Sequence alignment for CL0045

PF01215

COX5_DICDI/2-120SKIVKFLKELAT.PSHSMEFFHKPASNSLL...........DASELNFVRRNI......KREDFGHEVLTGA.FGTLKSP
COX4_YEAST/21-155SRYLLQQKPVVK.TAQNLAEVNGPE..TLIGPGAKEGTVPTDLDQETGLARLELLGKLEGIDVFDTKPLDSSRKGTMKDP
COX4_SCHPO/29-164ASIRRNEQNVVKAAAQELANAKEPS..DLIGPGGRDGEVPTDLEQATGLERYELLSELSGRDAFDMKPLDASRKGTLTDP
COX5B_BOVIN/3-129SRLLRGVGAL...ASQALR.ARGPNGVSVVRSMASGGGVPTDEEQATGLEREVMLAARKGQDPYNILAPKAT.SGTKEDP

PF10276

Q4WE81_ASPFU/135-173--------------------------------------------------------------------------------
A1UT54_BARBK/21-59--------------------------------------------------------------------------------
Q2N7B3_ERYLH/42-90--------------------------------------------------------------------------------
Q3IZ23_RHOS4/25-64--------------------------------------------------------------------------------
A5FYN1_ACICJ/27-64--------------------------------------------------------------------------------
NDUS6_CAEEL/85-123--------------------------------------------------------------------------------
A5EM31_BRASB/21-59--------------------------------------------------------------------------------
A0CXJ8_PARTE/60-102--------------------------------------------------------------------------------
A0Q485_FRATN/12-52--------------------------------------------------------------------------------
Q2VNS3_9BACT/126-164--------------------------------------------------------------------------------
Q6BWG5_DEBHA/95-135--------------------------------------------------------------------------------
Q9ABN7_CAUCR/28-66--------------------------------------------------------------------------------
Q4P288_USTMA/166-204--------------------------------------------------------------------------------
Q2GBB3_NOVAD/11-54--------------------------------------------------------------------------------
Q0EVP8_9PROT/8-42--------------------------------------------------------------------------------
Q8J0P6_PARBR/138-176--------------------------------------------------------------------------------
Q0C112_HYPNA/17-55--------------------------------------------------------------------------------
Q9VMU0_DROME/81-119--------------------------------------------------------------------------------
NDUS6_ARATH/66-105--------------------------------------------------------------------------------
Q84SD6_ORYSJ/68-112--------------------------------------------------------------------------------
A6U8I2_SINMW/21-59--------------------------------------------------------------------------------
Q28RR5_JANSC/12-51--------------------------------------------------------------------------------
A0P451_9RHOB/21-59--------------------------------------------------------------------------------
Q5WTA2_LEGPL/20-60--------------------------------------------------------------------------------
Q55GR1_DICDI/53-91--------------------------------------------------------------------------------
Q7PW69_ANOGA/80-119--------------------------------------------------------------------------------
B7L0V2_METC4/21-59--------------------------------------------------------------------------------
A7IKB8_XANP2/21-59--------------------------------------------------------------------------------
A8LJP2_DINSH/12-51--------------------------------------------------------------------------------
Q0FDD3_9RHOB/12-49--------------------------------------------------------------------------------
Q0ATM3_MARMM/17-55--------------------------------------------------------------------------------
A5V7L6_SPHWW/14-58--------------------------------------------------------------------------------
Q57E02_BRUAB/21-59--------------------------------------------------------------------------------
Q0FRJ5_9RHOB/12-51--------------------------------------------------------------------------------
Q01CP7_OSTTA/91-142--------------------------------------------------------------------------------
Q5DC02_SCHJA/72-110--------------------------------------------------------------------------------
Q0G0C3_9RHIZ/21-59--------------------------------------------------------------------------------

PF00301

RUBR2_PSEOL/3-50--------------------------------------------------------------------------------
RUBR2_PSEOL/121-167--------------------------------------------------------------------------------
RUBR_PYRFU/3-49--------------------------------------------------------------------------------
RUBR1_METJA/21-69--------------------------------------------------------------------------------
RUBR_CLOSD/3-49--------------------------------------------------------------------------------
O26912_METTH/131-159--------------------------------------------------------------------------------
O50375_METTF/1-35--------------------------------------------------------------------------------
O26259_METTH/3-49--------------------------------------------------------------------------------
P94698_DESVU/7-55--------------------------------------------------------------------------------
RUBR_CUPNH/25-71--------------------------------------------------------------------------------
RUBR_MEGEL/3-48--------------------------------------------------------------------------------
RUBR_THETC/3-49--------------------------------------------------------------------------------
RUBR_ACIAD/3-49--------------------------------------------------------------------------------
RUBR_DESGI/3-49--------------------------------------------------------------------------------
RUBR_BUTME/3-49--------------------------------------------------------------------------------
RUBR_PEPAS/3-48--------------------------------------------------------------------------------
HUPJ_RHOCA/25-71--------------------------------------------------------------------------------
RUBR_SYNY3/17-63--------------------------------------------------------------------------------
RUBL_BRAJA/18-64--------------------------------------------------------------------------------
P96745_CLOBU/3-49--------------------------------------------------------------------------------
RUBH_METTH/1-35--------------------------------------------------------------------------------
P95500_9PSED/25-71--------------------------------------------------------------------------------
O27972_ARCFU/140-168--------------------------------------------------------------------------------
O05893_MYCTU/6-52--------------------------------------------------------------------------------
RUBR1_PSEOL/3-50--------------------------------------------------------------------------------
RUBR_CHLLT/3-49--------------------------------------------------------------------------------
RUBR_HELMO/3-49--------------------------------------------------------------------------------
RUBR_TREPA/3-49--------------------------------------------------------------------------------
RUBR2_CLOPE/3-49--------------------------------------------------------------------------------
RUBR_CLOPA/3-49--------------------------------------------------------------------------------
RUBR_METTH/13-59--------------------------------------------------------------------------------
O05894_MYCTU/3-50--------------------------------------------------------------------------------
RUBR1_DESDA/3-42--------------------------------------------------------------------------------
O29906_ARCFU/3-32--------------------------------------------------------------------------------
RUBR_DESVM/3-49--------------------------------------------------------------------------------
Q46496_DESBR/3-49--------------------------------------------------------------------------------
NORV_ECOLI/425-471--------------------------------------------------------------------------------
O28920_ARCFU/22-68--------------------------------------------------------------------------------
RUBR2_METJA/6-51--------------------------------------------------------------------------------
RUBR_AZOCH/21-67--------------------------------------------------------------------------------
RUBL_RHILV/17-63--------------------------------------------------------------------------------
O26576_METTH/3-40--------------------------------------------------------------------------------
O29905_ARCFU/114-142--------------------------------------------------------------------------------

PF06397

DFX_DESDA/2-37--------------------------------------------------------------------------------
DFX_DESVM/2-37--------------------------------------------------------------------------------
DESR_DESGI/2-37--------------------------------------------------------------------------------
DFX_DESB2/2-37--------------------------------------------------------------------------------
Q9FDN8_MOOTH/2-37--------------------------------------------------------------------------------
DFX_ARCFU/2-37--------------------------------------------------------------------------------
DFX_METTH/2-37--------------------------------------------------------------------------------
Q8TJP6_METAC/4-39--------------------------------------------------------------------------------

PF01215

COX5_DICDI/2-120VIVESIFHSRIVACEG----------GD-----GE-------EHDILFHTVAEKKP---TICLDC--GQVFKLKHISSEG
COX4_YEAST/21-155IIIESYDDYRYVGCTG----------SP-----AG-------SHTIMWLKPTVNEV---ARCWEC--GSVYKLNPVGVPN
COX4_SCHPO/29-164IMVTSLDPYRHIGCTG----------SP-----SG-------SHNLIWMTVYKDKL---RRCPEC--GSVYKLKFMGDPN
COX5B_BOVIN/3-129NLVPSITNKRIVGCIC----------EE-----DN-------S.TVIWFWLHKGEA---QRCPSC--GTHYKLVP.....

PF10276

Q4WE81_ASPFU/135-173-------NKRIVSCDG..........GG.....GP......LGHPRIFINTDK.PE..IATCGYC--GLPFA--------
A1UT54_BARBK/21-59-------GVKEFMCVG..........AT.....QP......FDHPHIFIDMGAADE...KICPYC--STLYR--------
Q2N7B3_ERYLH/42-90-------TTRRVSCDGAS.....DIRGGANYRPAA......LGHPRIYLEIDEH.G..YVDCGYC--DRRFV--------
Q3IZ23_RHOS4/25-64-------STWKVACDG..........GE.....GA......LGHPRVWLSIPHETG..FVECGYC--DRRYI--------
A5FYN1_ACICJ/27-64-------RERTVACDG..........GG.....GP......LGHPRVYLKIEDR....EVTCPYC--SRHYV--------
NDUS6_CAEEL/85-123-------DKRVVFCDG..........GH.....PA......LGHPKVYINLDK.PG..VHACGYC--GNRFY--------
A5EM31_BRASB/21-59-------GSREFMCVG..........AN.....PP......FDHPHVFLDLGNDKE...IICPYC--STLYR--------
A0CXJ8_PARTE/60-102-------DSDVVRCLG..........GT.....HI.....NAGHPQVYIKLDTRTEGTPQTCKYC--GLQYV--------
A0Q485_FRATN/12-52-------PGERVSC...................PTKYHENWNLHPRVYIDLKDKKT...NSCPYC--GTTFK--------
Q2VNS3_9BACT/126-164-------GAKEFMCVG..........AL.....PP......FDHPHIFIDMGDSND...AICPYC--STHYV--------
Q6BWG5_DEBHA/95-135-------DGNIAVCDG..........NK.....GDN....LQGHPKIFINLDQ.PK..ANTCGYC--GLRYA--------
Q9ABN7_CAUCR/28-66-------HGHRIACDG..........VG.....GA......LGHPRVWLEMGAA.G..FVDCPYC--DRRFV--------
Q4P288_USTMA/166-204-------SKRIAACDG..........GG.....GP......LGHPKVFINLDK.PG..PKPCPYC--GIRFE--------
Q2GBB3_NOVAD/11-54-------DHHRVKCDGAS.....DIRGG.....AA......LGHPRVWLEIDEK.G..YVECGYC--DKRFV--------
Q0EVP8_9PROT/8-42-------TEEVVSCSD..........NG..............QHPLVYINLKNGTG....RCQYC--GQKFE--------
Q8J0P6_PARBR/138-176-------KEKVVSCDG..........GG.....GP......LGHPRIFINTDK.PQ..ICMCEYC--GLPFA--------
Q0C112_HYPNA/17-55-------SSHKVSCNG..........GG.....GA......LGHPKVWYEMGDE.D..FVECKYC--DRRFI--------
Q9VMU0_DROME/81-119-------TERVVFCDG..........GD.....GP......LGHPKVYINLDK.PG..NHICGYC--GLRFV--------
NDUS6_ARATH/66-105-------DGRIVACEG..........DT.....NP.....ALGHPIEFICLDL.NE..PAICKYC--GLRYV--------
Q84SD6_ORYSJ/68-112-------EGRIAACDG..........RQ.....DKGRETGSLGHPIEYICLDL.DQ..PAVCKYC--GLRFV--------
A6U8I2_SINMW/21-59-------GVKEFMCTG..........AS.....VP......FDHPHIFVDMGDENE...KVCSYC--STLYR--------
Q28RR5_JANSC/12-51-------TAKRISCDG..........GE.....GA......LGHPRVWLMIDPDTG..FVECGYC--DKKFI--------
A0P451_9RHOB/21-59-------GAREFMCIG..........AN.....PP......FDHPHVFLDMGSENE...VVCPYC--STLYK--------
Q5WTA2_LEGPL/20-60-------HQLPLSC...................PTDEMELWNAHPKVYLPIEKTGV...EVCPYC--GSRFV--------
Q55GR1_DICDI/53-91-------EGSSVGCDG..........GN.....GP......LGHPMVYINLDG.KE..PQPCGYC--GLRFV--------
Q7PW69_ANOGA/80-119-------EQRVVCCDG..........GT.....DP.....ALGHPKVYINLDK.PG..AHACGYC--GQRFE--------
B7L0V2_METC4/21-59-------GSKEFMCIG..........AL.....PP......FDHPHVFLDMGSETE...IICQYC--STLFR--------
A7IKB8_XANP2/21-59-------GSKEFMCVG..........AK.....PP......FDHPHIFIDLGGDTE...AVCPYC--STLYR--------
A8LJP2_DINSH/12-51-------NQWRIACDG..........GE.....GA......LGHPRVWLQIPQEHG..WVECPYC--DARYI--------
Q0FDD3_9RHOB/12-49-------TSSRVACDG..........GV.....G........GHPRVWLQIPDDQG..WVECPYC--DCKYV--------
Q0ATM3_MARMM/17-55-------DQHRMACDG..........GG.....GA......LGHPRVYLEMGQD.D..FVECPYC--DRRFV--------
A5V7L6_SPHWW/14-58-------SSTRVACDGAS.....DIPGG.....EA......LGHPRVFIEIDPDIG..HADCGYC--DRRFV--------
Q57E02_BRUAB/21-59-------GVKEFMCVG..........AN.....PP......FDHPHVYLDMGDESE...IVCPYC--STLYR--------
Q0FRJ5_9RHOB/12-51-------DSHRIACDG..........GE.....GA......LGHPRVWLMIPPEEG..FVECPYC--DAKYV--------
Q01CP7_OSTTA/91-142-------AGDKVSCDSPGACKDRFGVGE.....GG......LGAPHTYYKLNDTSKEFPAKCKYC--GLRFY--------
Q5DC02_SCHJA/72-110-------KEHVISCDG..........GS.....GA......LGHPKVYINLDQ.PG..NHACGYC--GLRFY--------
Q0G0C3_9RHIZ/21-59-------GVTEFMCCG..........AN.....PP......HDHPHVFLDMGDERE...KICAYC--STLFK--------

PF00301

RUBR2_PSEOL/3-50----------SYKCPD..CNYVYDESAG-----NV------HEGFSPGTPWHLIPE--DWCCPDC..AVRDKLDF-----
RUBR2_PSEOL/121-167----------KWICIT..CGHIYDEALG-----DE------AEGFTPGTRFEDIPD--DWCCPDC..GAT.KEDY-----
RUBR_PYRFU/3-49----------KWVCKI..CGYIYDEDAG-----DP------DNGISPGTKFEELPD--DWVCPIC..GAP.KSEF-----
RUBR1_METJA/21-69----------KYKCKV..CGWVYDPLKG-----DP------SQNIPPKTPFEELPD--TWICPVCRGKVG.KESF-----
RUBR_CLOSD/3-49----------KYVCTV..CGYVYDPEVG-----DP------DNNINPGTSFQDIPE--DWVCPLC..GVG.KDQF-----
O26912_METTH/131-159----------YYVCNW..CGNTVEGEAP-----S.------...............--..RCPIC..GAP.KDEF-----
O50375_METTF/1-35----------MYVCRI..CQYQVPDRDF-----..------..........SELGD--GWVCPQC..GVG.RDEF-----
O26259_METTH/3-49----------KYVCQM..CGYIYDPEEG-----DP------VSGIEAGTPFEDLPD--DWVCPVC..GVG.KDQF-----
P94698_DESVU/7-55----------MWRCQTVNCGYVYDPDRG-----DK------RGKVPPGTRFEDLPD--EWRCPIC..KAT.KKCF-----
RUBR_CUPNH/25-71----------RLECKI..CWWEYDPEVG-----DP------VWQIAPGTSFSALPA--HWRCPNC..DGE.AEQF-----
RUBR_MEGEL/3-48----------KYECSI..CGYIYDEAEG-----DD------GN.VAAGTKFADLPA--DWVCPTC..GAD.KDAF-----
RUBR_THETC/3-49----------KWQCTV..CGYIYDPEVG-----DP------TQNIPPGTKFEDLPD--DWVCPDC..GVG.KDQF-----
RUBR_ACIAD/3-49----------KYQCIV..CGWIYDEAEG-----WP------QDGIAPGTKWEDIPD--DWTCPDC..GVS.KVDF-----
RUBR_DESGI/3-49----------IYVCTV..CGYEYDPAKG-----DP------DSGIKPGTKFEDLPD--DWACPVC..GAS.KDAF-----
RUBR_BUTME/3-49----------KYVCDI..CGYVYDPAVG-----DP------DNGVAPGTAFADLPE--DWVCPEC..GVS.KDEF-----
RUBR_PEPAS/3-48----------KFECTL..CGYIYDPALV-----GP------DT.PDQDGAFEDVSE--NWVCPLC..GAG.KEDF-----
HUPJ_RHOCA/25-71----------IMECKI..CWTPYDPASG-----DE------FRQVLPGTPFTALPE--DWHCPNC..DAP.KAQF-----
RUBR_SYNY3/17-63----------NHECRA..CGYVYIPSQG-----DQ------KTSVSPGTPFEALPL--NWKCPVC..GAP.RNYF-----
RUBL_BRAJA/18-64----------RLECGI..CWTVYDPADG-----DD------VAQIAPGTPFAALPE--EWHCPNC..DAP.KSKF-----
P96745_CLOBU/3-49----------KYICTV..CGYIYDEAAG-----DP------DNGVAPGTKFEDIPD--DWVCPLC..GVP.KSDF-----
RUBH_METTH/1-35----------MKICRI..CGYQIPEGEF-----..------..........NLLED--GWVCPRC..GVG.KEEL-----
P95500_9PSED/25-71----------KLECKI..CWWVYDPAVG-----DP------VWQIPPGVPFSALPP--HWRCPNC..DGD.ADQF-----
O27972_ARCFU/140-168----------IYVCPV..CGYAMEGEAP-----E.------...............--..KCPLC..NTP.KEKF-----
O05893_MYCTU/6-52----------LFRCIQ..CGFEYDEALG-----WP------EDGIAAGTRWDDIPD--DWSCPDC..GAA.KSDF-----
RUBR1_PSEOL/3-50----------RYQCPD..CQYIYDENKG-----EP------HEGFHPNTSWNDIPK--DWACPDC..AVRDKVDF-----
RUBR_CHLLT/3-49----------KYVCSV..CGYVYDPADG-----EP------DDPIDPGTGFEDLPE--DWVCPVC..GVD.KDLF-----
RUBR_HELMO/3-49----------KYGCLV..CGYVYDPAKG-----DP------DHGIAPGTAFEDLPA--DWVCPLC..GVS.KDEF-----
RUBR_TREPA/3-49----------TYMCDL..CGWGYNPEVG-----DA------DGGIPAGTAFENLPD--HWECPLC..GVD.KTSF-----
RUBR2_CLOPE/3-49----------KFICDV..CGYIYDPAVG-----DP------DNGVEPGTEFKDIPD--DWVCPLC..GVD.KSQF-----
RUBR_CLOPA/3-49----------KYTCTV..CGYIYNPEDG-----DP------DNGVNPGTDFKDIPD--DWVCPLC..GVG.KDQF-----
RUBR_METTH/13-59----------RYKCRV..CGYIYDPEKG-----EP------RTDTPPGTPFEDLPE--TWRCPSC..GAK.KKMF-----
O05894_MYCTU/3-50----------AYRCPV..CDYVYDEANG-----DA------REGFPAGTGWDQIPD--DWCCPDC..AVREKVDF-----
RUBR1_DESDA/3-42----------KYVCNV..CGYEYDPAEH-----DN------.......VPFDQLPD--DWCCPVC..GVS.KDQF-----
O29906_ARCFU/3-32----------RWRCKL..CGLVFRGDE.-----..------....PPE........--..VCGRC..GAT.KEQF-----
RUBR_DESVM/3-49----------KYVCTV..CGYEYDPAEG-----DP------DNGVKPGTAFEDVPA--DWVCPIC..GAP.KSEF-----
Q46496_DESBR/3-49----------KYVCGV..CVYEYDPAKG-----DP------DNGVAPGTAFEDLPA--DWSCPVC..GAS.KDQF-----
NORV_ECOLI/425-471----------RMQCSV..CQWIYDPAKG-----EP------MQDVAPGTPWSEVPD--NFLCPEC..SLG.KDVF-----
O28920_ARCFU/22-68----------KYECQV..CGYVYDEAEG-----DP------DNDIPAGTKWEDLPD--DWVCPVC..GAS.KDQF-----
RUBR2_METJA/6-51----------RYQC.M..CGWVYDEDKG-----EP------SQNIPPGTKFEDLPD--TFRCPQC..GLG.KNAF-----
RUBR_AZOCH/21-67----------VLECKI..CWHRYDPAVG-----DE------VWQILAGTPFAALPA--HWRCPQC..DGD.REQF-----
RUBL_RHILV/17-63----------RMECGI..CWHVYDPAEG-----DP------VWQIPPGTPFSNLTE--DWRCPNC..DAL.QSKF-----
O26576_METTH/3-40----------DFRCTV..CNYIFHEEAD-----GE------.........FDSLPA--DWRCPVC..NAP.RTAF-----
O29905_ARCFU/114-142----------IYVCPM..CGYIVKDETP-----D.------...............--..VCPLC..NAP.GESF-----

PF06397

DFX_DESDA/2-37-----PKHLEVYKCTH--CGNIVEVLHG-----G--------------------GA--ELVC--C--GEP-MKHM-----
DFX_DESVM/2-37-----PNMLEVYKCVH--CGNIVEVMHA-----G--------------------GG--DLVC--C--GEP-MKFM-----
DESR_DESGI/2-37-----ANEGDVYKCEL--CGQVVKVLEE-----G--------------------GG--TLVC--C--GED-MVKQ-----
DFX_DESB2/2-37-----PERLQVYKCEV--CGNIVEVLNG-----G--------------------IG--ELVC--C--NQD-MKLM-----
Q9FDN8_MOOTH/2-37-----AAITQVYKCNI--CGNIVTILHP-----G--------------------GG--ALVC--C--GKP-MELL-----
DFX_ARCFU/2-37-----TEVMQVYKCMV--CGNIVEVVHA-----G--------------------RG--QLVC--C--GQP-MKLM-----
DFX_METTH/2-37-----TETNQIFRCNV--CGNIVEVLNP-----G--------------------AG--QLVC--C--NQP-MELL-----
Q8TJP6_METAC/4-39-----SRKGEKYRCEI--CGNEVVVTEV-----G--------------------GG--TLVC--C--GED-MTLI-----

PF01215

COX5_DICDI/2-120EVMYY
COX4_YEAST/21-155DDHHH
COX4_SCHPO/29-164AEHSH
COX5B_BOVIN/3-129HQLAH

PF10276

Q4WE81_ASPFU/135-173-----
A1UT54_BARBK/21-59-----
Q2N7B3_ERYLH/42-90-----
Q3IZ23_RHOS4/25-64-----
A5FYN1_ACICJ/27-64-----
NDUS6_CAEEL/85-123-----
A5EM31_BRASB/21-59-----
A0CXJ8_PARTE/60-102-----
A0Q485_FRATN/12-52-----
Q2VNS3_9BACT/126-164-----
Q6BWG5_DEBHA/95-135-----
Q9ABN7_CAUCR/28-66-----
Q4P288_USTMA/166-204-----
Q2GBB3_NOVAD/11-54-----
Q0EVP8_9PROT/8-42-----
Q8J0P6_PARBR/138-176-----
Q0C112_HYPNA/17-55-----
Q9VMU0_DROME/81-119-----
NDUS6_ARATH/66-105-----
Q84SD6_ORYSJ/68-112-----
A6U8I2_SINMW/21-59-----
Q28RR5_JANSC/12-51-----
A0P451_9RHOB/21-59-----
Q5WTA2_LEGPL/20-60-----
Q55GR1_DICDI/53-91-----
Q7PW69_ANOGA/80-119-----
B7L0V2_METC4/21-59-----
A7IKB8_XANP2/21-59-----
A8LJP2_DINSH/12-51-----
Q0FDD3_9RHOB/12-49-----
Q0ATM3_MARMM/17-55-----
A5V7L6_SPHWW/14-58-----
Q57E02_BRUAB/21-59-----
Q0FRJ5_9RHOB/12-51-----
Q01CP7_OSTTA/91-142-----
Q5DC02_SCHJA/72-110-----
Q0G0C3_9RHIZ/21-59-----

PF00301

RUBR2_PSEOL/3-50-----
RUBR2_PSEOL/121-167-----
RUBR_PYRFU/3-49-----
RUBR1_METJA/21-69-----
RUBR_CLOSD/3-49-----
O26912_METTH/131-159-----
O50375_METTF/1-35-----
O26259_METTH/3-49-----
P94698_DESVU/7-55-----
RUBR_CUPNH/25-71-----
RUBR_MEGEL/3-48-----
RUBR_THETC/3-49-----
RUBR_ACIAD/3-49-----
RUBR_DESGI/3-49-----
RUBR_BUTME/3-49-----
RUBR_PEPAS/3-48-----
HUPJ_RHOCA/25-71-----
RUBR_SYNY3/17-63-----
RUBL_BRAJA/18-64-----
P96745_CLOBU/3-49-----
RUBH_METTH/1-35-----
P95500_9PSED/25-71-----
O27972_ARCFU/140-168-----
O05893_MYCTU/6-52-----
RUBR1_PSEOL/3-50-----
RUBR_CHLLT/3-49-----
RUBR_HELMO/3-49-----
RUBR_TREPA/3-49-----
RUBR2_CLOPE/3-49-----
RUBR_CLOPA/3-49-----
RUBR_METTH/13-59-----
O05894_MYCTU/3-50-----
RUBR1_DESDA/3-42-----
O29906_ARCFU/3-32-----
RUBR_DESVM/3-49-----
Q46496_DESBR/3-49-----
NORV_ECOLI/425-471-----
O28920_ARCFU/22-68-----
RUBR2_METJA/6-51-----
RUBR_AZOCH/21-67-----
RUBL_RHILV/17-63-----
O26576_METTH/3-40-----
O29905_ARCFU/114-142-----

PF06397

DFX_DESDA/2-37-----
DFX_DESVM/2-37-----
DESR_DESGI/2-37-----
DFX_DESB2/2-37-----
Q9FDN8_MOOTH/2-37-----
DFX_ARCFU/2-37-----
DFX_METTH/2-37-----
Q8TJP6_METAC/4-39-----

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window