D......L............
O45869_CAEEL/49-223EAMG-P------E...MIR...F...........HDRQQ........N............H......M............
SYS_HELPJ/174-344LPKF-K------E..DVFK...I...........EN...........E............N......L............
SYH_SCHPO/79-242...D-S------K..LIYD...L...........KDQGG........E............L......C............
SYG2_YEAST/45-343DKFT-D------W...MCR...N...........PKTGEYYRADHLIEQTLK....KRLL........DKDVNPQDMKNM
SYHC_HUMAN/72-234...D-S------K..LIYD...L...........KDQGG........E............L......L............
SYT_MYCLE/310-489DWYA-E------G...IFP...P...........MHLDA........EHNDDGTVRKPGQD......Y............
SYS_THET2/168-340FPAY-R------D..QVWA...I...........AE...........T............D......L............
SYP_THEMA/49-219DDYG-P------E...MMK...L...........KDRHE........R............D......F............
SYT_DEIRA/279-448PYYS-E------S...QFN...P...........IQVDE........E............E......Y............
SYS_AQUAE/174-344LPKF-E------E..DLYK...C...........ER...........D............N......L............
SYT_ARCFU/227-389ERFP-A------R...QYI...I............KGDK........R............E......F............
SYS_MYCTU/169-339LGAH-A------E..EVYR...V...........EG...........D............G......L............
SYG_MYCTU/45-278DVFH-D------P...LVE...S...........LITHKRYRADHLIE............A.......YEAKHGHPPPNG
SYTC_HUMAN/352-516QHYS-E------N...MFS...F...........EV.EK........E............L......F............
SYT_MYCPN/198-368VHYS-E------D...MFP...S...........VKLEN........Q............M......M............
SYPM_YEAST/56-225NN..-S------E...LFK...L...........KDSKG........K............Q......Y............
SYH_MYCGE/20-187ADIV-Q------K..ELYQ...F...........FDKSQ........R............E......L............
SYH_THEMA/19-186SDIV-Q------K..EMYT...F...........QDKAG........R............S......I............
SYG_PYRAB/44-320EKFV-D------P...IVE...C...........KKCGARFRADHLIE....................ETLGIDVEGKSA
SYG_METJA/42-324DNFT-D------P...IVE...C...........KNCLESFRADHLIE....................EFVDVDTEGKTL
SYS_RICPR/171-341LPKF-S------E..ESFI...T...........T............N............G......Y............
SYH_METTH/19-182...V-V------N..QIYH...F...........TDKGG........R............E......L............
SYH_MYCLE/30-193TDVV-A------K..EMYT...F...........ADRGD........R............S......V............
SYS_DEIRA/170-342FPGD-E------E..SVYK...L...........EG...........D............E......L............
SYS_HAEIN/173-348LPKF-G------E..DLFHTLAL...........EGE..........Q............P......Y............
SYPM_SCHPO/54-224QKTG-S------E...LFR...L...........HDRND........R............E......M............
SYT1_BACSU/276-446DHYQ-E------G...MFP...P...........MEMDN........E............T......L............
SYT_TREPA/223-390DKYR-A------N...MYL...............TEGEK........R............S......F............
SYS_TREPA/171-342PRGS-G------S..NIYR...I...........EG...........E............H......R............
SYTM_ARATH/346-510DNYK-D------N...MFT...............FNIEK........Q............E......F............
SYSC_SCHPO/179-353LEQF-D------E..ELYK...V...........IDGD.........E............E......R............
SYS_STAA8/173-344LPKF-E------E..DLFK...V...........EK...........E............G......L............
SYH_CHLTR/28-193SDIV-K------K..EVYT...F...........LDKKR........R............S......L............
O82413_ARATH/85-250...I-R------D..QLYC...F...........EDRGN........R............R......V............
SYS_CHLPN/172-344IPKF-D------G..QYYR...V...........EDG..........E............Q.....YL............
SYH_SYNY3/20-187TDVV-G------K..EMYS...F...........TDRGD........R............P......I............

PF13393

Q1K3M2_DESAC/22-332D..L.K......E--CTLRF.DD-----------RQ.SG--------K------------L------L------------
B5JRM1_9GAMM/12-323D..L.D.....LK--.TFKL.TD-----------.QLSG--------R------------L------M------------
C0N861_9GAMM/12-325T..L.D.....IQ--.TFKL.TD-----------.QMSG--------R------------M------L------------
HISZ_PSEU5/12-321D..L.D......L--RTFKV.ID-----------PL.SG--------R------------Q------M------------
B0SA16_LEPBA/18-333G..L.E......S--.LLVA.KD-----------.W.DG--------N------------E------L------------
HISZ_ANAD2/9-318A.AL.A......D--.VMKFVEP-----------.G.SG--------E------------V------V------------
HISZ_ALHEH/17-328D..L.D.....VQ--.TFKL.TD-----------.QLTG--------R------------L------M------------
HISZ_MICAN/8-319D..P.S......T--.VIQL.HG-----------.D.SQ--------G------------L------S------------
C8WUX4_ALIAD/25-356S..S.R......D--.WIRL.FD-----------.G.GG--------D------------A------V------------
HISZ_THISH/12-323D..L.D.....LQ--.TFKL.TD-----------.QLNG--------R------------L------M------------
HISZ_ANADF/9-318A.AL.A......D--.VMKFVEP-----------.G.SG--------E------------V------V------------
Q2BIN1_9GAMM/12-324D..L.D.....LN--.TVKV.TD-----------.QISG--------H------------T------L------------
HISZ_HAHCH/12-320D..L.E.....LE--.MFKV.TD-----------.QLTG--------R------------L------M------------
E6W5Z4_DESIS/15-323N..TLP......S--.TYRI.ID-----------.SITG--------R------------V------L------------
C9YB19_9BURK/9-313A..L.D.....LQ--.TFKL.VD-----------.QISG--------R------------M------M------------
C6XEF7_METSD/9-315D..L.D......L--ATFKV.VD-----------.QLTG--------R------------L------M------------
A1WUT1_HALHL/12-323D..L.D.....VQ--.TFKV.TD-----------.QLSG--------R------------T------L------------
C4KMP4_BURPE/9-313E..L.R......L--RTFKL.VD-----------.QVSG--------R------------T------L------------
HISZ_LARHH/9-314A..L.D.....MQ--.TFKL.DD-----------.QLSG--------R------------Q------L------------
HISZ_METFK/9-315D..L.D.....IA--.TFKV.VD-----------.QLTG--------K------------L------M------------
HISZ_RALME/10-314D..L.D......L--RTLKL.VD-----------.QLSG--------R------------T------L------------
B6C6F9_9GAMM/12-321D..L.E.....LQ--.TFKL.TD-----------.QLTG--------R------------L------M------------
D5CRS6_SIDLE/8-314D..M.D.....LR--.SFKL.VD-----------.QLSG--------R------------T------L------------
D0LNQ8_HALO1/14-324D..A.R......Q--AAIRFVEP-----------.G.TG--------E------------V------V------------
HISZ_CELJU/17-327D..I.D......L--LTLKV.TD-----------.QLSG--------R------------T------L------------
HISZ_CHRSD/12-323D..L.D.....LQ--.TFKL.TD-----------.QLSG--------R------------M------M------------
HISZ_TERTT/12-323D..I.D......L--LTFKL.TD-----------.QLTG--------K------------T------L------------
A0Y7Z9_9GAMM/12-323D..V.D.....IQ--.TFKV.VD-----------.QLSG--------R------------M------M------------
Q0VMF2_ALCBS/13-322D.LE.R......E--.TFKI.TD-----------.QLTG--------R------------L------M------------
A3RVD4_RALSL/9-313D..L.D.....LK--.TFKL.VD-----------.QLSG--------R------------T------I------------
C6WV54_METML/9-315D..L.D......L--ATFKV.VD-----------.QLTG--------R------------L------M------------
B9Z696_9NEIS/9-315A..L.D.....IK--.TFKL.DD-----------.HLSG--------R------------Q------L------------
HISZ_NITEU/9-320G..M.N.....LR--.MFKV.VD-----------.QLSG--------R------------M------M------------
A4BLP9_9GAMM/17-328D..L.D.....LQ--.TFKL.TD-----------.QLTG--------R------------M------M------------
HISZ_SACD2/12-323D..A.Y.....LD--.TFKI.TD-----------.QLSG--------K------------T------M------------
Q1YRY2_9GAMM/12-321D..L.D......L--MTFRI.TD-----------.QLSG--------R------------M------M------------
HISZ_JANMA/9-313D..M.D......L--RTFKL.VD-----------.QLSG--------R------------T------L------------
HISZ_METCA/17-328D..L.D.....IQ--.TFKL.ID-----------.QASG--------R------------L------L------------
HISZ_MARMS/12-324D..L.E.....IE--.TFKV.ID-----------.QLSG--------R------------L------L------------
HISZ_POLNS/9-318D..L.N.....LQ--.TFKL.VD-----------.QLSG--------R------------T------L------------
HISZ_VARPS/9-317A..L.D.....LQ--.TFKL.VD-----------.QLSG--------R------------S------M------------
B7RW37_9GAMM/12-322D..L.D......L--LTFKL.TD-----------.QLSG--------R------------S------M------------
HISZ_NITMU/11-321Q..M.N.....LR--.VLKV.VD-----------.QLSG--------R------------M------M------------
D3RSK9_ALLVD/11-321D..L.D.....LQ--.TFKL.TD-----------.QLTG--------R------------L------L------------
Q1N278_9GAMM/12-321D..L.N.....LQ--.TFKV.TD-----------.QLTG--------R------------M------M------------
HISZ_MARAV/12-322D..L.E.....LQ--.TFKL.TD-----------.QLTG--------R------------M------M------------
HISZ_AROAE/8-312D..L.K......L--RTFKL.VD-----------.QLSG--------R------------T------M------------
D1YNU9_9FIRM/9-314R..G.Q......H--.MYEF.MD-----------.S.SE--------V------------S------V------------
C7RU27_ACCPU/8-312D..L.K......L--RTFKC.VD-----------.QLSG--------R------------T------L------------
A3YHH2_9GAMM/12-323D..L.E.....LE--.TFKV.ID-----------.QLSG--------R------------L------M------------
D9SFI4_GALCS/9-316D..M.D.....LR--.TFKL.VD-----------.QLSG--------R------------T------L------------
HISZ_THICR/11-322H.LA.V......D--.TCRF.TD-----------QE.SG--------K------------M------M------------
HISZ_DECAR/8-312D..L.K......L--RTFKL.VD-----------.QLSG--------R------------T------M------------
HISZ_THIDA/9-313D..L.D.....LK--.TFKL.VD-----------.QLSG--------R------------L------M------------
D3SBT1_THISK/12-326A..L.D.....LQ--.TFKL.TD-----------.QMNG--------R------------L------M------------
HISZ_RHOFD/9-313A..L.D.....LQ--.TFKL.VD-----------.QLSG--------R------------M------M------------
B8KW68_9GAMM/12-325D..L.D.....VL--.TCKF.TD-----------.QLSG--------R------------T------L------------
A6GNJ9_9BURK/9-322S..L.N.....LQ--.TFKL.LD-----------.QASG--------R------------M------L------------
B7X1H5_COMTE/9-313A..L.A.....LQ--.TSKL.ID-----------.QLSG--------R------------T------M------------
A0Z0R0_9GAMM/12-324D..L.D.....VL--.TCKF.SD-----------.RTSG--------R------------M------L------------
HISZ_ACIAC/9-313A..L.D.....LQ--.TFKL.VD-----------.QLSG--------R------------S------I------------
B5EJB1_ACIF5/15-325D..L.D.....LQ--.TWKL.LD-----------QD.SG--------R------------L------V------------
A3EWA4_9BACT/25-339V.LQ.H......K--.AYTL.QD-----------.RGSG--------H------------V------L------------
Q12AC8_POLSJ/13-319A..L.D.....LQ--.TFKL.VD-----------.QLSG--------R------------T------L------------
HISZ_BORPA/9-316D..L.N.....LR--.TCKL.VD-----------.QLSG--------R------------T------L------------
HISZ_VEREI/9-313A..L.D.....LQ--.TFKL.VD-----------.QLSG--------R------------S------L------------
HISZ_ACISJ/9-313A..L.D.....LQ--.TFKL.VD-----------.QLSG--------R------------S------L------------
D4DMZ4_NEIEG/10-317GLSL.K......T--.IRFV.DQ-----------.I.SG--------R------------Q------L------------
A4A6K0_9GAMM/15-328D..L.D......L--LTFKV.PD-----------.QVTG--------R------------M------L------------
HISZ_AQUAE/8-290G..S.K......E--.AITF.KD-----------SY.TK--------E------------S------F------------
HISZ_THET2/5-297...A.E......R--.AFKL.VD-----------.K.TG--------E------------V------L------------
C1CVJ4_DEIDV/29-323Q..D.R......R--.AFKL.ID-----------.S.GG--------Q------------V------L------------
Q1J099_DEIGD/30-328Q..N.A......R--.AFKL.ID-----------.T.DG--------E------------V------L------------
A6G000_9DELT/27-343D.MA.E......R--.CVRF.IE-----------AG.TG--------D------------V------V------------
D0KVK0_HALNC/13-326D..L.A.....LD--.TLQM.TD-----------GL.TG--------R------------Q------L------------
A4BEB8_9GAMM/12-323D..L.D......L--LTFKI.TD-----------QQ.TG--------R------------M------M------------
HISZ_DEIRA/31-328.....N......H--.AFKL.ID-----------.S.GG--------Q------------V------L------------
HISZ_LEPIC/17-331D..S.S......S--.LFRI.RD-----------.L.SG--------N------------E------I------------
A3Z6V4_9SYNE/8-318A..S.E......D--.IVRL.V.-----------...AD--------E------------P------L------------
HISZ_PROMT/8-318S..N.N......E--.ILKI.V.-----------...SD--------E------------P------L------------
A2SHA5_METPP/10-318E..L.D......L--RTFKL.VD-----------.QLSG--------R------------T------L------------
C6NXF6_9GAMM/15-326D..L.D.....LQ--.TWKV.LD-----------QA.SS--------R------------L------L------------
Q067E0_9SYNE/8-318A..S.R......D--.IVRL.V.-----------...AD--------D------------P------L------------
HISZ_PROM4/8-318D..S.K......E--.ILKL.V.-----------...ID--------E------------P------V------------
D0SC52_ACIJO/12-322N..Q.DL...DLA--.TFKV.ID-----------.QLSG--------R------------L------L------------
HISZ_SYNPX/8-318A..S.E......D--.VVRL.V.-----------...AD--------E------------P------L------------
HISZ_BORA1/9-316D..L.N......L--YTCKL.ID-----------.QLSG--------R------------T------L------------
B1XXK3_LEPCP/10-318E..L.D.....LK--.TFKL.VD-----------.QLSG--------R------------T------L------------
B5IJM2_9CHRO/8-318D..S.R......E--.LVRL.A.-----------...AD--------E------------P------L------------
D0CJ76_9SYNE/8-318D..S.S......D--.IVRL.V.-----------...AD--------D------------P------L------------
B0VFH4_CLOAI/7-312E..A.DTAMKGVL--.SLSL.PD-----------.D.QL--------S------------L------L------------
B6BTN9_9PROT/10-316V..D.S......D--.MFKL.SD-----------PL.SG--------R------------L------I------------
HISZ_PSYA2/5-314D..L.K.....RQ--.TFKI.ID-----------.QLTG--------R------------L------M------------
HISZ_SYNR3/8-318Q..S.H......Q--.VVQV.V.-----------...AD--------E------------A------L------------
A5WGG0_PSYWF/34-354D..L.K.....RQ--.TFKI.ID-----------.QLSG--------R------------L------M------------
D1KE67_9GAMM/9-315V..D.E......K--.TFKF.LD-----------SA.SG--------K------------M------L------------
Q0IAC0_SYNS3/25-335A..S.H......D--.VVRL.V.-----------...AD--------D------------P------L------------
D3P4X4_AZOS1/14-318A.MS.K......Q--.TFRL.MD-----------PH.SQ--------R------------M------M------------
A8TQZ8_9PROT/17-319T..S.D......R--.VFRL.MD-----------PM.SQ--------R------------M------M------------
D2Z2L9_9BACT/13-312T..I.R......E--SLLVL.TS-----------.P.MG--------E------------P------C------------
B1X3U7_PAUCH/8-318E..P.E......A--.VVQL.V.-----------...AN--------E------------A------L------------
C7JCL4_ACEP3/27-328A.LA.E......Q--.SFRV.MD-----------PD.TR--------R------------M------M------------
Q0BTV8_GRABC/14-327V..S.D......Q--.SFRL.MD-----------PD.SH--------R------------M------M------------
HISZ_RHOCS/16-317A.LA.K......Q--.TFRL.MD-----------.PISQ--------Q------------M------M------------
D3L2N6_9BACT/7-310N..LHN......R--.FMVT.NS-----------.F.FG--------E------------P------C------------
A9HLQ2_GLUDA/27-327A.VA.D......Q--.AFRL.MD-----------PD.TR--------R------------M------M------------
HISZ_RHORT/16-319A..TAG......Q--.TFRV.MD-----------.PITQ--------R------------M------M------------
C8PZK1_9GAMM/30-351D..V.K.....LQ--.TFKI.ID-----------.QLTG--------R------------L------M------------
D3DJN8_HYDTT/9-286Q..Y.K......P--.FVIG.TC-----------.Q.DG--------S------------L------L------------
Q2G4V6_NOVAD/12-320Q..S.R......R--.MFRF.VD-----------PS.SL--------R------------M------M------------
C8WED5_ZYMMN/11-310A..R.K......Q--DLLRF.VD-----------PV.SQ--------R------------S------L------------
D3SMU8_THEAH/10-286...V.E......P--.FITG.TT-----------.G.RG--------E------------V------L------------
Q5UF78_9PROT/11-312S..L.R......D--YAYSF.SD-----------.E.NL--------K------------N------I------------
A5VFF4_SPHWW/22-321A.GA.R......D--.LLRF.VD-----------PV.SQ--------R------------T------L------------
C4L169_EXISA/13-302D..E.S......A--.YYRL.FG-----------.N.DG--------E------------L------L------------
Q1NEW5_9SPHN/12-315M.RA.Q......D--.LVRV.VD-----------PV.SQ--------R------------T------L------------
Q2NCV4_ERYLH/16-312Q..T.R......R--.LFRF.VD-----------PE.SL--------R------------T------L------------
A3W9X6_9SPHN/22-321A..T.R......R--.TFRM.VD-----------PA.SL--------R------------T------L------------
A5PDB1_9SPHN/11-307A..T.R......R--.MVRF.TD-----------PE.SL--------R------------T------L------------
Q1GVI6_SPHAL/11-307S..G.R......D--.LLRF.TD-----------PV.SQ--------R------------T------L------------
A6Q5H3_NITSB/10-275D..E.K......V--.LIRL.SD-----------.D.KN--------R------------E------L------------
A7I327_CAMHC/12-273N..S.E......Q--.LLKF.SD-----------.P.AN--------N------------E------I------------
HISZ_WOLSU/12-276S..S.R......E--.VLRL.SN-----------.E.KN--------H------------Q------I------------
A5LME0_STRPN/14-307S..I.G......R--.YYQV.KD-----------.E.KN--------R------------N------I------------
A8ER44_ARCB4/10-275N..E.K......K--.LIKF.SD-----------.E.QN--------E------------Q------V------------
B6BHN3_9PROT/10-276D..E.K......K--.LIKV.ND-----------.A.KN--------N------------S------I------------
C5EYR6_9HELI/22-286Q..S.R......E--.FVRI.SN-----------.P.SN--------H------------Q------I------------
C3XLA7_9HELI/10-286K..S.R......E--.VVRT.NN-----------.Q.YN--------H------------Q------I------------
HISZ_HELHP/10-274F..N.R......E--.IVRL.SS-----------.E.NN--------H------------Q------I------------

PF00152

Q7NBK8_MYCGA/10-341-----K----------PYKVIS..............KSN----------------------------L------------
SYK_HUMAN/222-575-----K----------PFITY................HN----------------------------E------------
Q6BRH4_DEBHA/177-668-----R----------EFLVPT...........RSHDRF----------------------------Y------------
Q6BZ12_DEBHA/190-549-----E----------PFKTISNAL.....KSTGDGSKY----------------------------L------------
Q6C814_YARLI/181-540-----R----------PFTTESNHLTRTKKKSKSDCKEI----------------------------T------------
SYK_RHIME/154-495-----E----------PFKTH................HN----------------------------T------------
SYD_SYNPX/123-576-----R----------DYVLPSR..........VCGGEW----------------------------F------------
SYD_AQUAE/128-577-----R----------DFLVPSR..........LHPGKF----------------------------Y------------
SYD_BDEBA/162-604-----R----------DYLVPSR..........VNPGHF----------------------------Y------------
SYNC_ENCCU/175-498-----T----------LFKLD.................Y----------------------------Y------------
Q6F944_ACIAD/4-329-----A----------LRHIE..................----------------------------G------------
Q7UK37_RHOBA/210-545-----R----------PFETH................HN----------------------------A------------
SYD_CAMJE/119-554-----R----------DYLVPSR..........VHQGEF----------------------------Y------------
SYD_THEAC/112-424-----D----------LFPVR.................Y----------------------------F------------
Q6C700_YARLI/128-469-----E----------VFKVAGG..........GKGDKF----------------------------F------------
Q6CLY6_KLULA/143-620-----R----------EFLVPTRG.......KIDGEASF----------------------------Y------------
SYD_SULSO/113-425-----Q----------LFPVL.................Y----------------------------F------------
SYD_TREPA/137-576-----R----------DFVVPSR..........VCPGRF----------------------------Y------------
SYD_PSESM/120-560-----R----------DYLVPSR..........THPGSF----------------------------F------------
SYKM_SCHPO/182-530-----R----------PFITS.................D----------------------------I------------
SYD_BRAJA/121-561-----R----------DFLVPSR..........IHPGKF----------------------------Y------------
Q7NBS8_MYCGA/119-554-----R----------DYVVPSR..........LGPNMF----------------------------Y------------
SYK1_MYCTU/156-502-----R----------PFATH................SN----------------------------A------------
Q6CX40_KLULA/145-470-----E----------MFNLK...............QDH----------------------------W------------
SYD_METTH/121-433-----E----------LFPIT.................Y----------------------------F------------
SYD_HALVO/113-429-----E----------LFPIT.................Y----------------------------F------------
SYK_CHLTR/170-520-----T----------PFVTT................LQ----------------------------A------------
SYD_TREDE/124-564-----R----------DYLVPSR..........LYPGKF----------------------------Y------------
SYD_MYCLE/116-559-----R----------DFLVPAR..........LRPGTF----------------------------Y------------
SYD_HALSA/115-432-----D----------LFPVV.................Y----------------------------Y------------
SYD_GEOSL/128-566-----R----------DFLVPSR..........INQGNF----------------------------Y------------
SYD_BORBU/118-557-----R----------DFVIPSR..........IHKGSF----------------------------Y------------
SYD_ENTFA/122-560-----R----------DYLVPSR..........VHAGHF----------------------------Y------------
SYD_MYCGE/108-524-----Q----------DFLVPAR..........IRKDCF----------------------------Y------------
SYK_SULSO/147-487-----K----------PFKTH................VN----------------------------Y------------
SYD_MYCPE/119-554-----R----------DYLVPT............RSKKF----------------------------F------------
SYN_MYCGE/116-452-----E----------TFVIKD.............SETF----------------------------F------------
SYD1_STRMU/118-557-----R----------DFLVPSR..........VFKNQF----------------------------Y------------
SYNM_MOUSE/135-473-----E----------LFQVEPSSK......IKGPKESF----------------------------F------------
SYD_THEMA/117-552-----R----------DFLVPSR..........LRPGKF----------------------------Y------------
Q98QM9_MYCPU/122-552-----R----------DFLVPT...........RNKNKF----------------------------F------------
SYD_BACTN/119-557-----R----------DFVVPSR..........MNPGQF----------------------------Y------------
SYD_RHOBA/122-563-----R----------DYLVPSR..........VHPSNF----------------------------Y------------
SYD_VIBCH/117-559-----R----------DYLVPSR..........VHKGSF----------------------------Y------------
SYD_BLOFL/118-566-----R----------DYLVPSR..........LHINKY----------------------------Y------------
SYN_BACHD/109-426-----E----------LFHTK.................Y----------------------------F------------
SYD_THETN/128-566-----R----------DYLVPSR..........IYPGKF----------------------------Y------------
Q6KI16_MYCMO/110-541-----K----------DFIVPS...........RKKGFF----------------------------F------------
Q7P704_FUSNV/123-564-----R----------DFLVPSR..........TNPGTF----------------------------Y------------
SYDM_SCHPO/138-579-----R----------EFVVPSR..........LNPGKF----------------------------Y------------
SYD_STRR6/120-554-----R----------DYLVPSR..........VNKGHF----------------------------Y------------
SYD_STRCO/121-557-----R----------DFVVPSR..........LHAGRF----------------------------Y------------
SYD_DESPS/140-579-----R----------DYLVPSR..........VSAGKF----------------------------Y------------
Q6NEX1_CORDI/708-1045-----R----------PFRTH................IR----------------------------A------------
SYD_BIFLO/126-568-----R----------DFVVPAR..........LVPGSW----------------------------Y------------
YJEA_BUCBP/1-322-----I----------PFKTK................LQ----------------------------I------------
SYN_THEAC/109-425-----T----------LFKVD.................F----------------------------F------------
Q7UH30_RHOBA/67-394-----D----------PIEVESSQ........VGLFGEL----------------------------D------------
SYK_PORGI/163-502-----R----------PFITH................HN----------------------------A------------
SYD_NEIMA/118-568-----R----------DYLVPSR..........VHPGEF----------------------------F------------
Q97DB5_CLOAB/160-475-----E----------LFKLK.................Y----------------------------F------------
Q7Q3E7_ANOGA/129-574-----Q----------EFVVPS...........RKPGHF----------------------------Y------------
SYK_UREPA/150-490-----R----------PFITH................HN----------------------------T------------
SYD_LACJO/120-559-----R----------DYLVPSR..........IYPGSF----------------------------Y------------
SYD_UREPA/115-551-----R----------DFYVPT............RTRKF----------------------------Y------------
SYK_BUCAI/162-503-----R----------PFITY................HN----------------------------E------------
Q74MV5_NANEQ/94-400-----E----------VFPVL.................Y----------------------------F------------
SYD_CHLTR/123-558-----R----------DYLVPSR..........IYPGNF----------------------------Y------------
SYD_BUCAI/117-559-----R----------DYLVPSR..........NHYGKF----------------------------Y------------
SYD_AERPE/118-438-----E----------VFPVV.................Y----------------------------F------------
Q8PAB4_XANCP/1-324-----T----------RFSGH................VD----------------------------A------------
SYD_BACSU/123-562-----R----------DYLVPSR..........VHEGEF----------------------------Y------------
SYK_DEIRA/167-507-----R----------PFMTH................HN----------------------------A------------
Q8D388_WIGBR/116-550-----R----------DYLVHSR..........IHPGMF----------------------------Y------------
SYD_THETH/123-553-----R----------DFLVPYR..........HEPGLF----------------------------Y------------
SYD_COXBU/119-561-----R----------DYLVPSR..........THPGQF----------------------------F------------
SYN_LEPIN/113-431-----T----------LFSTE.................Y----------------------------F------------
SYD_BRUSU/121-565-----R----------DFLVPSR..........IHPGKF----------------------------Y------------
SYD_DESVH/142-576-----R----------DFLVPSR..........LNHGMF----------------------------Y------------
SYD_PARUW/129-567-----R----------DYLVPSR..........VYPGNF----------------------------Y------------
O81892_ARATH/198-611-----.----------.....................TF----------------------------Y------------
SYD_PYRAE/116-424-----E----------LFPVM.................Y----------------------------F------------
Q7SFD2_NEUCR/259-590-----N----------VFRMP.................Y----------------------------F------------
SYD_PROMP/123-570-----R----------DFLVPAR..........LSNGEF----------------------------F------------
SYD_NITEU/118-561-----R----------DYLVPSR..........VNAGHF----------------------------F------------
Q8ZUX9_PYRAE/23-343-----K----------QASID.................F----------------------------Y------------
Q9VJH2_DROME/521-960-----Q----------EFVVPT...........RKAGHF----------------------------Y------------
Q8EX85_LEPIN/1-330-----D----------PFLVR................SP----------------------------S------------
Q8ZWD4_PYRAE/145-481-----R----------PFTTK................IW----------------------------A------------
SYD_BUCBP/117-561-----R----------DYIVPSR..........IHKNKY----------------------------Y------------
SYD_GLOVI/120-563-----R----------DYLVPSR..........VNPGDW----------------------------F------------
SYD_LEPIN/129-574-----R----------DFLVPSR..........LNPNQF----------------------------Y------------
SYD_CLOTE/126-566-----R----------DYLVPSR..........NYPGMF----------------------------Y------------
SYNC_HUMAN/225-544-----T----------LFKLD.................Y----------------------------F------------
Q9LCY8_THETH/104-418-----G----------LFGVD.................Y----------------------------F------------
Q9HKI9_THEAC/20-325-----F----------DPTID.................Y----------------------------Y------------
SYK2_METMA/169-509-----R----------PFTTF................HN----------------------------C------------
SYD_STAAS/123-562-----R----------DYLVPSR..........VHDGEF----------------------------Y------------
SYK_CHRVO/160-501-----K----------PFVTH................HN----------------------------A------------
SYD_MESFL/115-551-----R----------DFLVPSR..........LNKNTF----------------------------Y------------
Q6MPY6_BDEBA/81-404-----D----------VFSTNL..............KIG----------------------------S------------
SYD_WOLPM/133-574-----R----------DYLVPSR..........LNPGKF----------------------------Y------------
SYD_CHLTE/133-572-----R----------DFLVPSR..........LHPGKF----------------------------Y------------
SYN_PYRHO/114-430-----T----------LFKLK.................Y----------------------------F------------
SYD_XYLFA/120-560-----R----------DFLVPAR..........MHPGEF----------------------------Y------------
SYDM_YEAST/144-629-----R----------EFLVPTRTK......RSDGKPSF----------------------------Y------------
Q9F112_RHIRD/4-352-----H----------AFATDG.............LTPG----------------------------G------------

PF01409

SEPS_METJA/103-348LKVLET----------AFPEFKDLKP..................................ESTT---L------------
SYFA_YEAST/212-492ARDLQD----------TFYIKDPLTADLPDDKTYMDNIKAVH.EQGRFGSIGYRYNWKPEECQK---L------------
SYFA_CHLMU/94-340ARQMQD----------TFYL.........................................DPV---T------------
SYFA_COXBU/92-328ARTMAD----------TFYF....S....................................G.D---K------------
SYFA_HALSA/219-498ARNHWD----------RFALSNPARIDELPDALVERVERAHR.EGAGDDGDGYHSPWDEDFARA---L------------
SYFA_NITEU/97-344ARAMHD----------TFYV....D....................................G.G---K------------
SYFA_CLOAB/92-339ARGEQD----------TFYI....N....................................D.N---V------------
Q9GYS8_CAEEL/265-545ARDAHD----------TFFVSDPAISTKFPEDYLERVKTVHS..KGGYGSAGYNYDWKIEEAQK---N------------
SEPS_METTH/101-347LRVLER----------VFPEIRDLKP..................................VSGR---T------------
SYFA_AQUAE/91-337ARDMQD----------TFYV....N....................................REG---Y------------
SYFA_BACHD/92-341ARDMQD----------SFYF....T....................................D.E---L------------
SYFA_BUCAI/91-326ARDSHD----------TFWF....D....................................R.N---R------------
SYFA_NEIMA/91-328ARAMQD----------TFYV....E....................................N.G---D------------
SYFA_PSEAE/91-337ARAMHD----------TFYF....N....................................A.N---M------------
SYFA_RICPR/92-334ARQMHD----------TFYLKGHEN....................................DKP---L------------
SYFA_PYRAB/223-496AREWTD----------TYQLKYPEKGYLPDESLVSRVKEAHE..RGLAGSRGWGYVWSPERAML---L------------
SYFA_STAAW/94-343ARDMQD----------SFYI....T....................................D.E---I------------
SYFA_UREPA/86-332ARASAD----------SFFI.........................................NSI---K------------
SYFA_METTH/232-503AREMQD----------TFYVKNPAVTDLPCEDLVRAVQDAHE.TGGSTGSEGWQYEWDRDVARQ---S------------
SYFA_ARATH/198-478ARDSHD----------TFFLKVPSTTRTLPEDYVERVKRVHE..SGGYGSRGYNYDWKREEANK---N------------
SYFA_CAMJE/84-329ARDMQD----------TFYF....D....................................D.K---R------------
SYFA_THETH/85-346ARDMWD----------TFWL....TGEGFRLE......................GPLGEEVEGR---L------------
SYFA_DEIRA/85-334ARDLQD----------TFWL.........................................EDG---R------------
SYFA_HELPJ/84-328ARDMQD----------TFYF....K....................................D.H---K------------
SYFA_XYLFA/93-332ARAMHD----------TFYF....G....................................D.G---R------------
Q98QL3_MYCPU/81-313ARDMQD----------SLYI.........................................NKN---L------------
SYFA_THEMA/90-325ARDEHD----------SFYI....T....................................D.D---L------------
SYFA_BACAN/92-341ARDMQD----------TFYI....T....................................E.E---T------------
SYFA_THEVO/209-478ARDMQD----------TFYVKDSNFTIEHPEIEKRIKRIHE...RGFDGYSGWGYRWSSDDGKK---L------------
SYFA_ECOLI/91-326ARADHD----------TFWF....D....................................T.T---R------------
SYFA_SYNY3/96-331ARDMQD----------TFFL....K....................................D.G---R------------
SYFA_AERPE/218-483AREIHD----------SLWIKSPRRGDLSGYSDLVERVA.......SVHERGWKYRWSPEVASR---Y------------
SYFA_ARCFU/200-469ARDMQD----------TFYLDRYIDLEGEIVERVKATHENG....WITGSTGWGGEWSLEKARQ---L------------
SYFA_MYCGE/88-339SRNESD----------SFYI.........................................DKT---S------------
SYFA_TREPA/280-552ARDIHD----------VYYLKHPTHAPTIPEPFLSRVAATHE.RGADSGSLGWRYSFDRDFTRR---L------------
SYFA_SCHPO/208-490ARDAQD----------TFFLKVPASTDKLPDPEYVARVKATHENGGETKGIGYRAPFSLEETRK---L------------
SYFA_CAUCR/91-342AREMHD----------TFFFNPKED....................................GER---M------------
SYFA_STRPN/97-347ARDMQD----------TFYI....T....................................E.E---I------------
SYFA_ENTFA/94-344ARDMQD----------TFYI....S....................................D.E---M------------
SYFA_RHILO/95-349AREMHD----------TFFFQPDEK....................................GER---K------------
SEPS_ARCFU/103-355VKILDE----------VFPEFKELKP..................................ISST---L------------
SYFA_TROWT/94-333AREESD----------TIFA.EPRS....................................A.S---M------------
SYFA_MYCLE/94-337ARSEQD----------TFYI.APDG....................................S.R---Q------------
SYFA_METJA/212-480AREMQD----------TFFLKYPNEGDIPEDLLSKVKE.........VHERCWKYKFDENVSRR---L------------
SYFA_STRCO/93-354ARGEAD----------TFFVQGPEGG..................................AESG---V------------
SYFA_SULSO/200-463AREIHD----------SFSVEGSGKIEDKDLLNNVKEI..........HEKFWKYEWKQDITLR---L------------

PF02091

SYGM2_ARATH/73-356-----E----------PWNV-----------------------------------------------A------------
SYG_CHLPN/8-291-----E----------PYKA-----------------------------------------------A------------
SYG_CHLTR/8-291-----E----------PFRT-----------------------------------------------A------------
SYGA_MORCA/9-296-----E----------RWNT-----------------------------------------------A------------
SYGA_ECOLI/9-298-----E----------PMAA-----------------------------------------------A------------
SYGA_COXBU/9-296-----E----------PWRA-----------------------------------------------A------------
SYGA_BACSU/3-286-----E----------PWKV-----------------------------------------------A------------
SYGA_HELPY/4-291-----K----------PWNV-----------------------------------------------A------------
SYGA_SYNY3/5-288-----E----------PWSV-----------------------------------------------A------------

PF03590

ASNA_STRPN/3-246ENPV------------SVKVLQIPDATYEVVHSLAKWKR----------------------------H------------
ASNA_TREPA/3-246EKAV------------SVSVKQIPGTAFEVVHSLAKWKR----------------------------H------------
ASNA_HAEIN/3-246EKAV------------QVNVKCIPNAVFEVVHSLAKWKR----------------------------H------------
ASNA_UREPA/6-240QKAV------------SFYAKKL.DKTLEIVQSLAKWKR----------------------------L------------
ASNA_PASMU/3-246EKAV------------QVNVKQITDATFEVVHSLAKWKR----------------------------H------------
ASNA_ECOLI/3-246EKAV------------QVKVKALPDAQFEVVHSLAKWKR----------------------------Q------------

PF01411

SYA_YEAST/38-617QYKP------------IFLGTVDPASDFYTLKRAYNSQK-----------------------------------------
SYAC_HUMAN/9-597QFKP------------IFLNTIDPSHPMAKLSRAANTQK-----------------------------------------
SYA_SCHPO/14-598QFKP------------IFLGTVDPSSDFAKLKRACDSQK-----------------------------------------
SYA_CHLPN/5-550QFKD------------IFLNKE.....KVSYSRATTSQK-----------------------------------------
SYA_SYNY3/12-554PFKP------------IFLGQK.....SAEFPRATTSQK-----------------------------------------
SYA_ARATH/63-638QYKP------------IFLGTADPNTELSKLSRACNTQK-----------------------------------------
SYA_PYRHO/61-605DFQP------------WVISGE....ADPPANPLVISQP-----------------------------------------
SYA_HAEIN/6-555QFKD------------VFLGMD.....KRPYSRATTAQR-----------------------------------------
SYA_THIFE/5-557PFKD------------VFLGLE.....TRPYRRAVSSQR-----------------------------------------
SYA_METTH/58-581NFQP------------WVTSGL....VKPPANPLVVAQP-----------------------------------------
SYA_METJA/61-582VFQP------------WITKGI....VKPKANPLVIAQP-----------------------------------------
SYA_MYCGE/7-560TLKD------------YFSARK.....TPPSKRLVNAQI-----------------------------------------
SYA_AQUAE/7-551PFKN------------VFLGLE.....KRPYKRATSCQK-----------------------------------------
SYA_CHLTR/5-553QFKN------------IFLGKE.....QTSYTRATTSQK-----------------------------------------
SYA_RICPR/8-559QFKN------------VFTGQE.....KRSYNKAVTSQK-----------------------------------------
SYA_BARBA/6-556DFKN------------VFTGLE.....KHSYNRATTAQK-----------------------------------------
SYAC_BOMMO/9-597QFKP------------IFLGSVDPNSDMAQYIRVVNTQK-----------------------------------------
SYA_THET8/5-566PLKP------------YFLGAKPI.FGGREWRRVTTCQE-----------------------------------------
SYA_MYCTU/5-576QFVP------------FFLGQR.....TPPYPTATSIQK-----------------------------------------
SYA_ARCFU/64-592DFQP------------FVTSGV....APPPANPLTISQP-----------------------------------------
SYAC_CAEEL/8-598QFKP------------LFLGIADPNSDLAKLKRAVNTQK-----------------------------------------
SYA_ECOLI/7-556QFKD------------VFLGLD.....KRNYSRATTSQR-----------------------------------------
SYA_MYCPN/7-559TLKD------------YFSAKK.....TPPSKRLANAQI-----------------------------------------
SYA_HELPY/2-546QFKD------------IFTGIV....PRPSIPRAASSQL-----------------------------------------
SYA_BACSU/8-558TLKK------------YFDGRV.....VPENPRIVNAQK-----------------------------------------

PF03099

LPLA_YEAST/163-273-----K--------------------------------------------------------------------------
Q9ZIU6_BORPT/40-170-----P--------------------------------------------------------------------------
Q9Z7T6_CHLPN/47-157-----D--------------------------------------------------------------------------
Q9ZD17_RICPR/16-161-----D--------------------------------------------------------------------------
O66622_AQUAE/46-165-----F--------------------------------------------------------------------------
Q9R9L1_RHIML/22-149-----N--------------------------------------------------------------------------
Q49107_MYCCA/44-154-----D--------------------------------------------------------------------------
O69817_STRCO/180-302-----H--------------------------------------------------------------------------
O27938_METTH/23-148-----G--------------------------------------------------------------------------
BPL1_YEAST/386-536-----T--------------------------------------------------------------------------
Q9Z740_CHLPN/7-132-----L--------------------------------------------------------------------------
O45303_CAEEL/54-165-----N--------------------------------------------------------------------------
LIPB_RICPR/47-164-----D--------------------------------------------------------------------------
LIPM_BACSU/51-189-----Y--------------------------------------------------------------------------
LIPB_CYACA/47-160-----T--------------------------------------------------------------------------
O67557_AQUAE/109-224-----E--------------------------------------------------------------------------
O84507_CHLTR/46-156-----D--------------------------------------------------------------------------
LIPB_KLULA/132-268-----K--------------------------------------------------------------------------
O73952_9EURY/15-131-----G--------------------------------------------------------------------------
O57883_PYRHO/15-131-----G--------------------------------------------------------------------------
O84730_CHLTR/7-132-----L--------------------------------------------------------------------------
BPL_METJA/5-126-----N--------------------------------------------------------------------------
O83376_TREPA/20-139-----G--------------------------------------------------------------------------
LPLA_AERPE/43-154-----E--------------------------------------------------------------------------
LPLA_MYCGE/47-159-----D--------------------------------------------------------------------------
O66837_AQUAE/7-123-----G--------------------------------------------------------------------------
LIPB_HAEIN/48-159-----S--------------------------------------------------------------------------
BPL1_SCHPO/358-503-----G--------------------------------------------------------------------------
P72816_SYNY3/40-164-----P--------------------------------------------------------------------------
LIPB_ECOLI/49-159-----G--------------------------------------------------------------------------
LPLA_SCHPO/66-176-----N--------------------------------------------------------------------------
O32511_DEIRD/91-219-----G--------------------------------------------------------------------------
Q9WZG7_THEMA/43-167-----D--------------------------------------------------------------------------
LIPB_PSEAE/48-158-----G--------------------------------------------------------------------------
Q9WY67_THEMA/8-130-----G--------------------------------------------------------------------------
P96884_MYCTU/32-158-----G--------------------------------------------------------------------------
Q9SL92_ARATH/116-244-----G--------------------------------------------------------------------------
O25760_HELPY/8-130-----P--------------------------------------------------------------------------
Q9V2B8_PYRAB/79-190-----Y--------------------------------------------------------------------------
Q8SX78_DROME/101-210-----R--------------------------------------------------------------------------
O30162_ARCFU/85-200-----D--------------------------------------------------------------------------
LIPT_BOVIN/74-185-----E--------------------------------------------------------------------------
LIPB_YEAST/125-262-----P--------------------------------------------------------------------------
O84287_CHLTR/47-181-----L--------------------------------------------------------------------------
BIRA_BACSU/88-214-----G--------------------------------------------------------------------------
BIRA_PARDE/1-127-----S--------------------------------------------------------------------------
LIPL_BACSU/62-186-----E--------------------------------------------------------------------------
LIPB_DEIRA/141-265-----Q--------------------------------------------------------------------------
Q52660_RHOCA/5-131-----P--------------------------------------------------------------------------
O67765_AQUAE/41-157-----L--------------------------------------------------------------------------
LPLJ_BACSU/44-155-----N--------------------------------------------------------------------------
LIPB_SYNY3/51-164-----P--------------------------------------------------------------------------
LIPB_MYCLE/54-171-----H--------------------------------------------------------------------------
BPL1_HUMAN/471-603-----G--------------------------------------------------------------------------
P74052_SYNY3/32-161-----Q--------------------------------------------------------------------------
Q9Y9E5_AERPE/44-177-----R--------------------------------------------------------------------------
BIRA_HAEIN/74-192-----G--------------------------------------------------------------------------
BIRA_ECOLI/83-208-----G--------------------------------------------------------------------------
LIPB_MYXXA/48-170-----E--------------------------------------------------------------------------
Q9V2C7_PYRAB/15-131-----G--------------------------------------------------------------------------
Q9UX52_SULSF/9-132-----D--------------------------------------------------------------------------
LIPB_SCHPO/60-172-----P--------------------------------------------------------------------------
Q9Z8A7_CHLPN/47-181-----L--------------------------------------------------------------------------
O59156_PYRHO/46-163-----L--------------------------------------------------------------------------
LIPT2_DROME/56-171-----L--------------------------------------------------------------------------
LPLA_ECOLI/46-158-----D--------------------------------------------------------------------------

PF04424

FA63A_HUMAN/143-268LQLNFQ--------------------------------------------------------------------------
FA63B_HUMAN/272-397QRLNYE--------------------------------------------------------------------------
YP191_YEAST/34-157....PS--------------------------------------------------------------------------
Q9T054_ARATH/67-194YIENQQ--------------------------------------------------------------------------
O82744_ARATH/44-169....DD--------------------------------------------------------------------------
YGI2_YEAST/34-157...GTD--------------------------------------------------------------------------
Q9N370_CAEEL/82-206LKETFE--------------------------------------------------------------------------
YAGB_SCHPO/65-177KAYGLC--------------------------------------------------------------------------

PF00587

SYG_YEAST/76-406GLVEDANAAAKDDAEKKKRKKKVKQIKAVKLDDDVVKEYEEILAKIDGYSGPELGELMEKYDIGNPVTGETLESPRAFNL
SYP_ZYMMO/49-218................................................................................
SYTM_SCHPO/78-251................................................................................
SYSM_SCHPO/220-399................................................................................
SYG_HUMAN/157-453KCSVEKKSEMESVLAQLDNYGQQELA.............................DLFVNYNVKSPITGNDLSPPVSFNL
SYT2_BACSU/275-439................................................................................
SYS_AERPE/198-368................................................................................
SYT1_AERPE/51-229................................................................................
SYH_ECOLI/21-188................................................................................
SYH_STREQ/19-188................................................................................
SYH_ORYSJ/369-529................................................................................
SYP_SYNY3/49-222................................................................................
SYG_THET8/42-301AMEVEEENLHALVQAMMQAPERAGGAM...........................TAAGVLDPASGEPGDWTPPRYFNMMF
SYH_HAEIN/21-187................................................................................
SYSC_HUMAN/203-386................................................................................
SYG_DEIRA/42-302FAALVAALNAKPAQASAAFKEAG...................................VRDPFSGEVGEWTDPKPFNMMF
SYH_PORPU/20-187................................................................................
SYP_HELPJ/49-219................................................................................
SYPC_CANAX/59-225................................................................................
SYSM_YEAST/191-366................................................................................
SYP_AQUAE/49-219................................................................................
SYG_CAEEL/167-463QDVLARLEGFDNKDMHEVITR.......................................FNFKSPITGNDLTEPIAFNL
O94025_CANAX/62-240................................................................................
SYTM_YEAST/68-246................................................................................
SYS_COXBU/172-344................................................................................
SYS_BUCAP/172-346................................................................................
SYS_HALMA/177-355................................................................................
SYH_METJA/21-183................................................................................
SYPM_HUMAN/97-268................................................................................
SYT_HELPY/249-413................................................................................
SYP_RICPR/49-219................................................................................
SYS_THEMA/175-346................................................................................
SYS_BORBU/171-341................................................................................
SYS_BACSU/173-344................................................................................
SYT_METTH/225-383................................................................................
SYG_ARCFU/39-308AVKEVMEVYDLKCE.....................................................CGGRFKDPAPMNL
SYT_BORBU/216-382................................................................................
SYH_MYCPN/20-187................................................................................
SYT_AQUAE/274-440................................................................................
Q9VUK8_DROME/189-485EDIIIKLDGLNKQELAGVLAK.......................................YNIKSPLTGNDLTEPIEFNL
SYH_ARCFU/19-179................................................................................
SYH_YEAST/71-233................................................................................
Q9VF85_DROME/153-322................................................................................
SYH_STAAW/18-186................................................................................
SYS_SYNY3/181-351................................................................................
O65395_ARATH/266-437................................................................................
SYT_CHLTR/267-432................................................................................
SYS_PYRHO/195-365................................................................................
SYG_METTH/42-319QELTEIISDEGIRCP...................................................RCGGHLTHVWSYNL
SYH_BACSU/19-187................................................................................
SYS_SULSO/195-365................................................................................
SYS_STRCO/173-343................................................................................
YHI0_YEAST/227-403................................................................................
SYH_THET8/19-186................................................................................
SYT_PYRAB/237-399................................................................................
SYT_METJA/228-387................................................................................
SYP_MYCTU/51-221................................................................................
SYH_AQUAE/19-186................................................................................
SYTC_YEAST/359-523................................................................................
SYH_DEIRA/28-196................................................................................
SYS_MYCPN/169-338................................................................................
SYP_BACSU/49-219................................................................................
SYT_SYNY3/228-403................................................................................
SYT_THEMA/271-435................................................................................
SYP_TREPA/47-217................................................................................
SYHM_HUMAN/73-235................................................................................
SYT_RICPR/272-437................................................................................
SYP_ECOLI/49-219................................................................................
SYS_ARATH/179-353................................................................................
SYP_CHLTR/49-221................................................................................
SYG_AERPE/42-324SELDRIIRERGLRCP...................................................VCQGELGRVETFNL
SYH_CHLPN/28-193................................................................................
SYT_HAEIN/273-438................................................................................
SYH_TREPA/25-187................................................................................
SYH_RICPR/21-188................................................................................
SYS_ARCFU/192-362................................................................................
O45869_CAEEL/49-223................................................................................
SYS_HELPJ/174-344................................................................................
SYH_SCHPO/79-242................................................................................
SYG2_YEAST/45-343EKILTTIDGFSGPELNLVMQE.......................................YNINDPVTNDVLDALTSFNL
SYHC_HUMAN/72-234................................................................................
SYT_MYCLE/310-489................................................................................
SYS_THET2/168-340................................................................................
SYP_THEMA/49-219................................................................................
SYT_DEIRA/279-448................................................................................
SYS_AQUAE/174-344................................................................................
SYT_ARCFU/227-389................................................................................
SYS_MYCTU/169-339................................................................................
SYG_MYCTU/45-278LADIRDPETGEPG.......................................................QWTQPREFNMML
SYTC_HUMAN/352-516................................................................................
SYT_MYCPN/198-368................................................................................
SYPM_YEAST/56-225................................................................................
SYH_MYCGE/20-187................................................................................
SYH_THEMA/19-186................................................................................
SYG_PYRAB/44-320EEMTKIIREHNIKCP...................................................ECGGELGDVFYFNL
SYG_METJA/42-324KELDELIRKHNIRCP...................................................KCGGELGEVKKFNL
SYS_RICPR/171-341................................................................................
SYH_METTH/19-182................................................................................
SYH_MYCLE/30-193................................................................................
SYS_DEIRA/170-342................................................................................
SYS_HAEIN/173-348................................................................................
SYPM_SCHPO/54-224................................................................................
SYT1_BACSU/276-446................................................................................
SYT_TREPA/223-390................................................................................
SYS_TREPA/171-342................................................................................
SYTM_ARATH/346-510................................................................................
SYSC_SCHPO/179-353................................................................................
SYS_STAA8/173-344................................................................................
SYH_CHLTR/28-193................................................................................
O82413_ARATH/85-250................................................................................
SYS_CHLPN/172-344................................................................................
SYH_SYNY3/20-187................................................................................

PF13393

Q1K3M2_DESAC/22-332--------------------------------------------------------------------------------
B5JRM1_9GAMM/12-323--------------------------------------------------------------------------------
C0N861_9GAMM/12-325--------------------------------------------------------------------------------
HISZ_PSEU5/12-321--------------------------------------------------------------------------------
B0SA16_LEPBA/18-333--------------------------------------------------------------------------------
HISZ_ANAD2/9-318--------------------------------------------------------------------------------
HISZ_ALHEH/17-328--------------------------------------------------------------------------------
HISZ_MICAN/8-319--------------------------------------------------------------------------------
C8WUX4_ALIAD/25-356--------------------------------------------------------------------------------
HISZ_THISH/12-323--------------------------------------------------------------------------------
HISZ_ANADF/9-318--------------------------------------------------------------------------------
Q2BIN1_9GAMM/12-324--------------------------------------------------------------------------------
HISZ_HAHCH/12-320--------------------------------------------------------------------------------
E6W5Z4_DESIS/15-323--------------------------------------------------------------------------------
C9YB19_9BURK/9-313--------------------------------------------------------------------------------
C6XEF7_METSD/9-315--------------------------------------------------------------------------------
A1WUT1_HALHL/12-323--------------------------------------------------------------------------------
C4KMP4_BURPE/9-313--------------------------------------------------------------------------------
HISZ_LARHH/9-314--------------------------------------------------------------------------------
HISZ_METFK/9-315--------------------------------------------------------------------------------
HISZ_RALME/10-314--------------------------------------------------------------------------------
B6C6F9_9GAMM/12-321--------------------------------------------------------------------------------
D5CRS6_SIDLE/8-314--------------------------------------------------------------------------------
D0LNQ8_HALO1/14-324--------------------------------------------------------------------------------
HISZ_CELJU/17-327--------------------------------------------------------------------------------
HISZ_CHRSD/12-323--------------------------------------------------------------------------------
HISZ_TERTT/12-323--------------------------------------------------------------------------------
A0Y7Z9_9GAMM/12-323--------------------------------------------------------------------------------
Q0VMF2_ALCBS/13-322--------------------------------------------------------------------------------
A3RVD4_RALSL/9-313--------------------------------------------------------------------------------
C6WV54_METML/9-315--------------------------------------------------------------------------------
B9Z696_9NEIS/9-315--------------------------------------------------------------------------------
HISZ_NITEU/9-320--------------------------------------------------------------------------------
A4BLP9_9GAMM/17-328--------------------------------------------------------------------------------
HISZ_SACD2/12-323--------------------------------------------------------------------------------
Q1YRY2_9GAMM/12-321--------------------------------------------------------------------------------
HISZ_JANMA/9-313--------------------------------------------------------------------------------
HISZ_METCA/17-328--------------------------------------------------------------------------------
HISZ_MARMS/12-324--------------------------------------------------------------------------------
HISZ_POLNS/9-318--------------------------------------------------------------------------------
HISZ_VARPS/9-317--------------------------------------------------------------------------------
B7RW37_9GAMM/12-322--------------------------------------------------------------------------------
HISZ_NITMU/11-321--------------------------------------------------------------------------------
D3RSK9_ALLVD/11-321--------------------------------------------------------------------------------
Q1N278_9GAMM/12-321--------------------------------------------------------------------------------
HISZ_MARAV/12-322--------------------------------------------------------------------------------
HISZ_AROAE/8-312--------------------------------------------------------------------------------
D1YNU9_9FIRM/9-314--------------------------------------------------------------------------------
C7RU27_ACCPU/8-312--------------------------------------------------------------------------------
A3YHH2_9GAMM/12-323--------------------------------------------------------------------------------
D9SFI4_GALCS/9-316--------------------------------------------------------------------------------
HISZ_THICR/11-322--------------------------------------------------------------------------------
HISZ_DECAR/8-312--------------------------------------------------------------------------------
HISZ_THIDA/9-313--------------------------------------------------------------------------------
D3SBT1_THISK/12-326--------------------------------------------------------------------------------
HISZ_RHOFD/9-313--------------------------------------------------------------------------------
B8KW68_9GAMM/12-325--------------------------------------------------------------------------------
A6GNJ9_9BURK/9-322--------------------------------------------------------------------------------
B7X1H5_COMTE/9-313--------------------------------------------------------------------------------
A0Z0R0_9GAMM/12-324--------------------------------------------------------------------------------
HISZ_ACIAC/9-313--------------------------------------------------------------------------------
B5EJB1_ACIF5/15-325--------------------------------------------------------------------------------
A3EWA4_9BACT/25-339--------------------------------------------------------------------------------
Q12AC8_POLSJ/13-319--------------------------------------------------------------------------------
HISZ_BORPA/9-316--------------------------------------------------------------------------------
HISZ_VEREI/9-313--------------------------------------------------------------------------------
HISZ_ACISJ/9-313--------------------------------------------------------------------------------
D4DMZ4_NEIEG/10-317--------------------------------------------------------------------------------
A4A6K0_9GAMM/15-328--------------------------------------------------------------------------------
HISZ_AQUAE/8-290--------------------------------------------------------------------------------
HISZ_THET2/5-297--------------------------------------------------------------------------------
C1CVJ4_DEIDV/29-323--------------------------------------------------------------------------------
Q1J099_DEIGD/30-328--------------------------------------------------------------------------------
A6G000_9DELT/27-343--------------------------------------------------------------------------------
D0KVK0_HALNC/13-326--------------------------------------------------------------------------------
A4BEB8_9GAMM/12-323--------------------------------------------------------------------------------
HISZ_DEIRA/31-328--------------------------------------------------------------------------------
HISZ_LEPIC/17-331--------------------------------------------------------------------------------
A3Z6V4_9SYNE/8-318--------------------------------------------------------------------------------
HISZ_PROMT/8-318--------------------------------------------------------------------------------
A2SHA5_METPP/10-318--------------------------------------------------------------------------------
C6NXF6_9GAMM/15-326--------------------------------------------------------------------------------
Q067E0_9SYNE/8-318--------------------------------------------------------------------------------
HISZ_PROM4/8-318--------------------------------------------------------------------------------
D0SC52_ACIJO/12-322--------------------------------------------------------------------------------
HISZ_SYNPX/8-318--------------------------------------------------------------------------------
HISZ_BORA1/9-316--------------------------------------------------------------------------------
B1XXK3_LEPCP/10-318--------------------------------------------------------------------------------
B5IJM2_9CHRO/8-318--------------------------------------------------------------------------------
D0CJ76_9SYNE/8-318--------------------------------------------------------------------------------
B0VFH4_CLOAI/7-312--------------------------------------------------------------------------------
B6BTN9_9PROT/10-316--------------------------------------------------------------------------------
HISZ_PSYA2/5-314--------------------------------------------------------------------------------
HISZ_SYNR3/8-318--------------------------------------------------------------------------------
A5WGG0_PSYWF/34-354--------------------------------------------------------------------------------
D1KE67_9GAMM/9-315--------------------------------------------------------------------------------
Q0IAC0_SYNS3/25-335--------------------------------------------------------------------------------
D3P4X4_AZOS1/14-318--------------------------------------------------------------------------------
A8TQZ8_9PROT/17-319--------------------------------------------------------------------------------
D2Z2L9_9BACT/13-312--------------------------------------------------------------------------------
B1X3U7_PAUCH/8-318--------------------------------------------------------------------------------
C7JCL4_ACEP3/27-328--------------------------------------------------------------------------------
Q0BTV8_GRABC/14-327--------------------------------------------------------------------------------
HISZ_RHOCS/16-317--------------------------------------------------------------------------------
D3L2N6_9BACT/7-310--------------------------------------------------------------------------------
A9HLQ2_GLUDA/27-327--------------------------------------------------------------------------------
HISZ_RHORT/16-319--------------------------------------------------------------------------------
C8PZK1_9GAMM/30-351--------------------------------------------------------------------------------
D3DJN8_HYDTT/9-286--------------------------------------------------------------------------------
Q2G4V6_NOVAD/12-320--------------------------------------------------------------------------------
C8WED5_ZYMMN/11-310--------------------------------------------------------------------------------
D3SMU8_THEAH/10-286--------------------------------------------------------------------------------
Q5UF78_9PROT/11-312--------------------------------------------------------------------------------
A5VFF4_SPHWW/22-321--------------------------------------------------------------------------------
C4L169_EXISA/13-302--------------------------------------------------------------------------------
Q1NEW5_9SPHN/12-315--------------------------------------------------------------------------------
Q2NCV4_ERYLH/16-312--------------------------------------------------------------------------------
A3W9X6_9SPHN/22-321--------------------------------------------------------------------------------
A5PDB1_9SPHN/11-307--------------------------------------------------------------------------------
Q1GVI6_SPHAL/11-307--------------------------------------------------------------------------------
A6Q5H3_NITSB/10-275--------------------------------------------------------------------------------
A7I327_CAMHC/12-273--------------------------------------------------------------------------------
HISZ_WOLSU/12-276--------------------------------------------------------------------------------
A5LME0_STRPN/14-307--------------------------------------------------------------------------------
A8ER44_ARCB4/10-275--------------------------------------------------------------------------------
B6BHN3_9PROT/10-276--------------------------------------------------------------------------------
C5EYR6_9HELI/22-286--------------------------------------------------------------------------------
C3XLA7_9HELI/10-286--------------------------------------------------------------------------------
HISZ_HELHP/10-274--------------------------------------------------------------------------------

PF00152

Q7NBK8_MYCGA/10-341--------------------------------------------------------------------------------
SYK_HUMAN/222-575--------------------------------------------------------------------------------
Q6BRH4_DEBHA/177-668--------------------------------------------------------------------------------
Q6BZ12_DEBHA/190-549--------------------------------------------------------------------------------
Q6C814_YARLI/181-540--------------------------------------------------------------------------------
SYK_RHIME/154-495--------------------------------------------------------------------------------
SYD_SYNPX/123-576--------------------------------------------------------------------------------
SYD_AQUAE/128-577--------------------------------------------------------------------------------
SYD_BDEBA/162-604--------------------------------------------------------------------------------
SYNC_ENCCU/175-498--------------------------------------------------------------------------------
Q6F944_ACIAD/4-329--------------------------------------------------------------------------------
Q7UK37_RHOBA/210-545--------------------------------------------------------------------------------
SYD_CAMJE/119-554--------------------------------------------------------------------------------
SYD_THEAC/112-424--------------------------------------------------------------------------------
Q6C700_YARLI/128-469--------------------------------------------------------------------------------
Q6CLY6_KLULA/143-620--------------------------------------------------------------------------------
SYD_SULSO/113-425--------------------------------------------------------------------------------
SYD_TREPA/137-576--------------------------------------------------------------------------------
SYD_PSESM/120-560--------------------------------------------------------------------------------
SYKM_SCHPO/182-530--------------------------------------------------------------------------------
SYD_BRAJA/121-561--------------------------------------------------------------------------------
Q7NBS8_MYCGA/119-554--------------------------------------------------------------------------------
SYK1_MYCTU/156-502--------------------------------------------------------------------------------
Q6CX40_KLULA/145-470--------------------------------------------------------------------------------
SYD_METTH/121-433--------------------------------------------------------------------------------
SYD_HALVO/113-429--------------------------------------------------------------------------------
SYK_CHLTR/170-520--------------------------------------------------------------------------------
SYD_TREDE/124-564--------------------------------------------------------------------------------
SYD_MYCLE/116-559--------------------------------------------------------------------------------
SYD_HALSA/115-432--------------------------------------------------------------------------------
SYD_GEOSL/128-566--------------------------------------------------------------------------------
SYD_BORBU/118-557--------------------------------------------------------------------------------
SYD_ENTFA/122-560--------------------------------------------------------------------------------
SYD_MYCGE/108-524--------------------------------------------------------------------------------
SYK_SULSO/147-487--------------------------------------------------------------------------------
SYD_MYCPE/119-554--------------------------------------------------------------------------------
SYN_MYCGE/116-452--------------------------------------------------------------------------------
SYD1_STRMU/118-557--------------------------------------------------------------------------------
SYNM_MOUSE/135-473--------------------------------------------------------------------------------
SYD_THEMA/117-552--------------------------------------------------------------------------------
Q98QM9_MYCPU/122-552--------------------------------------------------------------------------------
SYD_BACTN/119-557--------------------------------------------------------------------------------
SYD_RHOBA/122-563--------------------------------------------------------------------------------
SYD_VIBCH/117-559--------------------------------------------------------------------------------
SYD_BLOFL/118-566--------------------------------------------------------------------------------
SYN_BACHD/109-426--------------------------------------------------------------------------------
SYD_THETN/128-566--------------------------------------------------------------------------------
Q6KI16_MYCMO/110-541--------------------------------------------------------------------------------
Q7P704_FUSNV/123-564--------------------------------------------------------------------------------
SYDM_SCHPO/138-579--------------------------------------------------------------------------------
SYD_STRR6/120-554--------------------------------------------------------------------------------
SYD_STRCO/121-557--------------------------------------------------------------------------------
SYD_DESPS/140-579--------------------------------------------------------------------------------
Q6NEX1_CORDI/708-1045--------------------------------------------------------------------------------
SYD_BIFLO/126-568--------------------------------------------------------------------------------
YJEA_BUCBP/1-322--------------------------------------------------------------------------------
SYN_THEAC/109-425--------------------------------------------------------------------------------
Q7UH30_RHOBA/67-394--------------------------------------------------------------------------------
SYK_PORGI/163-502--------------------------------------------------------------------------------
SYD_NEIMA/118-568--------------------------------------------------------------------------------
Q97DB5_CLOAB/160-475--------------------------------------------------------------------------------
Q7Q3E7_ANOGA/129-574--------------------------------------------------------------------------------
SYK_UREPA/150-490--------------------------------------------------------------------------------
SYD_LACJO/120-559--------------------------------------------------------------------------------
SYD_UREPA/115-551--------------------------------------------------------------------------------
SYK_BUCAI/162-503--------------------------------------------------------------------------------
Q74MV5_NANEQ/94-400--------------------------------------------------------------------------------
SYD_CHLTR/123-558--------------------------------------------------------------------------------
SYD_BUCAI/117-559--------------------------------------------------------------------------------
SYD_AERPE/118-438--------------------------------------------------------------------------------
Q8PAB4_XANCP/1-324--------------------------------------------------------------------------------
SYD_BACSU/123-562--------------------------------------------------------------------------------
SYK_DEIRA/167-507--------------------------------------------------------------------------------
Q8D388_WIGBR/116-550--------------------------------------------------------------------------------
SYD_THETH/123-553--------------------------------------------------------------------------------
SYD_COXBU/119-561--------------------------------------------------------------------------------
SYN_LEPIN/113-431--------------------------------------------------------------------------------
SYD_BRUSU/121-565--------------------------------------------------------------------------------
SYD_DESVH/142-576--------------------------------------------------------------------------------
SYD_PARUW/129-567--------------------------------------------------------------------------------
O81892_ARATH/198-611--------------------------------------------------------------------------------
SYD_PYRAE/116-424--------------------------------------------------------------------------------
Q7SFD2_NEUCR/259-590--------------------------------------------------------------------------------
SYD_PROMP/123-570--------------------------------------------------------------------------------
SYD_NITEU/118-561--------------------------------------------------------------------------------
Q8ZUX9_PYRAE/23-343--------------------------------------------------------------------------------
Q9VJH2_DROME/521-960--------------------------------------------------------------------------------
Q8EX85_LEPIN/1-330--------------------------------------------------------------------------------
Q8ZWD4_PYRAE/145-481--------------------------------------------------------------------------------
SYD_BUCBP/117-561--------------------------------------------------------------------------------
SYD_GLOVI/120-563--------------------------------------------------------------------------------
SYD_LEPIN/129-574--------------------------------------------------------------------------------
SYD_CLOTE/126-566--------------------------------------------------------------------------------
SYNC_HUMAN/225-544--------------------------------------------------------------------------------
Q9LCY8_THETH/104-418--------------------------------------------------------------------------------
Q9HKI9_THEAC/20-325--------------------------------------------------------------------------------
SYK2_METMA/169-509--------------------------------------------------------------------------------
SYD_STAAS/123-562--------------------------------------------------------------------------------
SYK_CHRVO/160-501--------------------------------------------------------------------------------
SYD_MESFL/115-551--------------------------------------------------------------------------------
Q6MPY6_BDEBA/81-404--------------------------------------------------------------------------------
SYD_WOLPM/133-574--------------------------------------------------------------------------------
SYD_CHLTE/133-572--------------------------------------------------------------------------------
SYN_PYRHO/114-430--------------------------------------------------------------------------------
SYD_XYLFA/120-560--------------------------------------------------------------------------------
SYDM_YEAST/144-629--------------------------------------------------------------------------------
Q9F112_RHIRD/4-352--------------------------------------------------------------------------------

PF01409

SEPS_METJA/103-348--------------------------------------------------------------------------------
SYFA_YEAST/212-492--------------------------------------------------------------------------------
SYFA_CHLMU/94-340--------------------------------------------------------------------------------
SYFA_COXBU/92-328--------------------------------------------------------------------------------
SYFA_HALSA/219-498--------------------------------------------------------------------------------
SYFA_NITEU/97-344--------------------------------------------------------------------------------
SYFA_CLOAB/92-339--------------------------------------------------------------------------------
Q9GYS8_CAEEL/265-545--------------------------------------------------------------------------------
SEPS_METTH/101-347--------------------------------------------------------------------------------
SYFA_AQUAE/91-337--------------------------------------------------------------------------------
SYFA_BACHD/92-341--------------------------------------------------------------------------------
SYFA_BUCAI/91-326--------------------------------------------------------------------------------
SYFA_NEIMA/91-328--------------------------------------------------------------------------------
SYFA_PSEAE/91-337--------------------------------------------------------------------------------
SYFA_RICPR/92-334--------------------------------------------------------------------------------
SYFA_PYRAB/223-496--------------------------------------------------------------------------------
SYFA_STAAW/94-343--------------------------------------------------------------------------------
SYFA_UREPA/86-332--------------------------------------------------------------------------------
SYFA_METTH/232-503--------------------------------------------------------------------------------
SYFA_ARATH/198-478--------------------------------------------------------------------------------
SYFA_CAMJE/84-329--------------------------------------------------------------------------------
SYFA_THETH/85-346--------------------------------------------------------------------------------
SYFA_DEIRA/85-334--------------------------------------------------------------------------------
SYFA_HELPJ/84-328--------------------------------------------------------------------------------
SYFA_XYLFA/93-332--------------------------------------------------------------------------------
Q98QL3_MYCPU/81-313--------------------------------------------------------------------------------
SYFA_THEMA/90-325--------------------------------------------------------------------------------
SYFA_BACAN/92-341--------------------------------------------------------------------------------
SYFA_THEVO/209-478--------------------------------------------------------------------------------
SYFA_ECOLI/91-326--------------------------------------------------------------------------------
SYFA_SYNY3/96-331--------------------------------------------------------------------------------
SYFA_AERPE/218-483--------------------------------------------------------------------------------
SYFA_ARCFU/200-469--------------------------------------------------------------------------------
SYFA_MYCGE/88-339--------------------------------------------------------------------------------
SYFA_TREPA/280-552--------------------------------------------------------------------------------
SYFA_SCHPO/208-490--------------------------------------------------------------------------------
SYFA_CAUCR/91-342--------------------------------------------------------------------------------
SYFA_STRPN/97-347--------------------------------------------------------------------------------
SYFA_ENTFA/94-344--------------------------------------------------------------------------------
SYFA_RHILO/95-349--------------------------------------------------------------------------------
SEPS_ARCFU/103-355--------------------------------------------------------------------------------
SYFA_TROWT/94-333--------------------------------------------------------------------------------
SYFA_MYCLE/94-337--------------------------------------------------------------------------------
SYFA_METJA/212-480--------------------------------------------------------------------------------
SYFA_STRCO/93-354--------------------------------------------------------------------------------
SYFA_SULSO/200-463--------------------------------------------------------------------------------

PF02091

SYGM2_ARATH/73-356--------------------------------------------------------------------------------
SYG_CHLPN/8-291--------------------------------------------------------------------------------
SYG_CHLTR/8-291--------------------------------------------------------------------------------
SYGA_MORCA/9-296--------------------------------------------------------------------------------
SYGA_ECOLI/9-298--------------------------------------------------------------------------------
SYGA_COXBU/9-296--------------------------------------------------------------------------------
SYGA_BACSU/3-286--------------------------------------------------------------------------------
SYGA_HELPY/4-291--------------------------------------------------------------------------------
SYGA_SYNY3/5-288--------------------------------------------------------------------------------

PF03590

ASNA_STRPN/3-246--------------------------------------------------------------------------------
ASNA_TREPA/3-246--------------------------------------------------------------------------------
ASNA_HAEIN/3-246--------------------------------------------------------------------------------
ASNA_UREPA/6-240--------------------------------------------------------------------------------
ASNA_PASMU/3-246--------------------------------------------------------------------------------
ASNA_ECOLI/3-246--------------------------------------------------------------------------------

PF01411

SYA_YEAST/38-617--------------------------------------------------------------------------------
SYAC_HUMAN/9-597--------------------------------------------------------------------------------
SYA_SCHPO/14-598--------------------------------------------------------------------------------
SYA_CHLPN/5-550--------------------------------------------------------------------------------
SYA_SYNY3/12-554--------------------------------------------------------------------------------
SYA_ARATH/63-638--------------------------------------------------------------------------------
SYA_PYRHO/61-605--------------------------------------------------------------------------------
SYA_HAEIN/6-555--------------------------------------------------------------------------------
SYA_THIFE/5-557--------------------------------------------------------------------------------
SYA_METTH/58-581--------------------------------------------------------------------------------
SYA_METJA/61-582--------------------------------------------------------------------------------
SYA_MYCGE/7-560--------------------------------------------------------------------------------
SYA_AQUAE/7-551--------------------------------------------------------------------------------
SYA_CHLTR/5-553--------------------------------------------------------------------------------
SYA_RICPR/8-559--------------------------------------------------------------------------------
SYA_BARBA/6-556--------------------------------------------------------------------------------
SYAC_BOMMO/9-597--------------------------------------------------------------------------------
SYA_THET8/5-566--------------------------------------------------------------------------------
SYA_MYCTU/5-576--------------------------------------------------------------------------------
SYA_ARCFU/64-592--------------------------------------------------------------------------------
SYAC_CAEEL/8-598--------------------------------------------------------------------------------
SYA_ECOLI/7-556--------------------------------------------------------------------------------
SYA_MYCPN/7-559--------------------------------------------------------------------------------
SYA_HELPY/2-546--------------------------------------------------------------------------------
SYA_BACSU/8-558--------------------------------------------------------------------------------

PF03099

LPLA_YEAST/163-273--------------------------------------------------------------------------------
Q9ZIU6_BORPT/40-170--------------------------------------------------------------------------------
Q9Z7T6_CHLPN/47-157--------------------------------------------------------------------------------
Q9ZD17_RICPR/16-161--------------------------------------------------------------------------------
O66622_AQUAE/46-165--------------------------------------------------------------------------------
Q9R9L1_RHIML/22-149--------------------------------------------------------------------------------
Q49107_MYCCA/44-154--------------------------------------------------------------------------------
O69817_STRCO/180-302--------------------------------------------------------------------------------
O27938_METTH/23-148--------------------------------------------------------------------------------
BPL1_YEAST/386-536--------------------------------------------------------------------------------
Q9Z740_CHLPN/7-132--------------------------------------------------------------------------------
O45303_CAEEL/54-165--------------------------------------------------------------------------------
LIPB_RICPR/47-164--------------------------------------------------------------------------------
LIPM_BACSU/51-189--------------------------------------------------------------------------------
LIPB_CYACA/47-160--------------------------------------------------------------------------------
O67557_AQUAE/109-224--------------------------------------------------------------------------------
O84507_CHLTR/46-156--------------------------------------------------------------------------------
LIPB_KLULA/132-268--------------------------------------------------------------------------------
O73952_9EURY/15-131--------------------------------------------------------------------------------
O57883_PYRHO/15-131--------------------------------------------------------------------------------
O84730_CHLTR/7-132--------------------------------------------------------------------------------
BPL_METJA/5-126--------------------------------------------------------------------------------
O83376_TREPA/20-139--------------------------------------------------------------------------------
LPLA_AERPE/43-154--------------------------------------------------------------------------------
LPLA_MYCGE/47-159--------------------------------------------------------------------------------
O66837_AQUAE/7-123--------------------------------------------------------------------------------
LIPB_HAEIN/48-159--------------------------------------------------------------------------------
BPL1_SCHPO/358-503--------------------------------------------------------------------------------
P72816_SYNY3/40-164--------------------------------------------------------------------------------
LIPB_ECOLI/49-159--------------------------------------------------------------------------------
LPLA_SCHPO/66-176--------------------------------------------------------------------------------
O32511_DEIRD/91-219--------------------------------------------------------------------------------
Q9WZG7_THEMA/43-167--------------------------------------------------------------------------------
LIPB_PSEAE/48-158--------------------------------------------------------------------------------
Q9WY67_THEMA/8-130--------------------------------------------------------------------------------
P96884_MYCTU/32-158--------------------------------------------------------------------------------
Q9SL92_ARATH/116-244--------------------------------------------------------------------------------
O25760_HELPY/8-130--------------------------------------------------------------------------------
Q9V2B8_PYRAB/79-190--------------------------------------------------------------------------------
Q8SX78_DROME/101-210--------------------------------------------------------------------------------
O30162_ARCFU/85-200--------------------------------------------------------------------------------
LIPT_BOVIN/74-185--------------------------------------------------------------------------------
LIPB_YEAST/125-262--------------------------------------------------------------------------------
O84287_CHLTR/47-181--------------------------------------------------------------------------------
BIRA_BACSU/88-214--------------------------------------------------------------------------------
BIRA_PARDE/1-127--------------------------------------------------------------------------------
LIPL_BACSU/62-186--------------------------------------------------------------------------------
LIPB_DEIRA/141-265--------------------------------------------------------------------------------
Q52660_RHOCA/5-131--------------------------------------------------------------------------------
O67765_AQUAE/41-157--------------------------------------------------------------------------------
LPLJ_BACSU/44-155--------------------------------------------------------------------------------
LIPB_SYNY3/51-164--------------------------------------------------------------------------------
LIPB_MYCLE/54-171--------------------------------------------------------------------------------
BPL1_HUMAN/471-603--------------------------------------------------------------------------------
P74052_SYNY3/32-161--------------------------------------------------------------------------------
Q9Y9E5_AERPE/44-177--------------------------------------------------------------------------------
BIRA_HAEIN/74-192--------------------------------------------------------------------------------
BIRA_ECOLI/83-208--------------------------------------------------------------------------------
LIPB_MYXXA/48-170--------------------------------------------------------------------------------
Q9V2C7_PYRAB/15-131--------------------------------------------------------------------------------
Q9UX52_SULSF/9-132--------------------------------------------------------------------------------
LIPB_SCHPO/60-172--------------------------------------------------------------------------------
Q9Z8A7_CHLPN/47-181--------------------------------------------------------------------------------
O59156_PYRHO/46-163--------------------------------------------------------------------------------
LIPT2_DROME/56-171--------------------------------------------------------------------------------
LPLA_ECOLI/46-158--------------------------------------------------------------------------------

PF04424

FA63A_HUMAN/143-268--------------------------------------------------------------------------------
FA63B_HUMAN/272-397--------------------------------------------------------------------------------
YP191_YEAST/34-157--------------------------------------------------------------------------------
Q9T054_ARATH/67-194--------------------------------------------------------------------------------
O82744_ARATH/44-169--------------------------------------------------------------------------------
YGI2_YEAST/34-157--------------------------------------------------------------------------------
Q9N370_CAEEL/82-206--------------------------------------------------------------------------------
YAGB_SCHPO/65-177--------------------------------------------------------------------------------

PF00587

SYG_YEAST/76-406MFETAIGPSGQLKGYLRPE----TAQGQFLNFNK-L-L-------EFNNSK..T----P-FA-SA---------------
SYP_ZYMMO/49-218..............LYGPT----NEEMITALIRD-N-L-------QS.YRD..L----P-RI-FY---------------
SYTM_SCHPO/78-251..............GLKPM----NCPGHCIVYAS-T-E-------RS.YKE..L----P-LR-FA---------------
SYSM_SCHPO/220-399..............CLIGT----AEISLAALGFK-K-T-------FN..NF..T----E-RK-VV---------------
SYG_HUMAN/157-453MFKTFIGPGGNMPGYLRPE----TAQGIFLNFKR-L-L-------EFNQGK..L----P-FA-AA---------------
SYT2_BACSU/275-439..............AMKPM----NCPGHMLIFKN-S-L-------YS.YRD..L----P-IR-MA---------------
SYS_AERPE/198-368..............YLIAT----AEHPLAALYYN-S-E-------IY.DED..L----P-LK-LV---------------
SYT1_AERPE/51-229..............AVKPM----NCPYHILLFLN-E-V-------AKHRSKLPL----P-FK-VF---------------
SYH_ECOLI/21-188..............TLRPE----GTAGCVRAGIE-H-G-------LL.YN...Q----E-QR-LW---------------
SYH_STREQ/19-188..............TLRPE----GTAPVVRSYVE-N-K-------LFAPEV.QK----P-VK-LY---------------
SYH_ORYSJ/369-529..............SLRYD----LTVPFARYVAM-N-N-------IS.S.....----.-LK-RY---------------
SYP_SYNY3/49-222..............GLGPT----HEEVITAIAKE-M-I-------RS.YRQ..L----P-VN-LY---------------
SYG_THET8/42-301KTYVGPVEDEASLAYLRPE----TAQGIFVNFKN-V-L-------DATSRK..L----P-FG-IA---------------
SYH_HAEIN/21-187..............TLRPE----GTAGCVRAAIE-H-G-------WI.YNN...----E-QR-LW---------------
SYSC_HUMAN/203-386..............YLIAT----SEQPIAALHRD-E-W-------LR.PED..L----P-IK-YA---------------
SYG_DEIRA/42-302RTTIGPVADEESYGYLRPE----TAQGIFTNFKN-V-V-------DSTSRR..L----P-FG-IA---------------
SYH_PORPU/20-187..............TLRPE----GTAGVVRAFIE-N-R-------MDVQN...R----L-QK-LW---------------
SYP_HELPJ/49-219..............VLSPT----LEENITEIAAN-F-I-------K.SYKQ..L----P-VH-LY---------------
SYPC_CANAX/59-225..............LLVPT----AEEEITNYVKK-Q-F-------LESYKN..F----P-LA-LY---------------
SYSM_YEAST/191-366..............GLVAT----AEIPLAGLGAN-K-V-------LELNSG.EC----S-KK-LV---------------
SYP_AQUAE/49-219..............CLGPT----HEEEITDLVRR-V-V-------R.SYRQ..L----P-VI-LY---------------
SYG_CAEEL/167-463MFPTQIGPTGDFKAFLRPE----TAQGIFVNFKR-L-L-------EFNQGK..L----P-FA-AA---------------
O94025_CANAX/62-240..............GLKPM----NCPSHCMIFAK-F-D-------RS.YQE..L----P-VR-YS---------------
SYTM_YEAST/68-246..............GLKPM----NCPGHCLIFGK-K-D-------RS.YNE..L----P-LR-FS---------------
SYS_COXBU/172-344..............FLVPT----GEVPLVNLARD-E-I-------IE.APA..L----P-KK-WV---------------
SYS_BUCAP/172-346..............VLIPT----AEVPLTNLFSN-Q-I-------LN.ETE..L----P-IM-LT---------------
SYS_HALMA/177-355..............WLLPT----AEVPVTNMYRG-E-I-------LL.DDD..L----P-VK-HQ---------------
SYH_METJA/21-183..............ALRPE----MTSPVVRFYLN-E-L-------KNLQ....K----P-LR-LY---------------
SYPM_HUMAN/97-268..............CLGPT----HEEAITALIAS-Q-K-------KLSYKQ..L----P-FL-LY---------------
SYT_HELPY/249-413..............GIKPM----NCVGHIKVYQS-A-L-------HS.YRD..L----P-LR-FY---------------
SYP_RICPR/49-219..............LFGPT----NEDMITDIFRR-N-I-------K.SYKD..L----P-KN-LY---------------
SYS_THEMA/175-346..............FLIPT----AEVPLAALHSG-E-I-------LE.EKE..L----P-KK-YV---------------
SYS_BORBU/171-341..............YLVGT----SEITLGGYYYN-K-I-------IDLT....L----P-IR-MA---------------
SYS_BACSU/173-344..............FLIPT----AEVPITNMHRD-E-I-------LS.GDS..L----P-IN-YA---------------
SYT_METTH/225-383..............MLRYA----CCFGAFRILSD-S-F-------LT.WKN..L----P-AS-IY---------------
SYG_ARCFU/39-308MFSTTIGPGKGKKGYLRPE----TAQGMFVDFKR-L-A-------NFFREK..L----P-FG-VA---------------
SYT_BORBU/216-382..............YLKPM----NCPFHIAIYNT-G-K-------HS.YRD..L----P-FR-WA---------------
SYH_MYCPN/20-187..............ALRPE----ATAGIVRLVCE-N-K-------LLQPQN..Y----P-LR-LF---------------
SYT_AQUAE/274-440..............YVKPM----NCPFHIAIYKS-R-T-------RS.YKE..L----P-LK-LF---------------
Q9VUK8_DROME/189-485MFATQIGPTGLVKGFLRPE----TAQGIFVNFKR-L-L-------EFNQGK..L----P-FA-VA---------------
SYH_ARCFU/19-179..............ALRPE----LTAPVMRMFVN-E-C-------SVMP....K----P-LR-FY---------------
SYH_YEAST/71-233..............SLRYD----LTVPFARYVAM-N-N-------I.......Q----S-IK-RY---------------
Q9VF85_DROME/153-322..............CLSGT----SEMALAGFFAN-K-L-------LS.EDQ..L----P-LK-VT---------------
SYH_STAAW/18-186..............TLRPE----GTAAVVRSYIE-H-K-------MQGNPN..Q----P-IK-LY---------------
SYS_SYNY3/181-351..............WLIPT----AEVPVTNLYRD-E-V-------LD.LEQ..L----P-IK-HC---------------
O65395_ARATH/266-437..............CLIGT----AEIPVGGIHMD-S-I-------LL.ESA..L----P-LK-YI---------------
SYT_CHLTR/267-432..............AIKPM----NCPGCMLYYKT-Q-L-------HS.YRE..F----P-LR-IA---------------
SYS_PYRHO/195-365..............YLIPT----AEHPLAGMHAN-E-I-------LD.GKD..L----P-LL-YV---------------
SYG_METTH/42-319MFQTLIGARGKKTGYLRPE----TAQGIFIPFKR-L-L-------RFFRNR..L----P-FG-VV---------------
SYH_BACSU/19-187..............TLRPE----GTAAAVRAFNE-N-K-------LFANPV..Q----P-TK-LY---------------
SYS_SULSO/195-365..............YLIAT----AEHPIAAMFFK-E-E-------IE.KDK..L----P-LK-FA---------------
SYS_STRCO/173-343..............YLVGT----SEVPLAAYHMD-E-I-------LD.GDR..L----P-LR-YA---------------
YHI0_YEAST/227-403..............AIRPT----SETVMYPYYAK-W-V-------QS.YRD..L----P-LK-LN---------------
SYH_THET8/19-186..............TLRPE----GTAAMVRAYLE-H-G-------MKVWP...Q----P-VR-LW---------------
SYT_PYRAB/237-399..............FLRFA----ACFGQFMIKKD-A-I-------IS.YRN..L----P-LR-MY---------------
SYT_METJA/228-387..............MLRFA----ACFGQFMMKKD-M-Y-------LL.PRY..L----P-LK-LY---------------
SYP_MYCTU/51-221..............LLGPT----HEELFTLTVKG-E-Y-------S.SYKD..F----P-LT-LY---------------
SYH_AQUAE/19-186..............ALRPE----GTAGTVRAFIQ-H-K-------LYALR...P----Y-VK-LF---------------
SYTC_YEAST/359-523..............GLKPM----NCPGHCLMFKS-R-E-------RS.YRE..L----P-WR-VA---------------
SYH_DEIRA/28-196..............VLRPE----GTASIVRAYLE-N-G-------LKQLP...A----P-LK-LW---------------
SYS_MYCPN/169-338..............YLSPT----LEVQLANLHAN-E-I-------FT.EGE..L----P-KY-YT---------------
SYP_BACSU/49-219..............ALGAT----HEEVITSLVRD-E-V-------K.SYKR..L----P-LT-LY---------------
SYT_SYNY3/228-403..............VLKPM----NCPFHIQIYKS-E-L-------RS.YRD..L----P-LR-LA---------------
SYT_THEMA/271-435..............AVKPM----NCPGHILVYKS-R-T-------VS.YRD..L----P-LR-FF---------------
SYP_TREPA/47-217..............LFSPT----AEESFTALVRG-D-C-------T.SYKH..F----P-LS-LY---------------
SYHM_HUMAN/73-235..............SLRYD----LTVPFARYLAM-N-K-------V.......K----K-MK-RY---------------
SYT_RICPR/272-437..............ALKPM----NCPCHVQIFKQ-G-I-------KS.YRD..L----P-LR-MS---------------
SYP_ECOLI/49-219..............VLGPT----HEEVITDLIRN-E-L-------S.SYKQ..L----P-LN-FY---------------
SYS_ARATH/179-353..............YLIAT----AEQPLCAYHID-E-W-------IH.PTE..L----P-LR-YA---------------
SYP_CHLTR/49-221..............CLAPT----HEEVVSEFVAQ-W-L-------T.GREQ..L----P-IH-LY---------------
SYG_AERPE/42-324LFRTQIGPYEGSVGYLRPE----LAQGIFVAFKR-V-Y-------EAMRSR..I----P-LG-IA---------------
SYH_CHLPN/28-193..............TLRPE----GTAAVVRSFLE-H-G-------ASHR....S----D-NK-FY---------------
SYT_HAEIN/273-438..............AIKPM----NCPGHVQIFNQ-G-L-------KS.YRD..L----P-IR-MA---------------
SYH_TREPA/25-187..............ALRFD----LTVPLARFVAT-H-Y-------ARLY....F----P-FK-RY---------------
SYH_RICPR/21-188..............ALRPE----FTSGIIRSFIS-N-G-------LQHK....L----P-LK-FF---------------
SYS_ARCFU/192-362..............YLIAT----SEHPIAAMHMR-E-V-------LE.ERE..L----P-LL-YA---------------
O45869_CAEEL/49-223..............CLQPT----AEEMCTELIAT-L-S-------PLKKSQ..F----P-LI-VY---------------
SYS_HELPJ/174-344..............YLIPT----AEVTLTNLYND-T-I-------IS.VEN..L----P-IK-MT---------------
SYH_SCHPO/79-242..............SLRYD----LTVPFARWLAM-N-P-------KV......T----S-IK-RF---------------
SYG2_YEAST/45-343MFETKIGASGQLKAFLRPE----TAQGQFLNFNK-L-L-------EINQGK..I----P-FA-SA---------------
SYHC_HUMAN/72-234..............SLRYD----LTVPFARYLAM-N-K-------L.......T----N-IK-RY---------------
SYT_MYCLE/310-489..............YLKPM----NCPMHTLIFSS-R-G-------RS.YRE..L----P-LR-LF---------------
SYS_THET2/168-340..............YLTGT----AEVVLNALHSG-E-I-------LP.YEA..L----P-LR-YA---------------
SYP_THEMA/49-219..............TLGPT----HEEIVTDLVKN-E-L-------R.SYKQ..L----P-LT-LY---------------
SYT_DEIRA/279-448..............MLKPM----NCPHHVRIYAS-K-P-------RS.YRD..L----P-VR-LA---------------
SYS_AQUAE/174-344..............YLIPT----AEVPLTNLYRE-E-I-------LK.EEN..L----P-IY-LT---------------
SYT_ARCFU/227-389..............FLRFA----ACFGQFLMLSS-S-T-------IT.YRN..L----P-LK-IY---------------
SYS_MYCTU/169-339..............YLVGT----SEVPLAGYHSG-E-I-------LD.LSR..G----P-LR-YA---------------
SYG_MYCTU/45-278KTYLGPIETEEGLHYLRPE----TAQGIFVNFAN-V-V-------TTARKK..P----P-FG-IG---------------
SYTC_HUMAN/352-516..............ALKPM----NCPGHCLMFDH-R-P-------RS.WRE..L----P-LR-LA---------------
SYT_MYCPN/198-368..............MLRPM----TCPHHCLIFKH-K-R-------RS.YKE..L----P-QR-FC---------------
SYPM_YEAST/56-225..............CLTAT----CEEDITDLMKN-Y-I-------A.SYKD..M----P-IT-IY---------------
SYH_MYCGE/20-187..............ALRPE----ATTPIVRLACE-N-K-------LMQEAN..F----P-LK-LF---------------
SYH_THEMA/19-186..............TLRPE----GTAPVVRAFLE-N-S-------LIDRG...F----Q-QR-YY---------------
SYG_PYRAB/44-320MFETYIGPYKDKKAYLRPE----TAQGIFVNFKR-L-N-------AFARNK..L----P-FG-VF---------------
SYG_METJA/42-324MFVTSIGPGGKRTGYMRPE----TAQGIFIQFRR-L-A-------QFFRNK..L----P-FG-VV---------------
SYS_RICPR/171-341..............RLIPT----AEVSLVNIVAD-T-I-------IQ.REK..L----P-MR-YV---------------
SYH_METTH/19-182..............ALRPE----LTAPVARLYMN-E-M-------QKKP....K----P-IK-MY---------------
SYH_MYCLE/30-193..............TLRPE----GTAGVVRAVIE-H-G-------LDRGA...L----P-VK-LC---------------
SYS_DEIRA/170-342..............LLAGT----AEVPINSLYAG-E-Q-------LS.ADE..L----P-LT-FA---------------
SYS_HAEIN/173-348..............ALIPT----AEVPVTNLVRD-V-I-------ID.EAE..L----P-IK-MT---------------
SYPM_SCHPO/54-224..............CLAPT----HEEDVTRTMAT-I-I-------D.SQKQ..L----P-IR-VY---------------
SYT1_BACSU/276-446..............VLRPM----NCPHHMMIYKQ-D-I-------HS.YRE..L----P-IR-IA---------------
SYT_TREPA/223-390..............ALKPM----NCPGHVEIFKQ-K-T-------RS.YRD..L----P-LR-LS---------------
SYS_TREPA/171-342..............CLVAT----AEITLGAYHAG-E-V-------LE.ERS..L----P-RL-YA---------------
SYTM_ARATH/346-510..............GLKPM----NCPGHCLIFQH-R-V-------RS.YRE..L----P-MR-LA---------------
SYSC_SCHPO/179-353..............YLIAT----SEQPISAYHSG-E-W-------FEKPSE.QL----P-LK-YA---------------
SYS_STAA8/173-344..............YTIPT----AEVPLTNFYRN-E-I-------IQ.PGV..L----P-EK-FT---------------
SYH_CHLTR/28-193..............TLRPE----GTAAVVRALLD-H-S-------ADMR....K----D-NK-FY---------------
O82413_ARATH/85-250..............ALRPE----LTPSLARLVIQ-K-G-------KSVS....L----P-LK-WF---------------
SYS_CHLPN/172-344..............YLIPT----AEVVLNGFRSQ-D-I-------LT.EKE..L----P-LY-YA---------------
SYH_SYNY3/20-187..............TLRPE----GTAGVVRAYIE-Q-N-------LQAAG...G----V-QR-LW---------------

PF13393

Q1K3M2_DESAC/22-332--------------AFPPD----ITPQVARIFAT.R.L....K.EAP......L----P-QR-LC---------------
B5JRM1_9GAMM/12-323--------------GLRAD----MTPQVARIDAH.V.L....N..RE......E----P-TR-LC---------------
C0N861_9GAMM/12-325--------------GIRAD----MTPQVARIAAH.K.L....R.HQS......E----I-LR-LC---------------
HISZ_PSEU5/12-321--------------GLRAD----ITPQVARVDAH.T.L....R..RE......G----P-SR-LC---------------
B0SA16_LEPBA/18-333--------------SPGVD----LTLQVVKGMAA.R.S....H..WE......E----N-QN-VY---------------
HISZ_ANAD2/9-318--------------AIRPD----ITPQIARLYAA.R.P....D.ALP......S----P-AR-LC---------------
HISZ_ALHEH/17-328--------------GVRAD----ITPQVARIDAH.R.L....R..RE......A----P-SR-LC---------------
HISZ_MICAN/8-319--------------GLRPE----LTASIARSAVT.R.M....S.GES......Y----P-QR-LC---------------
C8WUX4_ALIAD/25-356--------------ALRPE----MTPSIARMAAP.R.V....A.AGR......T----P-IR-WC---------------
HISZ_THISH/12-323--------------GVRAD----MTPQVARIDAH.S.L....N..RD......V----P-TR-LC---------------
HISZ_ANADF/9-318--------------AIRPD----ITPQIARLYAA.R.P....D.ALP......S----P-AR-LC---------------
Q2BIN1_9GAMM/12-324--------------GVRAD----ITPQVARIDAH.R.L....R..ES......G----A-TR-LC---------------
HISZ_HAHCH/12-320--------------GIRAD----MTPQVARIDSR.R.S.......HD......V----A-SR-FC---------------
E6W5Z4_DESIS/15-323--------------LLRPD----FTPSIARAYST.A.T....T.KLG......D----C-VR-LC---------------
C9YB19_9BURK/9-313--------------GLRAD----STPQVARIDAH.L.L....N..RS......G----V-TR-LC---------------
C6XEF7_METSD/9-315--------------GVRAD----TTPQAARIDAH.M.L....N..NQ......G----V-SR-LC---------------
A1WUT1_HALHL/12-323--------------GVRPD----ITPQAARVDAH.Q.L....R..RK......G----I-TR-LC---------------
C4KMP4_BURPE/9-313--------------GLRAD----MTPQVARIDAH.L.L....N..RQ......G----V-TR-LC---------------
HISZ_LARHH/9-314--------------GLRAD----MTPQVARIDAH.L.L...AH..RQ......G----V-TR-LC---------------
HISZ_METFK/9-315--------------GIRAD----ITPQTARIDAH.M.L....N..NQ......G----V-TR-LC---------------
HISZ_RALME/10-314--------------GLRAD----ITPQVARIDAH.L.L....N..RP......G----V-TR-LC---------------
B6C6F9_9GAMM/12-321--------------GVRAD----ITPQVARIAAH.C.I....Q..RK......G----V-TR-LC---------------
D5CRS6_SIDLE/8-314--------------AVRAD----ITPQVARIDAH.L.L....N..RQ......G----V-TR-LC---------------
D0LNQ8_HALO1/14-324--------------ALRPD----MTPQVARMAAT.H.L....S.DID......G----P-LR-YC---------------
HISZ_CELJU/17-327--------------GIRAD----ITPQTARMDAH.S.F....N..RQ......G----A-NR-LC---------------
HISZ_CHRSD/12-323--------------GASAD----VTPQVARMDAH.S.L....K..RS......G----P-AR-LC---------------
HISZ_TERTT/12-323--------------GIRAD----ITPQAARMDAH.S.L....K..RS......G----A-NR-LC---------------
A0Y7Z9_9GAMM/12-323--------------GIRAD----ITPQTARMDAH.S.L....R..GD......G----P-SR-LC---------------
Q0VMF2_ALCBS/13-322--------------GVRAD----ITPQVARMDAH.S.L....R..RN......A----P-SR-LC---------------
A3RVD4_RALSL/9-313--------------GLRAD----ITPQVARIDAH.L.L....N..RA......G----V-TR-LC---------------
C6WV54_METML/9-315--------------GVRAD----MTPQAARIDAH.L.L....N..HQ......G----V-TR-LC---------------
B9Z696_9NEIS/9-315--------------GLRAD----ITPQVARIDAH.LLS....N..RT......G----V-TR-LC---------------
HISZ_NITEU/9-320--------------GLRAD----MTPQAARIDAH.L.L....N..IS......G----V-TR-LC---------------
A4BLP9_9GAMM/17-328--------------GVRAD----ITPQAARIDAH.Q.L....R..RD......C----P-VR-LC---------------
HISZ_SACD2/12-323--------------GIRAD----ITPQAARMDAH.S.L....Q..RE......G----L-NR-LC---------------
Q1YRY2_9GAMM/12-321--------------GIRAD----ITPQTARMDAH.S.L....R..RE......G----P-SR-LC---------------
HISZ_JANMA/9-313--------------GLRAD----MTTQVARIDAH.L.L....N..RA......S----V-TR-LC---------------
HISZ_METCA/17-328--------------GIRAD----MTPQVARIDAR.T.H....A..GD......T----P-GR-FC---------------
HISZ_MARMS/12-324--------------GIRAD----FTSQVARIDAH.C.L....K..DD......G----V-QR-LS---------------
HISZ_POLNS/9-318--------------GLRAD----MTPQVARIDAH.L.L....N..RA......D----V-TR-LC---------------
HISZ_VARPS/9-317--------------GLRAD----TTPQVARIDAH.L.L....N..RE......G----V-AR-LC---------------
B7RW37_9GAMM/12-322--------------GVRAD----ITPQVARIDAH.S.L....A..PE......G----V-SR-LC---------------
HISZ_NITMU/11-321--------------GLRAD----MTPQVARIDAH.L.L....N..RK......G----I-TR-LC---------------
D3RSK9_ALLVD/11-321--------------GVRAD----MTPQVARMDAH.H.L....R..RE......A----P-TR-LC---------------
Q1N278_9GAMM/12-321--------------GLSAD----ITPQVARIDAH.S.W....P..KE......G----I-NR-LC---------------
HISZ_MARAV/12-322--------------GVRAD----MTPQAARIDAH.T.L....G..QD......G----I-TR-LC---------------
HISZ_AROAE/8-312--------------GVRAD----MTPQVARIDAH.L.L....N..RR......G----V-SR-LC---------------
D1YNU9_9FIRM/9-314--------------VIRPD----LTMPIGRFLAT.T......N..IE......L----P-RT-FY---------------
C7RU27_ACCPU/8-312--------------GVRAD----MTPQVARIDAH.L.L....N..RQ......G----V-TR-LC---------------
A3YHH2_9GAMM/12-323--------------GIRAD----FTSQVARIDAR.C.I....K..EQ......G----V-QR-LS---------------
D9SFI4_GALCS/9-316--------------ALRAD----ITPQVARIDAH.L.L....N..RQ......G----V-AR-LC---------------
HISZ_THICR/11-322--------------GVRAD----MTPQVARIATN.R.I....K..QT......G----I-QR-LC---------------
HISZ_DECAR/8-312--------------GVRAD----ITPQAARIDAH.L.L....N..HQ......G----V-TR-LC---------------
HISZ_THIDA/9-313--------------AVRAD----ITPQVARIDAH.L.L....G..AN......A----I-NR-LC---------------
D3SBT1_THISK/12-326--------------GVRAD----LTPQVARIDAH.R.L....K..VE......G----P-NR-LC---------------
HISZ_RHOFD/9-313--------------GLRAD----STPQVARIDAH.L.L....N..RP......G----V-TR-LC---------------
B8KW68_9GAMM/12-325--------------GVRAD----ITPQVARIDAH.S.M....P..HD......A----V-TR-LC---------------
A6GNJ9_9BURK/9-322--------------GLRAD----TTPQVARIDAH.I.L....N..RK......G----V-TR-LC---------------
B7X1H5_COMTE/9-313--------------GLRAD----MTQQVARIDAH.L.L....N..RK......G----V-TR-LC---------------
A0Z0R0_9GAMM/12-324--------------GVRAD----ITPQVARIDAH.A.L....G..EA......G----V-TR-LC---------------
HISZ_ACIAC/9-313--------------GLRAD----MTQQVARIDAH.L.L....N..RS......G----V-TR-LC---------------
B5EJB1_ACIF5/15-325--------------GLRSD----MTPQMARIDAQ.T.S....S..AK......E----V-RR-LS---------------
A3EWA4_9BACT/25-339--------------LLRPD----ATAQIARLVAQ.G.Q...EN..TT......E----V-QK-YA---------------
Q12AC8_POLSJ/13-319--------------GLRAD----TTPQVARIDAH.L.L....N..RS......G----V-AR-LC---------------
HISZ_BORPA/9-316--------------GVRAD----MTSQVTRIDAH.L.L....N..RA......G----V-TR-LC---------------
HISZ_VEREI/9-313--------------GLRAD----TTPQVARIDAH.L.L....N..RK......G----V-TR-LC---------------
HISZ_ACISJ/9-313--------------GLRAD----TTQQVARIDAH.L.L....N..RQ......G----V-AR-LC---------------
D4DMZ4_NEIEG/10-317--------------GIRAD----ITPQVARIDAH.L.L....S.ANQ......G----I-NR-LC---------------
A4A6K0_9GAMM/15-328--------------GFRAD----MTPQVARMDAH.S.L....H..GD......Q----V-NR-LC---------------
HISZ_AQUAE/8-290--------------GLRLD----FTTQVVRTISH.L.R....N..VK......L----P-ER-VY---------------
HISZ_THET2/5-297--------------ALRSE----FTTLLAKLLRA.H.L.......GE......G----A-HR-FQ---------------
C1CVJ4_DEIDV/29-323--------------ALRSE----FTTAIGRLVRL.RFP....E..GP......F----P-LR-LQ---------------
Q1J099_DEIGD/30-328--------------ALRSE----FTTAIGRLVQA.RFP....E..GP......F----P-LR-LQ---------------
A6G000_9DELT/27-343--------------ALRSD----VTPQIARVIAQ.R.VGGEVE..AG......D----Q-VR-LC---------------
D0KVK0_HALNC/13-326--------------GLRAD----MTPQIARIDAH.S.M....K..PE......A----E-RR-LC---------------
A4BEB8_9GAMM/12-323--------------GVSAD----RTQQVARMDAH.S.M....P..KA......G----V-AR-YC---------------
HISZ_DEIRA/31-328--------------ALRSE----YTTALGRLVGT.H.F...PS..GP......F----P-LR-LQ---------------
HISZ_LEPIC/17-331--------------SPSID----LTVQAVKGMAG.F.S....H..QR......E----N-QN-IF---------------
A3Z6V4_9SYNE/8-318--------------GLRPE----MTASIARAAST.R.F....A.KRS......R----P-LR-LW---------------
HISZ_PROMT/8-318--------------GLRPE----ITASIVRAAST.R.F....N.EYE......R----P-LR-FW---------------
A2SHA5_METPP/10-318--------------GLRAD----TTPQVARIDAH.L.L....N..RD......G----I-TR-LC---------------
C6NXF6_9GAMM/15-326--------------GFRSD----MTPQMARMDAQ.M.S....R..DH......D----Q-RR-LC---------------
Q067E0_9SYNE/8-318--------------GLRPE----MTASIARAACT.R.L....A.TRP......R----P-MR-LW---------------
HISZ_PROM4/8-318--------------GLRPE----MTASIARAAST.R.Y....V.AEP......R----P-LR-LW---------------
D0SC52_ACIJO/12-322--------------GVRAD----MTPQVARIDAH.V.H....P..VE......G----V-AR-YC---------------
HISZ_SYNPX/8-318--------------GLRPE----MTASIARAACT.R.L....A.SRP......R----P-LR-LW---------------
HISZ_BORA1/9-316--------------GVRAD----MTTQVSRIDAH.L.L....N..RN......S----V-TR-LC---------------
B1XXK3_LEPCP/10-318--------------GVRAD----TTPQVARIDAH.L.L....N..RA......G----L-TR-LC---------------
B5IJM2_9CHRO/8-318--------------GLRPE----LTASIARAAST.R.L....A.GLP......R----P-LR-LW---------------
D0CJ76_9SYNE/8-318--------------GLRPE----MTASIARAACT.R.F....A.DRQ......R----P-LR-LW---------------
B0VFH4_CLOAI/7-312--------------SLRPE----GTISVLHHTAR.I.T....N..PG......E----I-HR-FY---------------
B6BTN9_9PROT/10-316--------------GITPD----LTIQTARIDNY.L.A....S.SSN......D----I-KS-YC---------------
HISZ_PSYA2/5-314--------------GIRAD----ITPQILRIDAH.H.G.......GD......G----I-AR-YC---------------
HISZ_SYNR3/8-318--------------GLRPE----MTASIARAACT.R.L....A.AMQ......R----P-LR-LH---------------
A5WGG0_PSYWF/34-354--------------GVRAD----ITPQILRIDAHLN.K....MGKAN......K----I-AR-YC---------------
D1KE67_9GAMM/9-315--------------GVHAD----ITPQIARIDAK.S......G..SE......N----I-AK-YC---------------
Q0IAC0_SYNS3/25-335--------------GLRPE----MTASIARAAST.R.L....K.DRP......R----P-LR-LC---------------
D3P4X4_AZOS1/14-318--------------AVRAD----ITPQIARIATT.RLK....N..EA......R----P-LR-LC---------------
A8TQZ8_9PROT/17-319--------------GVRAD----MTVQVARIAST.RLK....N..AP......R----P-LR-LC---------------
D2Z2L9_9BACT/13-312--------------CLRSD----ITLAAVNYLAN.H.Y....S.PQE......R----P-LR-MC---------------
B1X3U7_PAUCH/8-318--------------ALRPE----MTASIARAACT.R.M....A.GKM......R----P-LR-LW---------------
C7JCL4_ACEP3/27-328--------------VLRPD----ITPQVARMAAT.R.V....A.STP......R----P-LR-VS---------------
Q0BTV8_GRABC/14-327--------------AVRPD----ITPQIARIATT.R.L....A.EAA......R----P-LR-LC---------------
HISZ_RHOCS/16-317--------------GVRSD----MTLQVARIAAT.R.M...PK..SP......R----P-LR-LS---------------
D3L2N6_9BACT/7-310--------------AVRTD----VTLGVVDYCAS.H.F....E.PHE......R----P-LR-LC---------------
A9HLQ2_GLUDA/27-327--------------ALRPD----ITPQIARIAAT.R.L....A.DVP......R----P-LR-LS---------------
HISZ_RHORT/16-319--------------GLRAD----ITIQVARLAAS.R.L....A.KAP......R----P-LR-LT---------------
C8PZK1_9GAMM/30-351--------------GVRAD----ITPQIARIDARLH.N....N..QDTSNPSKS----I-SR-YC---------------
D3DJN8_HYDTT/9-286--------------NLRTD----WTVSLARFLSS.I.R....H..LE......L----P-VK-VF---------------
Q2G4V6_NOVAD/12-320--------------ALRSD----FTPQIGRLAET.R.L....A.EAP......R----P-LR-LC---------------
C8WED5_ZYMMN/11-310--------------ALRPD----ITGQIGRIATT.R.L....N.HRP......R----P-LR-LA---------------
D3SMU8_THEAH/10-286--------------CLRSD----WTVSLVRYLSG.L.R....K..LD......L----P-KK-VF---------------
Q5UF78_9PROT/11-312--------------SIRPD----ISQQIARIDLQ.Q.G.......TK......D----K-KK-YC---------------
A5VFF4_SPHWW/22-321--------------ALRPD----ITAQVGRIAAT.R.M...GH..RP......R----P-LR-LA---------------
C4L169_EXISA/13-302--------------VMRPD----YTLQIARKLAD...........GH......E----P-MR-VA---------------
Q1NEW5_9SPHN/12-315--------------AFRPD----MTAQVGRIAAT.R.L....A.AAP......R----P-LR-LS---------------
Q2NCV4_ERYLH/16-312--------------ALRSD----MTPQVGRIAST.G.L....A.DAP......R----P-LR-LC---------------
A3W9X6_9SPHN/22-321--------------ALRSD----ITPQIGRIAST.S.L....A.SAP......R----P-LR-LA---------------
A5PDB1_9SPHN/11-307--------------ALRAD----MTVQVGRIAAT.G.L....A.DAP......R----P-LR-LC---------------
Q1GVI6_SPHAL/11-307--------------ALRPD----ITRQVGRIATS.L.L....A.ASP......R----P-LR-LC---------------
A6Q5H3_NITSB/10-275--------------SLRAD----STIDVVRLITN.R.L....G.RST......E----H-KK-WF---------------
A7I327_CAMHC/12-273--------------SLRAD----STVDVVRIARR.R.I....K..NQ......N----L-KR-WF---------------
HISZ_WOLSU/12-276--------------ALRND----TTLDVVRIITK.R.L....G.RST......E----H-RR-WF---------------
A5LME0_STRPN/14-307--------------GLSSD----GSMSILRYFYN.N.K....Q..GY......S----S-YK-VC---------------
A8ER44_ARCB4/10-275--------------SLRAD----STLDVVRIITK.R.L....G.RTT......K----H-KK-WF---------------
B6BHN3_9PROT/10-276--------------SIRAD----STIDVVRIIEK.R.L....G.RNT......Q----H-RK-WF---------------
C5EYR6_9HELI/22-286--------------ALRND----STIDAIRLLAP.H.L....K.ENA......I----K-KK-WF---------------
C3XLA7_9HELI/10-286--------------ALRND----STIDTIRLLAP.H.L....R.ENA......L----S-KR-WF---------------
HISZ_HELHP/10-274--------------GLRYD----TTLDAMRIVTK.R.I....M.RSS......T----H-KK-WF---------------

PF00152

Q7NBK8_MYCGA/10-341--------------N.YEF----YLADSMQFHLE-LML-------RA------K---DI.SS-VG---------------
SYK_HUMAN/222-575--------------LDMNL----YMRIAPELYHK-MLV-------VG------G---.I.DR-VY---------------
Q6BRH4_DEBHA/177-668--------------A....----.LPQSPQQYKQ-ILM-------SS------G---.F.TR-YF---------------
Q6BZ12_DEBHA/190-549--------------Q....----.LRVAPELWLK-KLV-------IS------G---.F.DK-IF---------------
Q6C814_YARLI/181-540--------------T..QI----ALRVAPELWLK-RLV-------IS------G---.F.DK-VF---------------
SYK_RHIME/154-495--------------LKLDM----YLRIAPELYLK-RIL-------VS------G---.LTDK-VF---------------
SYD_SYNPX/123-576--------------A....----.LPQSPQLFKQ-LLM-------VG------G---.I.ER-YY---------------
SYD_AQUAE/128-577--------------A....----.LPQSPQLFKQ-ILM-------IA------G---.F.DR-YF---------------
SYD_BDEBA/162-604--------------A....----.LPQSPQTLKQ-LLM-------IS------G---.Y.DR-YF---------------
SYNC_ENCCU/175-498--------------G.EDA----YLTQSSQLYLE-TVV-------PA------.---.S.HR-AY---------------
Q6F944_ACIAD/4-329--------------KERTQ----YLQTSPEFAMK-RLL-------AS------G---.S.GP-IY---------------
Q7UK37_RHOBA/210-545--------------LDMQL----TMRIALELHLK-RLM-------VG------G---.M.ER-VY---------------
SYD_CAMJE/119-554--------------A....----.LPQSPQLFKQ-LLM-------CS------G---.F.DR-YF---------------
SYD_THEAC/112-424--------------E.KDA----YLNQSPQLYKE-VLM-------SA------G---.F.DR-VF---------------
Q6C700_YARLI/128-469--------------GDKPA----YLTVSTQLHLE-VLA-------AA------.---.V.GR-VW---------------
Q6CLY6_KLULA/143-620--------------A....----.LPQSPQQYKQ-LLI-------AS------G---.V.NR-YF---------------
SYD_SULSO/113-425--------------G.KEA----FLAQSPQLYKE-LLA-------GA------.---.I.ER-VF---------------
SYD_TREPA/137-576--------------A....----.LPQSPQLYKQ-LLM-------VA------G---.F.DR-YF---------------
SYD_PSESM/120-560--------------A....----.LPQSPQLFKQ-LLM-------VA------G---.F.DR-YY---------------
SYKM_SCHPO/182-530--------------HKLPL----TLRCAPELWLK-QLV-------IG------G---.M.NR-VF---------------
SYD_BRAJA/121-561--------------A....----.LPQAPQQYKQ-LLM-------MS------G---.F.DR-YF---------------
Q7NBS8_MYCGA/119-554--------------A....----.LPQSAQIYKQ-LLM-------IS------G---.F.ER-YF---------------
SYK1_MYCTU/156-502--------------LDIDL----YLRIAPELFLK-RCI-------VG------G---.F.DK-VF---------------
Q6CX40_KLULA/145-470--------------D.EIV----NLTVSSQLHLE-VLM-------MG------.---.L.GR-VY---------------
SYD_METTH/121-433--------------E.REA----FLGQSPQLYKQ-IMM-------ST------G---.L.DR-VY---------------
SYD_HALVO/113-429--------------G.QEA----FMNQSPQLFKQ-LMV-------GS------G---.L.ER-VF---------------
SYK_CHLTR/170-520--------------LHAEM----FLRISLEIALK-KLL-------VG------G---.M.SR-VY---------------
SYD_TREDE/124-564--------------A....----.LPQSPQIYKQ-ILM-------VS------G---.F.DK-YF---------------
SYD_MYCLE/116-559--------------A....----.LPQSPQLFKQ-LLM-------VA------G---.M.ER-YY---------------
SYD_HALSA/115-432--------------D.KEA----YLSQSPQLYKQ-ILV-------AS------G---.V.DR-LF---------------
SYD_GEOSL/128-566--------------A....----.LPQSPQIFKQ-ILM-------IS------G---.F.DR-YF---------------
SYD_BORBU/118-557--------------A....----.LPQSPQLYKQ-LIM-------IA------G---.F.DK-YF---------------
SYD_ENTFA/122-560--------------A....----.LPQSPQLFKQ-LLM-------GA------G---.F.DR-YY---------------
SYD_MYCGE/108-524--------------A....----.LVQSPQIYKQ-LLM-------IA------G---.V.EK-YF---------------
SYK_SULSO/147-487--------------LNEDW----YLRIALELYLK-RYI-------IG------G---.F.NK-VF---------------
SYD_MYCPE/119-554--------------A....----.LPQSPQIYKQ-LLM-------VS------G---.M.DR-YF---------------
SYN_MYCGE/116-452--------------N.KTT----FLTVSGQFGAE-AFA-------QA------.---.F.KK-VF---------------
SYD1_STRMU/118-557--------------A....----.LPQSPQMLKQ-LLM-------GA------G---.L.ER-YY---------------
SYNM_MOUSE/135-473--------------D.VPA----FLTVSGQLHLE-VMS-------GA------.---.F.TQ-VF---------------
SYD_THEMA/117-552--------------A....----.LPQSPQLFKQ-ILM-------IS------G---.F.DR-YF---------------
Q98QM9_MYCPU/122-552--------------S....----.LPQSPQLYKQ-LLM-------AS------G---.F.ER-YF---------------
SYD_BACTN/119-557--------------A....----.LPQSPQTLKQ-LLM-------VS------G---.F.DR-YF---------------
SYD_RHOBA/122-563--------------A....----.LPQSPQLYKQ-ILM-------VA------G---.F.DR-YV---------------
SYD_VIBCH/117-559--------------A....----.LPQSPQLFKQ-LLM-------MS------G---.F.DR-YY---------------
SYD_BLOFL/118-566--------------A....----.LPQSPQMFKQ-LLM-------IA------G---.I.DR-YY---------------
SYN_BACHD/109-426--------------D.EDA----FLSQSGQLYME-AAA-------LA------.---.F.GR-VF---------------
SYD_THETN/128-566--------------A....----.LPQSPQIFKQ-LLM-------IA------G---.F.DR-YY---------------
Q6KI16_MYCMO/110-541--------------S....----.LPQSPQLYKQ-LLM-------AS------G---.F.EK-YY---------------
Q7P704_FUSNV/123-564--------------A....----.LPQSPQLFKQ-LLM-------IG------G---.V.EK-YF---------------
SYDM_SCHPO/138-579--------------A....----.LPQSPQQYKQ-ILM-------AS------G---.I.GN-YY---------------
SYD_STRR6/120-554--------------A....----.LPQSPQITKQ-LLM-------NA------G---.F.DR-YY---------------
SYD_STRCO/121-557--------------A....----.LPQAPQQFKQ-LLM-------IS------G---.F.DR-YF---------------
SYD_DESPS/140-579--------------A....----.LPQSPQLFKQ-LLM-------IA------G---.M.DR-YY---------------
Q6NEX1_CORDI/708-1045--------------YDQPL----TLRIAPELYLK-RLV-------VG------G---.F.ER-VF---------------
SYD_BIFLO/126-568--------------A....----.LPQSPQLLKQ-LLM-------VS------G---.V.ER-YY---------------
YJEA_BUCBP/1-322--------------TKKRM----WLVPSPEYHMK-RLL-------VQ------N---.I.GA-IY---------------
SYN_THEAC/109-425--------------G.EPI----YLNQSAQFYLE-TMI-------YS------.---.L.EK-VF---------------
Q7UH30_RHOBA/67-394--------------SPTKF----YLQTSPESAMK-RLL-------AE------G---.A.PS-IY---------------
SYK_PORGI/163-502--------------LDIPL----YLRIANELYLK-RLI-------VG------G---.F.DG-VY---------------
SYD_NEIMA/118-568--------------A....----.LPQSPQLFKQ-LLM-------VA------G---.F.DR-YY---------------
Q97DB5_CLOAB/160-475--------------D.KEA----YLAQSPQFYKQ-MMV-------AA------G---.Y.ER-VF---------------
Q7Q3E7_ANOGA/129-574--------------S....----.LVQSPQQFKQ-MLM-------VG------A---.I.DR-YF---------------
SYK_UREPA/150-490--------------LNKEY----YLRIATEIALK-KCI-------IG------G---.F.EK-VY---------------
SYD_LACJO/120-559--------------A....----.LPQSPQLFKQ-LLM-------GA------G---.F.DK-YY---------------
SYD_UREPA/115-551--------------A....----.LPQSPQTFKQ-LLM-------VA------G---.F.QK-YF---------------
SYK_BUCAI/162-503--------------IDSQM----YLRIAPELYLK-KLI-------IG------G---.F.ER-IF---------------
Q74MV5_NANEQ/94-400--------------G.KEA----YLTQSPQLYKQ-MMV-------SV------.---.F.PK-VF---------------
SYD_CHLTR/123-558--------------A....----.LPQSPQLFKQ-ILM-------VG------G---.L.DR-YF---------------
SYD_BUCAI/117-559--------------A....----.LPQSPQLFKQ-ILM-------IS------G---.I.DR-YY---------------
SYD_AERPE/118-438--------------D.KTA----FLAQSPQFYKQ-FAV-------IA------G---.L.ER-VF---------------
Q8PAB4_XANCP/1-324--------------GAPTR----WLRTSPEYPLK-RLL-------AA------G---.V.GD-CY---------------
SYD_BACSU/123-562--------------A....----.LPQSPQLFKQ-LLM-------VS------G---.I.ER-YY---------------
SYK_DEIRA/167-507--------------LSYDF----KLRISLELYLK-RLL-------VG------G---.F.ER-VY---------------
Q8D388_WIGBR/116-550--------------S....----.LPQSPQLFKQ-ILM-------IS------G---.I.DK-YY---------------
SYD_THETH/123-553--------------A....----.LPQSPQLFKQ-MLM-------VA------G---.L.DR-YF---------------
SYD_COXBU/119-561--------------A....----.LPQSPQIFKE-ILM-------VA------G---.F.DR-YY---------------
SYN_LEPIN/113-431--------------DLGNA----YLAQTGQLYLE-TAI-------FA------.---.H.NK-VF---------------
SYD_BRUSU/121-565--------------A....----.LPQAPQQYKQ-LLM-------VA------G---.F.DR-YF---------------
SYD_DESVH/142-576--------------A....----.LPQSPQIFKQ-LLM-------VS------G---.M.DR-YY---------------
SYD_PARUW/129-567--------------A....----.LPQSPQIFKQ-LLM-------IS------G---.M.DR-YF---------------
O81892_ARATH/198-611--------------A....----.LPQSPQLFKQ-MLM-------VS------G---.F.DK-YY---------------
SYD_PYRAE/116-424--------------E.RVA----YLSQSPQLYKE-QLT-------AS------.---.L.ER-VF---------------
Q7SFD2_NEUCR/259-590--------------D.KEA----FLAQSPQFYKQ-FEI-------AG------G---.R.KR-VF---------------
SYD_PROMP/123-570--------------A....----.LPQSPQLFKQ-LLM-------VG------G---.L.DK-YY---------------
SYD_NITEU/118-561--------------A....----.LPQSPQLFKQ-LLM-------VS------G---.F.DR-YY---------------
Q8ZUX9_PYRAE/23-343--------------G.AEY----KVMSSAILYKQ-YMA-------RV------.---.L.GK-IY---------------
Q9VJH2_DROME/521-960--------------S....----.LVQSPQQFKQ-MLM-------SG------G---.I.DR-YF---------------
Q8EX85_LEPIN/1-330--------------KKEKG----YLITSPEYSLK-EIL-------SK------G---.L.EK-IY---------------
Q8ZWD4_PYRAE/145-481--------------IDEEW----YLRISPELYLK-RYI-------IA------G---.F.PK-VF---------------
SYD_BUCBP/117-561--------------A....----.LPQSPQLFKQ-LLM-------IS------G---.I.DR-YY---------------
SYD_GLOVI/120-563--------------A....----.LPQSPQLFKQ-LLM-------VA------G---.F.DR-YY---------------
SYD_LEPIN/129-574--------------A....----.LPQSPQIFKQ-ILM-------VG------G---.M.ER-YF---------------
SYD_CLOTE/126-566--------------A....----.LPQSPQLFKQ-LLM-------VS------G---.F.DK-YF---------------
SYNC_HUMAN/225-544--------------G.EEA----FLTQSSQLYLE-TCL-------PA------.---.L.GD-VF---------------
Q9LCY8_THETH/104-418--------------E.KRA----YLAQSPQLYKQ-IMV-------GV------.---.F.ER-VY---------------
Q9HKI9_THEAC/20-325--------------G.YKY----SLTKSMIFHKH-LLT-------KH------.---.F.DR-IF---------------
SYK2_METMA/169-509--------------LGQNL----FLRIAPELYLK-RLV-------VG------G---.Y.EK-VF---------------
SYD_STAAS/123-562--------------A....----.LPQSPQLFKQ-LLM-------IS------G---.F.DK-YY---------------
SYK_CHRVO/160-501--------------LDMPL----YLRIAPELYLK-RLV-------VG------G---.L.ER-VF---------------
SYD_MESFL/115-551--------------A....----.LPQSPQLYKQ-LLM-------VS------G---.F.DK-YY---------------
Q6MPY6_BDEBA/81-404--------------RQQKL----FLPTSPELHLK-KAL-------AL------G---.A.EK-IF---------------
SYD_WOLPM/133-574--------------A....----.LPQAPQIFKQ-LLM-------VS------G---.F.DK-YF---------------
SYD_CHLTE/133-572--------------A....----.LPQAPQQFKQ-LLM-------VA------G---.F.PR-YF---------------
SYN_PYRHO/114-430--------------D.KYA----YLSQSAQLYLE-AAI-------FG------.---.L.EK-VW---------------
SYD_XYLFA/120-560--------------A....----.LPQSPQLFKQ-ILM-------VA------G---.F.DR-YY---------------
SYDM_YEAST/144-629--------------A....----.LDQSPQQYKQ-LLM-------AS------G---.V.NK-YY---------------
Q9F112_RHIRD/4-352--------------EAVPL----YLHTSPEFACK-KLL-------AA------G---.E.KR-IS---------------

PF01409

SEPS_METJA/103-348--------------TLRSH----MTSGWFITLSS.LIK-------KR------K...LP-LK-LF---------------
SYFA_YEAST/212-492--------------VLRTH----STAISARMLHD.LAK-------DP------K....P-TR-LF---------------
SYFA_CHLMU/94-340--------------VLRTH----TSNVQSREL.....A-------RN------K...PP-VR-VV---------------
SYFA_COXBU/92-328--------------LLRTH----TSPVQIREM.....E-------KQ------G...VP-IR-LI---------------
SYFA_HALSA/219-498--------------ALRGH----TTSLTARHLAGLADA-------DV------E...AP-AR-YF---------------
SYFA_NITEU/97-344--------------LLRTH----TSPVQIHYM.....Q-------NH------R...PP-IK-II---------------
SYFA_CLOAB/92-339--------------VLRTQ----TSPVQVRTM.....L-------NQ------K...PP-IK-MI---------------
Q9GYS8_CAEEL/265-545--------------VLRTH----TTAVSARQLYQ.LAQ-------EG------F...RP-SK-LF---------------
SEPS_METTH/101-347--------------TLRSH----MTSGWFISLQN.IHD-------RY------R...MP-LK-LF---------------
SYFA_AQUAE/91-337--------------LLRTH----TSPVQIRTM.....L-------KK------K...PP-IQ-II---------------
SYFA_BACHD/92-341--------------LLRTQ----TSPVQARTM.....E-------KY------KG.KGP-IK-II---------------
SYFA_BUCAI/91-326--------------LLRTQ----TSSMQIRIM.....K-------QE------K...PP-IR-FI---------------
SYFA_NEIMA/91-328--------------VLRTH----TSPIQIRYM....LD-------KK------E...PP-VR-II---------------
SYFA_PSEAE/91-337--------------LLRTH----TSPVQVRTM.....E-------SQ------Q...PP-IR-IV---------------
SYFA_RICPR/92-334--------------LLRTH----TSTVQIRAM.....K-------NG------K...PP-FR-FI---------------
SYFA_PYRAB/223-496--------------MPRAH----ATALSARQL....AK-------GI------E...IP-GK-YF---------------
SYFA_STAAW/94-343--------------LLRTH----TSPVQARTM.....E-------SR------HG.QGP-VK-II---------------
SYFA_UREPA/86-332--------------MLRTH----CTTTTAQFL....EN-------NV------N...KD-IR-IM---------------
SYFA_METTH/232-503--------------VLRTH----TTCVSARFL.....S-------EN------E...PP-LK-MF---------------
SYFA_ARATH/198-478--------------LLRTH----TTAVSSRMLYA.LAQ-------KP------F...VP-KK-YF---------------
SYFA_CAMJE/84-329--------------LLRTQ----TSPVQIRTM.....L-------AQ------K...PP-IR-MI---------------
SYFA_THETH/85-346--------------LLRTH----TSPMQVRYM.....V-------AH------T...PP-FR-IV---------------
SYFA_DEIRA/85-334--------------LLRTH----TSPMQIRYM.....V-------DH------E...PP-FK-IV---------------
SYFA_HELPJ/84-328--------------LLRTH----TSPVQIHTM.....Q-------EQ------T...PP-IK-MI---------------
SYFA_XYLFA/93-332--------------LLRTH----TSGVQVRYM.....S-------DH------R...PP-LR-MI---------------
Q98QL3_MYCPU/81-313--------------LLRTH----NTGVSAREL....ER-------NK------N...KA-FS-NF---------------
SYFA_THEMA/90-325--------------LLRTH----TSPVQIRTM.....L-------ER------K...PP-IA-II---------------
SYFA_BACAN/92-341--------------LLRTH----TSSVQARTM.....E-------NN------KE.KGP-IK-II---------------
SYFA_THEVO/209-478--------------ILRTH----TTVTTARYL....YE-------HN------T...YP-QA-IF---------------
SYFA_ECOLI/91-326--------------LLRTQ----TSGVQIRTM.....K-------AQ------Q...PP-IR-II---------------
SYFA_SYNY3/96-331--------------LLRTH----TSPVQIRYM.....E-------KH------D...PP-IR-IV---------------
SYFA_AERPE/218-483--------------ILRSQ----TTAVSARIL....AT-------RP------N...PP-AR-FF---------------
SYFA_ARCFU/200-469--------------VLRTH----TTAITIHYL....AE-------NP------E...PP-QK-AF---------------
SYFA_MYCGE/88-339--------------LLRTH----CTATTLKAVRT.SKK-------TN------N...PD-IR-VV---------------
SYFA_TREPA/280-552--------------LLRSQ----GTALSARHL.....P-------TA------H...IP-GK-YF---------------
SYFA_SCHPO/208-490--------------VLRTH----TTAVSANMLYK.LAQ-------NG------F...HP-AK-YF---------------
SYFA_CAUCR/91-342--------------LLRTH----TSPVQVRTM.....V-------SQ------K...PP-IR-II---------------
SYFA_STRPN/97-347--------------LLRTH----TSPVQARAM.....D-------AH------DFSKGP-LK-MI---------------
SYFA_ENTFA/94-344--------------LIRTH----TSPVQARTM.....E-------KH------DFSKGA-LR-MI---------------
SYFA_RHILO/95-349--------------LLRTH----TSPVQIRTM.....E-------KQ------K...PP-IR-IV---------------
SEPS_ARCFU/103-355--------------TLRSH----MTTGWFITLSH.IAD-------KL------P...LP-IK-LF---------------
SYFA_TROWT/94-333--------------LLRTH----TSPVQLRAL.....V-------SN------P...LP-LY-CV---------------
SYFA_MYCLE/94-337--------------LLRTH----TSPVQVRTL.....L-------ER------E...LP-VY-VI---------------
SYFA_METJA/212-480--------------ILRTH----TTASSIRYLASLSDE-------EK------N...KP-HK-VF---------------
SYFA_STRCO/93-354--------------VLRTH----TSPVQIRSA.....L-------TR------E...LP-VY-VI---------------
SYFA_SULSO/200-463--------------MLRSQ----TTATTARVL....AS-------RP------K...AP-QK-VF---------------

PF02091

SYGM2_ARATH/73-356--------------YVEPS----IRPDDSRYGENPNRL----------------------QR-HT---------------
SYG_CHLPN/8-291--------------YVEPS----RRPQDGRYGVHPNRL----------------------QN-YH---------------
SYG_CHLTR/8-291--------------YIEPS----RRPQDGRYGQHPNRL----------------------QK-YH---------------
SYGA_MORCA/9-296--------------YVQPS----RRPTDGRYGDNPNRL----------------------QH-YY---------------
SYGA_ECOLI/9-298--------------YVQPS----RRPTDGRYGENPNRL----------------------QH-YY---------------
SYGA_COXBU/9-296--------------YVQPS----RRPTDGRYGDNPNRT----------------------QH-YY---------------
SYGA_BACSU/3-286--------------YVEPS----RRPADGRYGENPNRL----------------------YQ-HH---------------
SYGA_HELPY/4-291--------------YVAPS----RRPTDGRYGENPNRL----------------------GS-YY---------------
SYGA_SYNY3/5-288--------------YVEPC----RRPTDGRYGENPNRV----------------------QH-YF---------------

PF03590

ASNA_STRPN/3-246--------------TLARF----GFGEGEGLFVHMKAL-------RP------D----E-DS-LD---------------
ASNA_TREPA/3-246--------------TLARY----GFQDNEGLFVHMIAL-------RP------D----E-DF-LD---------------
ASNA_HAEIN/3-246--------------TLARF----NFKEDEGLFVHMKAL-------RP------D----E-DS-LD---------------
ASNA_UREPA/6-240--------------ALLDY----GFSLYEGLYTDMNAI-------R.------A----D-DD-ID---------------
ASNA_PASMU/3-246--------------TLARF----NFAQGEGLFVHMTAL-------RP------D----E-DS-LD---------------
ASNA_ECOLI/3-246--------------TLGQH----DFSAGEGLYTHMKAL-------RP------D----E-DR-LS---------------

PF01411

SYA_YEAST/38-617--------------CIRAGGKHNDLEDVGKDSYH-HTF-------FEMLGNWSFG....-.D-YF---------------
SYAC_HUMAN/9-597--------------CIRAGGKHNDLDDVGKDVYH-HTF-------FEMLGSWSFG....-.D-YF---------------
SYA_SCHPO/14-598--------------CIRAGGKHNDLEDVGKDNYH-HTM-------FEMLGNWSFG....-.D-YF---------------
SYA_CHLPN/5-550--------------CIRAGGKHNDLDNVGHTSRH-LTF-------FEMLGNFSFG....-.D-YF---------------
SYA_SYNY3/12-554--------------CIRTN....DIENVGRTARH-HTF-------FEMLGNFSFG....-.D-YF---------------
SYA_ARATH/63-638--------------CIRAGGKHNDLDDVGKDTYH-HTF-------FEMLGNWSFG....-.D-YF---------------
SYA_PYRHO/61-605--------------SIRFT....DIDNVGITGRH-FTI-------FEMMAHHAFNYPGK-PI-YW---------------
SYA_HAEIN/6-555--------------CVRPGGKHNDLENVGYTARH-HTF-------FEMLGNFSFG....-.D-YF---------------
SYA_THIFE/5-557--------------CMRAGGKHNDLENVGYTARH-HTF-------FEMLGNFSFG....-.D-YF---------------
SYA_METTH/58-581--------------SIRLN....DVDNVGRTGRH-LTC-------FTMGGHHAFNSEDN-TV-YW---------------
SYA_METJA/61-582--------------CIRLN....DIDNVGRTGRH-LTC-------FTMGGHHAFNREDD-FK-YW---------------
SYA_MYCGE/7-560--------------CLRVN....DIENVGFTSRH-QTL-------FEMLGNFSIG....-.D-YF---------------
SYA_AQUAE/7-551--------------CLRVSGKHNDLEQVGYTSRH-HTF-------FEMLGNFSFG....-.D-YF---------------
SYA_CHLTR/5-553--------------CIRAGGKHNDLENVGHTSRH-LTF-------FEMLGNFSFG....-.D-YF---------------
SYA_RICPR/8-559--------------SLRAGGKHNDLEHVGYTARH-HTF-------FEMLGNFSFG....-.D-YF---------------
SYA_BARBA/6-556--------------CVRAGGKHNDLDNVGYTARH-HTF-------FEMLGNFSFS....-.N-YF---------------
SYAC_BOMMO/9-597--------------CIRAGGKHNDLDDVGKDVYH-HTF-------FEMMGNWSFG....-.D-YF---------------
SYA_THET8/5-566--------------CLRVG....DIENVGRTSRH-NTY-------FEMLGNFSFG....-.D-YF---------------
SYA_MYCTU/5-576--------------CIRTP....DIDEVGITTRH-NTF-------FQMAGNFSFG....-.D-YF---------------
SYA_ARCFU/64-592--------------CIRLD....DLDSVGRTGRH-LTL-------FEMMAHHAFNYPGK-EI-YW---------------
SYAC_CAEEL/8-598--------------CIRAGGKHNDLDDVGKDVYH-HTY-------FEMLGNWSFG....-.D-YF---------------
SYA_ECOLI/7-556--------------CVRAGGKHNDLENVGYTARH-HTF-------FEMLGNFSFG....-.D-YF---------------
SYA_MYCPN/7-559--------------CLRVN....DIENVGFTSRH-QTL-------FEMLGNFSIG....-.D-YF---------------
SYA_HELPY/2-546--------------CMRAGGKHNDLENVGYTARH-HTL-------FEMLGNFSFG....-.D-YF---------------
SYA_BACSU/8-558--------------AIRTN....DIENVGKTARH-HTF-------FEMLGNFSIG....-.D-YF---------------

PF03099

LPLA_YEAST/163-273--------------NFELL----RRFSGGG.....TVL-------HD-----------.-LG.NV---------------
Q9ZIU6_BORPT/40-170--------------CLLGA----HLQETGRGR.AGRPW-------QN-----------R-VGAAL---------------
Q9Z7T6_CHLPN/47-157--------------HIPII----RRYSGGG.....TVF-------ID-----------.-SN.TL---------------
Q9ZD17_RICPR/16-161--------------YAIFA----KSQTRGRGR.SGKNW-------QS-----------R-LG.NL---------------
O66622_AQUAE/46-165--------------PVKVV----RRPTGGG.....ALL-------HG-----------W-...DL---------------
Q9R9L1_RHIML/22-149--------------LWITA----VRQTGGRGR.RGRAW-------FS-----------E-PG.NL---------------
Q49107_MYCCA/44-154--------------NVKIV----KRNTGGG.....TVY-------QD-----------.-LG.NV---------------
O69817_STRCO/180-302--------------GIEVV----RRISGGG.....AMF-------VE-----------P-GN.TI---------------
O27938_METTH/23-148--------------TVVIA----KTQSRGRGR.RGKPW-------IS-----------P-QG.GI---------------
BPL1_YEAST/386-536--------------LLHVG----TIQVSGRGR.GGNTW-------IN-----------P-KGVCA---------------
Q9Z740_CHLPN/7-132--------------TVIST----KCQTAGTGK.FGKSW-------KS-----------S-KG.DL---------------
O45303_CAEEL/54-165--------------NIQIV----RRHSGGG.....TVY-------HD-----------.-LG.NL---------------
LIPB_RICPR/47-164--------------DIPVI----YTGRGGK.....FTF-------HG-----------P-GQ.RV---------------
LIPM_BACSU/51-189--------------NLGFV----RRPTGGR.....GVL-------HD-----------.-.Q.EL---------------
LIPB_CYACA/47-160--------------LVNLH----RVDRGGE.....VTY-------HD-----------Y-GQ.VI---------------
O67557_AQUAE/109-224--------------GIEVN----RRITGGG.....AIY-------FD-----------.-EL.QI---------------
O84507_CHLTR/46-156--------------GIPII----RRYSGGG.....TVF-------LD-----------.-AD.SL---------------
LIPB_KLULA/132-268--------------KPKFV----QAERGGQ.....VTF-------HG-----------P-GQ.IV---------------
O73952_9EURY/15-131--------------TVIVA----DTQTMGHGR.IGRRW-------ES-----------P-PG.GL---------------
O57883_PYRHO/15-131--------------TVIVA----DKQTMGHGR.LNRKW-------ES-----------P-EG.GL---------------
O84730_CHLTR/7-132--------------TVITT----REQTAGRGK.FGRVW-------HS-----------T-DQ.DL---------------
BPL_METJA/5-126--------------FIVLA----DKQNNGKGR.WGRVW-------YS-----------D-EG.GL---------------
O83376_TREPA/20-139--------------AVFCA----GEQVAGRGRGDQRKW-------QS-----------E-PGKNL---------------
LPLA_AERPE/43-154--------------GVPVV----RRISGGG.....AVF-------HD-----------.-LG.NM---------------
LPLA_MYCGE/47-159--------------KVNLF----RRFSGGG.....AVF-------HD-----------.-LG.NI---------------
O66837_AQUAE/7-123--------------TALVA----DRQTKGRGR.LGRKW-------LS-----------Q-EG.GL---------------
LIPB_HAEIN/48-159--------------EIPVV----QSVRGGQ.....ITY-------HA-----------P-GQ.QV---------------
BPL1_SCHPO/358-503--------------FTVLG----NYQTAGRGR.GQNMW-------VS-----------P-YG.TL---------------
P72816_SYNY3/40-164--------------LVAIA----REQTAGRGQ.WGRTW-------QS-----------P-PG.GL---------------
LIPB_ECOLI/49-159--------------DIPVI----QSDRGGQ.....VTY-------HG-----------P-GQ.QV---------------
LPLA_SCHPO/66-176--------------FVNII----RRKSGGG.....TVF-------HD-----------.-FG.NL---------------
O32511_DEIRD/91-219--------------AVVVA----ERQTAGRGR.RGRVW-------DT-----------T-HG.TL---------------
Q9WZG7_THEMA/43-167--------------WIDVV----RRPSGGR.....ALL-------HH-----------.-.R.EI---------------
LIPB_PSEAE/48-158--------------DIPVI----QVDRGGQ.....VTY-------HG-----------P-GQ.LV---------------
Q9WY67_THEMA/8-130--------------TVVVA----LEQTSGYGR.SGRHW-------HS-----------P-KG.GL---------------
P96884_MYCTU/32-158--------------VVLIA----EHQTAGRGR.HGRGW-------AA-----------T-ARAQI---------------
Q9SL92_ARATH/116-244--------------SVCVT----DIQFKGRGR.TKNVW-------ES-----------P-KG.CL---------------
O25760_HELPY/8-130--------------ILIVA----KNQSAGIGS.RGNIW-------EG-----------A-KS.AL---------------
Q9V2B8_PYRAB/79-190--------------DGVIA----KEQTKGRG..RSDPW-------IS-----------L-PG.GL---------------
Q8SX78_DROME/101-210--------------GITLA----RRNSGGG.....AVY-------HD-----------.-LG.NL---------------
O30162_ARCFU/85-200--------------ALFFA----NRQTAGRGR.HGRKW-------LS-----------E-EG.GL---------------
LIPT_BOVIN/74-185--------------GVKLA----RRRSGGG.....TVY-------HD-----------.-MG.NI---------------
LIPB_YEAST/125-262--------------RPKFV----QVERGGQ.....VTF-------HG-----------P-GQ.IV---------------
O84287_CHLTR/47-181--------------GVSAA----SRPTGGG.....VTF-------HN-----------.-.S.DY---------------
BIRA_BACSU/88-214--------------TLVVA----DKQTAGRGR.MSRVW-------HS-----------Q-EGNGV---------------
BIRA_PARDE/1-127--------------AWVLA----REQFAGRGR.RGREW-------VM-----------P-AG.NF---------------
LIPL_BACSU/62-186--------------GYRVI----VRNSGGL.....AVV-------LD-----------.-DG.VL---------------
LIPB_DEIRA/141-265--------------GIDVF----AVERGGD.....VTY-------HG-----------P-GQ.LV---------------
Q52660_RHOCA/5-131--------------AWVFA----HRQTAGRGR.RGRDW-------LM-----------P-SG.NF---------------
O67765_AQUAE/41-157--------------GIPVI----RREVGGG.....AVL-------LH-----------.-EN.QV---------------
LPLJ_BACSU/44-155--------------GIIVV----RRLSGGG.....AVY-------HD-----------.-LG.NL---------------
LIPB_SYNY3/51-164--------------PAELW----RTERGGE.....VTY-------HC-----------P-GQ.LV---------------
LIPB_MYCLE/54-171--------------GVPVV----ETDRGGK.....ITW-------HG-----------P-GQ.LV---------------
BPL1_HUMAN/471-603--------------LIVIA----ARQTEGKGR.GGNVW-------LS-----------P-VG.CA---------------
P74052_SYNY3/32-161--------------SLGLV----TRPSGGR.....AVL-------HQ-----------.-.G.GL---------------
Q9Y9E5_AERPE/44-177--------------GYVLV----RRPTGGA.....ALL-------HP-----------W-ER.EI---------------
BIRA_HAEIN/74-192--------------DLCVA----EYQTAGRGR.RGRQW-------LS-----------P-FAGQI---------------
BIRA_ECOLI/83-208--------------DACIA----EYQQAGRGR.RGRKW-------FS-----------P-FGANL---------------
LIPB_MYXXA/48-170--------------GAEVF----ETNRGGD.....VTY-------HG-----------P-GQ.LV---------------
Q9V2C7_PYRAB/15-131--------------TVIVA----DRQIKGHGR.LERKW-------ES-----------P-EG.GL---------------
Q9UX52_SULSF/9-132--------------FLVIA----EEQTKARGR.LGRSW-------YS-----------P-KG.GL---------------
LIPB_SCHPO/60-172--------------KAKVV----KALRGGQ.....TTF-------HG-----------P-GQ.IL---------------
Q9Z8A7_CHLPN/47-181--------------GLDAA----VRPTGGG.....FVF-------HK-----------.-.G.DY---------------
O59156_PYRHO/46-163--------------GIPVV----RRITGGG.....SVF-------HD-----------E-YG.EI---------------
LIPT2_DROME/56-171--------------GADFH----RTDRGGL.....ITF-------HG-----------P-GQ.LV---------------
LPLA_ECOLI/46-158--------------NVRLA----RRSSGGG.....AVF-------HD-----------.-LG.NT---------------

PF04424

FA63A_HUMAN/143-268--------------QNVDD----AMTVLPKLATGLDVN----------------------VR-FT...............
FA63B_HUMAN/272-397--------------QNMSD----AMAILHKLQTGLDVN----------------------VR-FT...............
YP191_YEAST/34-157--------------TDISE----LLSLLPRLHEGLNIN----------------------PE-FN...............
Q9T054_ARATH/67-194--------------QNIAD----AIDLLPRLTTGIDVN----------------------IK-FR...............
O82744_ARATH/44-169--------------TDEYI----DIGLIRKLACGINVD----------------------LK-FERKYLIVMTGNVLLAC
YGI2_YEAST/34-157--------------VDKQQ----LLQILPQLYSGLNIN----------------------PE-FN...............
Q9N370_CAEEL/82-206--------------ANLGD----VMNIMETLVNGLDVN----------------------VK-FS...............
YAGB_SCHPO/65-177--------------KNQQS----LQDKLTSMHFGQQLN----------------------PC-LY...............

PF00587

SYG_YEAST/76-406SIGKS.F--RNEI..---------..SPRA---------GLLRV--REFLMAE---------------------------
SYP_ZYMMO/49-218HIQWK.F--RDEV..---------..RPRF---------GVMRG--REFLMKD---------------------------
SYTM_SCHPO/78-251DFSPL.H--RNEA..---------.SGALS---------GLTRL--RCFHQDD---------------------------
SYSM_SCHPO/220-399GVSRA.Y--RREAGA---------RGKENR---------GLYRL--HEFTKVE---------------------------
SYG_HUMAN/157-453QIGNS.F--RNEI..---------..SPRS---------GLIRV--REFTMAE---------------------------
SYT2_BACSU/275-439EFGQV.H--RHEY..---------.SGALN---------GMLRV--RTFCQDD---------------------------
SYS_AERPE/198-368GVSPC.F--RKEAGA---------GNRDLK---------GIFRV--HQFHKVE---------------------------
SYT1_AERPE/51-229EFGRV.H--RYEP..---------.SGSIY---------GLLRV--RGFTQDD---------------------------
SYH_ECOLI/21-188YIGPM.F--RHE...---------..RPQ.---------.KGRY--RQFHQLG---------------------------
SYH_STREQ/19-188YIGSM.F--RYE...---------..RPQ.---------.AGRL--REFHQIG---------------------------
SYH_ORYSJ/369-529QIAKV.Y--RRD...---------..NPS.---------.KGRY--REFYQCD---------------------------
SYP_SYNY3/49-222QIQTK.F--RDEI..---------..RPRF---------GLMRG--REFIMKD---------------------------
SYG_THET8/42-301QIGKA.F--RNEI..---------..TPRN---------FIFRV--REFEQME---------------------------
SYH_HAEIN/21-187YIGPM.F--RHE...---------..RPQ.---------.KGRY--RQFHQVG---------------------------
SYSC_HUMAN/203-386GLSTC.F--RQEVGS---------HGRDTR---------GIFRV--HQFEKIE---------------------------
SYG_DEIRA/42-302QIGKA.F--RNEI..---------..TPRN---------FIFRV--RELEQME---------------------------
SYH_PORPU/20-187YSGPM.F--RYE...---------..RPQ.---------.SGRQ--RQFHQLG---------------------------
SYP_HELPJ/49-219QIHTK.F--RDEI..---------..RPRF---------GLVRA--REFIMKD---------------------------
SYPC_CANAX/59-225QINPK.F--RNEK..---------..RPRG---------GLLRG--KEFLMKD---------------------------
SYSM_YEAST/191-366GVSRC.Y--RAEAGA---------RGKDTK---------GLYRV--HEFTKVE---------------------------
SYP_AQUAE/49-219QIQVK.F--RDEK..---------..RPRF---------GLIRA--REFIMKD---------------------------
SYG_CAEEL/167-463QIGLG.F--RNEI..---------..SPRQ---------GLIRV--REFTMCE---------------------------
O94025_CANAX/62-240DFSSL.H--RNEA..---------.SGALS---------GLTRV--RRFHQDD---------------------------
SYTM_YEAST/68-246DFSPL.H--RNEA..---------.SGALS---------GLTRL--RKFHQDD---------------------------
SYS_COXBU/172-344AQTPC.F--RSEAGS---------YGKDVR---------GMIRQ--HQFQKVE---------------------------
SYS_BUCAP/172-346AHTPC.F--RSEASS---------YGRDSK---------GLIRL--HQFDKVE---------------------------
SYS_HALMA/177-355AFSPN.F--RREAGE---------HGTETR---------GYVRV--HQFHKVE---------------------------
SYH_METJA/21-183YFANC.F--RYE...---------..RPQ.---------.AGRF--REFWQMG---------------------------
SYPM_HUMAN/97-268QVTRK.F--RDEP..---------..RPRF---------GLLRG--REFYMKD---------------------------
SYT_HELPY/249-413EYGVV.H--RHEK..---------.SGVLH---------GLLRV--REFTQDD---------------------------
SYP_RICPR/49-219HIQWK.F--RDEI..---------..RPRF---------GVMRG--REFLMKD---------------------------
SYS_THEMA/175-346SYTPC.Y--RREAGS---------YGKDVR---------GMIRQ--HQFDKVE---------------------------
SYS_BORBU/171-341GFSHC.F--RKEAGA---------YGQLSK---------GLYRV--HQFSKVE---------------------------
SYS_BACSU/173-344AFSAC.F--RSEAGS---------AGRDTR---------GLIRQ--HQFNKVE---------------------------
SYT_METTH/225-383ELSTYSF--RLEK..---------.KGEVV---------GLKRL--RGFTMPD---------------------------
SYG_ARCFU/39-308QIGRA.Y--RNEI..---------..SPRQ---------GVIRL--REFNQAE---------------------------
SYT_BORBU/216-382ELGTV.Y--RYEK..---------.IGALH---------GMMRA--RGFTQDD---------------------------
SYH_MYCPN/20-187TIGTM.Y--RYE...---------..RPQ.---------.SNRY--REHYQFS---------------------------
SYT_AQUAE/274-440ELGTV.Y--RYEL..---------.SGVLH---------GLLRV--RGFTQDD---------------------------
Q9VUK8_DROME/189-485QIGNS.F--RNEI..---------..SPRS---------GLIRV--REFTMAE---------------------------
SYH_ARCFU/19-179YFANC.F--RYE...---------..RPQ.---------.KGRY--REFWQFG---------------------------
SYH_YEAST/71-233HIAKV.Y--RRD...---------..QPAM---------TKGRM--REFYQCD---------------------------
Q9VF85_DROME/153-322AVSRC.Y--RAETS.---------GLQEEK---------GIYRV--HQFNKVE---------------------------
SYH_STAAW/18-186YNGPM.F--RYE...---------..RKQ.---------.KGRY--RQFNQFG---------------------------
SYS_SYNY3/181-351AYTPC.F--RREAGS---------YGRDTK---------GLIRL--HQFNKVE---------------------------
O65395_ARATH/266-437AFSHC.F--RTEAGA---------AGAATK---------GLYRV--HQFSKAE---------------------------
SYT_CHLTR/267-432EIGHV.H--RHEL..---------.SGALS---------GLMRV--RTFHQDD---------------------------
SYS_PYRHO/195-365GVSPC.F--RKEAGT---------AGKDTK---------GIFRV--HQFHKVE---------------------------
SYG_METTH/42-319QLGKS.Y--RNEI..---------..SPRQ---------GVIRL--REFTQAE---------------------------
SYH_BACSU/19-187YVGPM.F--RYE...---------..RPQ.---------.TGRY--RQFYQFG---------------------------
SYS_SULSO/195-365GISPA.F--RKEASA---------ANKDLK---------GIFRV--HQFHKVE---------------------------
SYS_STRCO/173-343GFSPC.F--RREAGS---------HGKDTR---------GIFRV--HQFDKVE---------------------------
YHI0_YEAST/227-403QWNSV.V--RWEF..---------..KHPQ---------PFLRT--REFLWQE---------------------------
SYH_THET8/19-186MAGPM.F--RAE...---------..RPQ.---------.KGRY--RQFHQVN---------------------------
SYT_PYRAB/237-399ELTRYSF--RREK..---------.RGELS---------GLRRL--RAFTMPD---------------------------
SYT_METJA/228-387ELSTYSF--RYEQ..---------.RGELV---------GLKRL--RCFTMPD---------------------------
SYP_MYCTU/51-221QIQTK.Y--RDEA..---------..RPRA---------GILRA--REFVMKD---------------------------
SYH_AQUAE/19-186YEGPM.F--RYE...---------..RPQ.---------.AGRY--RQFHQIG---------------------------
SYTC_YEAST/359-523DFGVI.H--RNEF..---------.SGALS---------GLTRV--RRFQQDD---------------------------
SYH_DEIRA/28-196TSGPM.F--RAE...---------..RHQ.---------.KGRY--RQFTQVD---------------------------
SYS_MYCPN/169-338ATGVN.F--RQEAGS---------AGKQTK---------GTIRL--HQFQKVE---------------------------
SYP_BACSU/49-219QIQSK.F--RDEK..---------..RPRF---------GLLRG--REFIMKD---------------------------
SYT_SYNY3/228-403EFGTV.Y--RYEQ..---------.SGELG---------GLTRV--RGFTVDD---------------------------
SYT_THEMA/271-435EFGRV.H--RYER..---------.SGVLH---------GLMRV--RSFTQDD---------------------------
SYP_TREPA/47-217QINAK.Y--RDEI..---------..RPRY---------GLMRA--REFTMAD---------------------------
SYHM_HUMAN/73-235HVGKV.W--RRE...---------..SPTI---------VQGRY--REFCQCD---------------------------
SYT_RICPR/272-437EFGLC.H--RNEA..---------.SGALH---------GLMRV--RSLVQDD---------------------------
SYP_ECOLI/49-219QIQTK.F--RDEV..---------..RPRF---------GVMRS--REFLMKD---------------------------
SYS_ARATH/179-353GYSSC.F--RKEAGS---------HGRDTL---------GIFRV--HQFEKIE---------------------------
SYP_CHLTR/49-221QIGTK.F--RDEI..---------..RPRF---------GLMRA--KEFLMED---------------------------
SYG_AERPE/42-324QVGRV.G--RNEI..---------..SPRQ---------ALVRL--REFTIME---------------------------
SYH_CHLPN/28-193YILPM.F--RYE...---------..RQQ.---------.AGRY--RQHHQFG---------------------------
SYT_HAEIN/273-438EFGSC.H--RNEP..---------.SGSLH---------GLMRV--RGFTQDD---------------------------
SYH_TREPA/25-187HFAKV.W--RGE...---------..KPQ.---------.MGRY--REFTQCD---------------------------
SYH_RICPR/21-188STGPV.F--RYD...---------..RPQ.---------.AGRQ--RQFHQLN---------------------------
SYS_ARCFU/192-362GVSPC.F--RKEAGA---------HGKDTK---------GIFRV--HQFNKVE---------------------------
O45869_CAEEL/49-223QIGEK.F--RDEM..---------..NPRF---------GLMRG--RQFLMKD---------------------------
SYS_HELPJ/174-344AHTPC.F--RSEAGS---------AGKDTR---------GMIRQ--HQFDKVE---------------------------
SYH_SCHPO/79-242HIAKV.Y--RRD...---------..QPAM---------TKGRM--REFYQCD---------------------------
SYG2_YEAST/45-343SIGKS.F--RNEI..---------..SPRS---------GLLRV--REFLMAE---------------------------
SYHC_HUMAN/72-234HIAKV.Y--RRD...---------..NPAM---------TRGRY--REFYQCD---------------------------
SYT_MYCLE/310-489EFGTI.Y--RYEK..---------.SGVVH---------GLTRA--RGFTMDD---------------------------
SYS_THET2/168-340GYAPA.F--RSEAGS---------FGKDVR---------GLMRV--HQFHKVE---------------------------
SYP_THEMA/49-219QIANK.Y--RDEI..---------..RPRF---------GLLRA--REFIMKD---------------------------
SYT_DEIRA/279-448EFGTV.Y--RYEQ..---------.SGELN---------GLTRV--RGFTQDD---------------------------
SYS_AQUAE/174-344AYTPC.Y--RREAGA---------YGKDIR---------GIIRQ--HQFDKVE---------------------------
SYT_ARCFU/227-389ELTRYSF--RKEQ..---------.RGELV---------GLRRL--RAFTMPD---------------------------
SYS_MYCTU/169-339GWSSC.F--RREAGS---------HGKDTR---------GIIRV--HQFDKVE---------------------------
SYG_MYCTU/45-278QIGKS.F--RNEI..---------..TPGN---------FIFRT--REFEQME---------------------------
SYTC_HUMAN/352-516DFGVL.H--RNEL..---------.SGALT---------GLTRV--RRFQQDD---------------------------
SYT_MYCPN/198-368EDSIL.H--RFEA..---------.SGGLT---------GLERV--RCMTLLD---------------------------
SYPM_YEAST/56-225QMTRK.Y--RDEI..---------..RPRG---------GILRG--REFLMKD---------------------------
SYH_MYCGE/20-187CIGSM.Y--RYE...---------..RPQ.---------.NNRF--REHWQFS---------------------------
SYH_THEMA/19-186YIGPM.F--RYE...---------..KPQ.---------.SGRL--RQFHQVG---------------------------
SYG_PYRAB/44-320QIGKA.Y--RNEI..---------..SPRQ---------GMIRL--REFTQAE---------------------------
SYG_METJA/42-324QIGKS.Y--RNEI..---------..SPRQ---------GVIRL--REFTQAE---------------------------
SYS_RICPR/171-341AYTTC.F--RSEAGS---------SGRDTR---------GMIRL--HQFGKVE---------------------------
SYH_METTH/19-182YFGSC.F--RYE...---------..RPQ.---------.AGRF--RQFWQFG---------------------------
SYH_MYCLE/30-193YAGPF.F--RYE...---------..RPQ.---------.AGRC--RQLQQVG---------------------------
SYS_DEIRA/170-342GFSAA.F--RREAGS---------AGRDVR---------GLIRV--HEFRKVE---------------------------
SYS_HAEIN/173-348AHTPC.F--RSEAGS---------YGRDTR---------GLIRM--HQFDKVE---------------------------
SYPM_SCHPO/54-224QIGRK.F--RDEL..---------..RPRG---------GLLRG--REFMMKD---------------------------
SYT1_BACSU/276-446ELGTM.H--RYEM..---------.SGALS---------GLQRV--RGMTLND---------------------------
SYT_TREPA/223-390EFGSC.T--RNEP..---------.SGSLH---------GVMRV--RGFVQDD---------------------------
SYS_TREPA/171-342GLSHC.F--RKEAGA---------AGQFSR---------GLYRV--HQFTKLE---------------------------
SYTM_ARATH/346-510DFGVL.H--RNEA..---------.SGALS---------GLTRV--RRFQQDD---------------------------
SYSC_SCHPO/179-353GYSTC.Y--RREAGS---------HGRDAW---------GIFRV--HAFEKIE---------------------------
SYS_STAA8/173-344GQSAC.F--RSEAGS---------AGRDTR---------GLIRL--HQFDKVE---------------------------
SYH_CHLTR/28-193YILPM.F--RYE...---------..RQQ.---------.SGRY--RQHHQFG---------------------------
O82413_ARATH/85-250AIGQC.W--RYE...---------..RMT.---------.RGRR--REHYQWN---------------------------
SYS_CHLPN/172-344ACTPC.F--RREAGA---------AGAQER---------GLVRV--HQFHKVE---------------------------
SYH_SYNY3/20-187YTGPM.F--RYE...---------..RPQ.---------.AGRQ--RQFHQLG---------------------------

PF13393

Q1K3M2_DESAC/22-332YSCRV-L..RH---------------TEEQ..A......G..KD..REVFQSG---------------------------
B5JRM1_9GAMM/12-323YMGTV-L..HT---------------RASE..F......A..AS..RSPLQVG---------------------------
C0N861_9GAMM/12-325YIGSV-L..HT---------------LPEG..Q......G..KS..RNPIQLG---------------------------
HISZ_PSEU5/12-321YAGSV-L..HA---------------KPQA..L......S..TS..RSPIQLG---------------------------
B0SA16_LEPBA/18-333YFAKK-I..RD---------------HKKR..N......A..SR..REVLQVG---------------------------
HISZ_ANAD2/9-318YDGPV-L..RA---------------REAR..A......G..RP..REVYQAG---------------------------
HISZ_ALHEH/17-328YIGSV-L..HA---------------RPEG..I......S..RS..RNPVQVG---------------------------
HISZ_MICAN/8-319YRANV-F..RR---------------PSAG.YH......G..RQ..VEFYQAG---------------------------
C8WUX4_ALIAD/25-356YCERV-Y..RR---------------TDDP..ASLSWASG..KA..AESTQVG---------------------------
HISZ_THISH/12-323YMGTV-L..HT---------------RPDG..F......A..GS..RSPMQVG---------------------------
HISZ_ANADF/9-318YDGPV-L..RA---------------REAR..A......G..RP..REVYQAG---------------------------
Q2BIN1_9GAMM/12-324YCGSV-V..HA---------------LPAQ..P......L..AS..RNPLQLG---------------------------
HISZ_HAHCH/12-320YIGSV-L..RT---------------KSPS..M......F..SS..RTPIQTG---------------------------
E6W5Z4_DESIS/15-323YSGSV-F..RS---------------INKH..E......G..NQ..AQVVQAG---------------------------
C9YB19_9BURK/9-313YCGPV-L..HT---------------RPAA..P......H..AT..REPLQFG---------------------------
C6XEF7_METSD/9-315YAGSV-L..RT---------------TPSG..L......A..QT..REPLQLG---------------------------
A1WUT1_HALHL/12-323YIGST-L..QA---------------RAEG..P......A..GS..RNAVQLG---------------------------
C4KMP4_BURPE/9-313YAGPV-L..HT---------------RPRG..L......H..AS..REQLQIG---------------------------
HISZ_LARHH/9-314YAGSV-V..HT---------------RASG..L......M..RS..REPLQVG---------------------------
HISZ_METFK/9-315YAGSV-L..RT---------------SPDG..L......A..RS..REPLHVG---------------------------
HISZ_RALME/10-314YAGNV-L..HA---------------RPAG..F......N..AT..REPIQIG---------------------------
B6C6F9_9GAMM/12-321YIGSV-L..HT---------------LSQG..L......G..GT..RNPIQVG---------------------------
D5CRS6_SIDLE/8-314YAGSV-L..HT---------------QPAG..L......M..RT..REPLQIG---------------------------
D0LNQ8_HALO1/14-324YEGAV-T..RM---------------QR.G..T......R..VQ..REILQAG---------------------------
HISZ_CELJU/17-327YAGHV-V..HA---------------RPKN..P......L..AT..RTPIQAG---------------------------
HISZ_CHRSD/12-323YCTTV-L..RA---------------KADK..H......Q..GG..RSPTQVG---------------------------
HISZ_TERTT/12-323YAGHV-V..HT---------------.RPQ.VA......L..GS..RTPIQVG---------------------------
A0Y7Z9_9GAMM/12-323YAGSV-L..HT---------------KPKS..L......M..AS..RSPIQIG---------------------------
Q0VMF2_ALCBS/13-322YCSSA-L..RT---------------RPVV..A......G..GT..RLPYQLG---------------------------
A3RVD4_RALSL/9-313YAGSV-L..HT---------------RPSG..F......H..VT..REPLQIG---------------------------
C6WV54_METML/9-315YAGSV-L..RT---------------KPDG..L......A..LT..REPLQIG---------------------------
B9Z696_9NEIS/9-315YAGSV-V..HA---------------RPSG..L......M..SS..REPLQVG---------------------------
HISZ_NITEU/9-320YASSV-V..HT---------------VPDE..I......T..RT..REPFQVG---------------------------
A4BLP9_9GAMM/17-328YLGAV-L..QT---------------RPEG..P......G..SS..RNPLQIG---------------------------
HISZ_SACD2/12-323YAGHV-M..YT---------------KPKG..P......L..AS..RTPIQVG---------------------------
Q1YRY2_9GAMM/12-321YAGTV-L..HT---------------RPRG..P......L..ES..RTPISIG---------------------------
HISZ_JANMA/9-313YSGSV