Sequence alignment for CL0053

PF06875

Q9PUJ0_PLEJO/2-215RSTSLLTFLVVSLSTATSLAMAEINDVADLSSDTIVLFSEVQKFAEDIQSSADSLLPTYLSFQGAPL-------------
Q9PUJ2_PLEJO/2-215RSTSLLTFLVVSLSTATSLAMAEINDVADLSSDTIVRFSEVQKFAEDIQSSADSLLPTYLSFQGAPL-------------

PF01110

CNTF_CHICK/1-195------------------MAAAD.TPSATLRHHDLC--SRGIRLARKMRSDVTDLLDIYVERQGL---------------
CNTF_HUMAN/1-199------------------MAFTEHSPLTPHRR.DLC--SRSIWLARKIRSDLTALTESYVKHQGL---------------

PF01291

LIF_MOUSE/44-203---------------------------------NLM--NQIKNQLAQLNGSANALFISYYTAQGEPF-------------
LIF_BOVIN/43-202---------------------------------NLM--NQIRNQLGQLNSSANSLFILYYTAQGEPF-------------
ONCM_HUMAN/37-209---------------------------------VLL--GQLQKQTDLMQDTS.RLLDPYIRIQGLDV-------------
ONCM_MOUSE/34-194---------------------------------QLL--SQLQNQANLTGNTE.SLLEPYIRLQNLNT-------------
ONCM_BOVIN/34-194---------------------------------ELL--LQLQRQADLMQDPS.TLLDPYIHLQGLHS-------------

PF03039

IL12A_MOUSE/1-215MCQ.SRYLLFLATLALLN...HLSLARVIPVS..GP...ARCLSQSRNLLKTTDDMVKTAREKLKHYSCTAEDIDHEDIT
IL12A_PIG/1-222MCP.LRNLLLVATLVLLNHLDHLSLGRSLPATTAGPGM.FKCLNHSQNLLKAVSNTLQKAKQTLEFYSCTSEEIDHEDIT
IL12A_MARMO/1-223MCPSARSLLLLASLVLLE...HLGSARNLPRSTPVPAVSQECHNLSQTLLSTVDSALQNAIEILEYYPCSAEEVNHEDIT

PF00489

IL6_PIG/57-210----IKYILG----------------------------------------------------------------KISAMR
CSF3_BOVIN/42-190----VRKIQA----------------------------------------------------------------DGAELQ
IL6_FELCA/53-206----IKYILG----------------------------------------------------------------KISALK
CSF3_MOUSE/57-205----VRKIQA----------------------------------------------------------------SGSVLL
IL6_CANFA/52-205----IKYILG----------------------------------------------------------------KISALR
IL6_CERAT/57-210----IRYILD----------------------------------------------------------------GISALR
CSF3_HUMAN/51-202----VRKIQG----------------------------------------------------------------DGAALQ
IL6_BOVIN/57-206----IKRMVD----------------------------------------------------------------KISAMR
IL6_MOUSE/55-209----ITHVLW----------------------------------------------------------------EIVEMR
MGF_CHICK/46-196----TRKIRG----------------------------------------------------------------DVAALQ

PF07400

IL11_MACFA/1-199MNCVCRLVLV--------------VLSLWPDTAVAPGPPPGSPRASPDPRAELDSTVLLTR-------------SLLEDT
IL11_HUMAN/1-199MNCVCRLVLV--------------VLSLWPDTAVAPGPPPGPPRVSPDPRAELDSTVLLTR-------------SLLADT
IL11_MOUSE/1-199MNCVCRLVLV--------------VLSLWPDRVVAPGPPAGSPRVSSDPRADLDSAVLLTR-------------SLLADT

PF02024

LEP_MACMU/22-167--VPIQKVQS----------------------------------------------------------------DTKTLI
LEP_PIG/22-167--VPIWRVQD----------------------------------------------------------------DTKTLI
LEP_BOVIN/22-167--VPIRKVQD----------------------------------------------------------------DTKTLI
LEP_MOUSE/22-167--VPIQKVQD----------------------------------------------------------------DTKTLI
LEP_HUMAN/22-167--VPIQKVQD----------------------------------------------------------------DTKTLI
LEP_MELGA/1-145--VPCQIFQD----------------------------------------------------------------DTKTLI
LEP_CANFA/22-167--VPIRKVQD----------------------------------------------------------------DTKTLI

PF02947

FLT3L_MOUSE/28-162----TPDCYF----------------------------------------------------------------SHSPIS
FLT3L_HUMAN/27-159----TQDCSF----------------------------------------------------------------QHSPIS
Q61104_MOUSE/28-162----TPDCYF----------------------------------------------------------------SHSPIS

PF00103

PLRP1_BOVIN/26-238LLMSNLLLCQ.....GKSCPSCGPDVFVSLRKSFTDRFMNAASLSHDFYNLSTIMFNEFDEKYAQGKL......YYINVT
CSH2_BOVIN/26-238LVVSNLLLCQ.....GISCPSCGPDMFVSLQKSLIDVFINAASLSHDFHNLSTIMFNEFDEKYAQGKL......YYINAT
PLRP3_BOVIN/1-213MVMSNLLLCQ.....VNSCPSCCPDVFDIPLESLTHLFLNASRLSHDIVNHTTIMFHEFDEKYAQNQP......YTINAT
SOML_CYCLU/21-228LASSVPLDCREEQGILSRCPSIS..........QEKLLDRVIEHAELIYRVSEESCSLYEDMFIPLQFQ......RNQVG
PR4A1_RAT/17-227LLVSNLLLWEN....TASAMRAKLL.NVHNYTSYGDTWNQAIKISQDMNQYISDLSTHVKIFYAQGRG.......FERRT
CSH_HUMAN/9-215LLLAFALLCLPWLQEAGAVQTVP..........LSRLFDHAMLQAHRAHQLAIDTYQEFEETYIPKDQK....YSFLHDS
CSH1_BOVIN/26-236LVVSNLLLCQGVEDYAPYCKNQPGN....CRIPLQSLFERATLVASNNYRLAREMFNEFNKQFGEGKN.......FTSKV
SOMA_ACABU/4-202VVLMLSVLSLG....VSSQPITD..........GQRLFSIAVSRVQHLHLLAQRLFSDFESSLQTEEQR.....QLNKIF
PLRP4_BOVIN/26-239LVMSNLLLCQ.....GILCPSLCPDGDDVCRASLIDLFVHASVLSTGMYNTSVKMFTDFDEQYAQGKE......YFINVS
PR3D4_RAT/16-223LLVSNLLLWEN....MASKPTVLVS........TEDLYHRLVEQSHNTFIKAADVYREFDINFAKRSW......MKDRIL
PR2C2_MOUSE/16-224LLVNSSLLWKN....VASFPMCAMR.NGRCFMSFEDTFELAGSLSHNISIEVSELFTEFEKHYSNVSG......LRDKSP
SOM2_HUMAN/9-215LLLAFGLLCLSWLQEGSAFPTIP..........LSRLFDNAMLRARRLYQLAYDTYQEFEEAYILKEQK....YSFLQNP
PR8A5_RAT/17-238LVVSNLLLWEK....AASIPACMVE.DGGCWDPLREAFNSATQRAETLRNLSDQLYVEFFQNQFSSRQFADLSSQLIRKD
PR6A1_RAT/20-234LLMSNILLWEN....VASVPRHASGAGRG.EMSLHGLLDHAIILAHNVTELIAEMNSVFLEDVLYKPGR.....WFPERD
PRL_ANGAN/9-209SLFLTALLCL.....ASQGYAVG..........LGDMLERASQLSDKLHSLSTSLTNDLDTHFPPMGK......ILMPRP
PR7D1_MOUSE/17-240LLMSNLFLWEK....VSSAPINAS...EAVLSDLKDLFDNATVLSGEMSKLGVIMRKEFFMNSFSSETFNKIILDLHKST
PRL1_ONCTS/8-211TKLHLAVLCL.....VVSCHAIG..........LSDLMERASQRSDKLHSLSTSLTKDLDSHFPPMGR......VMMPRP

PF00143

IFNA1_CHICK/35-193LRPQDATFSHD-----------------------------SLQLLRDMAPTLPQLCPQ----------------------
IFNB1_BOVIN/27-186LRFQQRQSLKE-----------------------------CQKLLGQLPSTSQH.CLE----------------------
IFNB_HORSE/27-186LRSQLRSSNSA-----------------------------CLMLLRQLNGAPQR.CPE----------------------
IFNB_HUMAN/27-187LGFLQRSSNFQ-----------------------------CQKLLWQLNGRLEY.CLK----------------------
IFNB_MOUSE/27-182LQLQERTNIRK-----------------------------CQELLEQLNGKIN...LT----------------------
IFNW2_HORSE/26-187LPQNHILVSRK-----------------------------NFVLLGQMSRISSAICLK----------------------
IFNW1_HORSE/26-187LPASLDLRKQE-----------------------------TLRVLHQMETISPPSCLK----------------------
IFNW1_HUMAN/26-187LPQNHGLLSRN-----------------------------TLVLLHQMRRISPFLCLK----------------------
IFNT1_BOVIN/26-187LSEDHMLGARE-----------------------------NLRLLARMNRLSPHPCLQ----------------------
IFNA1_MOUSE/26-187LPQTHNLRNKR-----------------------------ALTLLVQMRRLSPLSCLK----------------------
IFNA4_MOUSE/27-183LPHTYNLGNKR-----------------------------ALTVLEEMRRLPPLSCLK----------------------
IFNA1_BOVIN/26-187LPHSHSLAKRR-----------------------------VLTLLRQLRRVSPSSCLQ----------------------
IFNA4_HUMAN/26-187LPQTHSLGNRR-----------------------------ALILLAQMGRISHFSCLK----------------------
IFNA1_HUMAN/26-187LPETHSLDNRR-----------------------------TLMLLAQMSRISPSSCLM----------------------
IFNA_FELCA/26-192LPQTHGLLNRR-----------------------------ALTLLGQMRRLPASSCQK----------------------

PF00714

IFNG_FELCA/15-153ILCSSGYYCQA---------------------------------------------------------------------
IFNG_BOVIN/15-152LLGFSGSYGQG---------------------------------------------------------------------
IFNG_MOUSE/14-150LMAVSGCYCHG---------------------------------------------------------------------
IFNG_RABIT/15-152ILGSYGCYCQD---------------------------------------------------------------------
IFNG_CERAT/15-152VLGSLGCYCQD---------------------------------------------------------------------
IFNG_RAT/14-151LMALSGCYCQG---------------------------------------------------------------------
IFNG_HORSE/15-152ILGSSTYYCQA---------------------------------------------------------------------
IFNG_PIG/15-152TLCFSGSYCQA---------------------------------------------------------------------
IFNG_CALJA/15-152VLGSLGCYCQD---------------------------------------------------------------------

PF00727

IL4_PIG/25-131--------------------------------------------------------------------------------
IL4_MOUSE/25-140--------------------------------------------------------------------------------
IL4_FELCA/25-131--------------------------------------------------------------------------------
A7LBR6_BISBO/25-133--------------------------------------------------------------------------------
IL4_CERAT/25-149--------------------------------------------------------------------------------
IL4_RAT/25-140--------------------------------------------------------------------------------
IL4_MERUN/25-141--------------------------------------------------------------------------------
IL4_HORSE/24-131--------------------------------------------------------------------------------

PF03487

IL13_HUMAN/15-57--------------------------------------------------------------------------------
IL13_BOVIN/1-43--------------------------------------------------------------------------------
IL13_MOUSE/1-47--------------------------------------------------------------------------------
IL13_CANFA/1-43--------------------------------------------------------------------------------

PF01109

CSF2_RAT/18-139------------------------------------------------------APTRSPNPV-----------------
CSF2_MOUSE/18-136------------------------------------------------------APTRSPITV-----------------
CSF2_BOVIN/18-138------------------------------------------------------APTRPPNTA-----------------
CSF2_CAVPO/18-140------------------------------------------------------APTDLLSPV-----------------
CSF2_PIG/18-139------------------------------------------------------APTRPPSPV-----------------
CSF2_HUMAN/18-139------------------------------------------------------APARSPSPS-----------------
CSF2_CANFA/18-139------------------------------------------------------APTRSPTLV-----------------

PF02025

IL5_CAVPO/22-134--------------------------------------------------------------------------------
IL5_HUMAN/21-133--------------------------------------------------------------------------------
IL5_HORSE/21-133--------------------------------------------------------------------------------
IL5_SHEEP/19-131--------------------------------------------------------------------------------
IL5_MERUN/19-131--------------------------------------------------------------------------------
IL5_FELCA/21-133--------------------------------------------------------------------------------

PF02404

SCF_PIG/1-274MKKTQTWIITCIYLQLLLFNPLVRTQGICRNRVTDDVKDVTKLVANLPKDYKITLKYVPGMDV-----------------
SCF_RAT/1-273MKKTQTWIITCIYLQLLLFNPLVKTQEICRNPVTDNVKDITKLVANLPNDYMITLNYVAGMDV-----------------
SCF_COTJA/1-287MKKAQTWIITCFCLQLLLLNPLVKTQSSCGNPVTDDVNDIAKLVGNLPNDYLITLKYVPKMDS-----------------
SCF_CHICK/1-287MKKAQTWIITCFCLQLLLLNPLVKAQSSCGNPVTDDVNDIAKLVGNLPNDYLITLKYVPKMDS-----------------

PF02059

IL3_MOUSE/27-138------------------------------------------------------ASISGRDTH-----------------
IL3_SAGOE/19-136------------------------------------------------------AAPTQTTSL-----------------
P97688_RAT/27-141------------------------------------------------------ISDRGSDAH-----------------
IL3_PANTR/20-137------------------------------------------------------APMTQTTSL-----------------
IL3_BOVIN/18-132------------------------------------------------------APQAKGLPV-----------------

PF00715

IL2_MERUN/7-151-------------------------------------------ASCVALALVLLANSAPTSS.....-------------
IL2_PIG/7-151-------------------------------------------LCCIALTLALMANGAPTSSS....-------------
IL2_FELCA/7-151-------------------------------------------LSCIALTLILVTNSAPASSS....-------------
IL2_CERAT/7-151-------------------------------------------LSCIALSLALVTNSAPTSRS....-------------
IL2_BOVIN/7-152-------------------------------------------LSCIALTLALVANGAPTSSS....-------------
IL2_MOUSE/7-165-------------------------------------------ASCVTLTLVLLVNSAPTSSSTSSS-------------
IL2_HORSE/7-146-------------------------------------------LSCIALTLAVLANSAPTSSS....-------------

PF00758

EPO_BOVIN/28-192------------------------------------------------------ARLICDSRVLERY-------------
TPO_CANFA/24-188------------------------------------------------------APPACDPRLLNKM-------------
EPO_RABIT/31-195------------------------------------------------------ARLICDSRVLERY-------------
TPO_MOUSE/24-188------------------------------------------------------VAPACDPRLLNKL-------------
EPO_MOUSE/29-192------------------------------------------------------PRLICDSRVLERY-------------
EPO_MACFA/30-192------------------------------------------------------PRLICDSRVLERY-------------

PF00726

IL10_BOVIN/5-174--------------------------ALLCCLVFLAGVAASRDASTLSDSSCIHLPTSLPHMLRELR-------------
IL10H_EBVB9/7-167--------------------------VTLQCLVLL.........YLAPECGGTDQCDNFPQMLRDLR-------------
IL10_MERUN/5-174--------------------------ALLYCLILLAGVRPSRGEYPRNESNCTHFPVSQTHMLRELR-------------

PF14565

Q6NZ84_HUMAN/40-178---------------------------------------------------CRLDKSNFQQPYITNR-------------
IL22_HUMAN/40-178---------------------------------------------------CRLDKSNFQQPYITNR-------------
Q6NWP4_HUMAN/40-178---------------------------------------------------CRLDKSNFQQPYITNR-------------
Q6NZ83_HUMAN/40-178---------------------------------------------------CRLDKSNLQQPYITNR-------------
E1C1U2_CHICK/46-184---------------------------------------------------CRLRKINFQQPYIRNR-------------

PF15036

B3DLJ8_DANRE/18-196--------------------------LLPVC-------------SSAAPDLCGPLKTVQDSLNATLR-------------
IL34_BOVIN/23-184--------------------------GLEPW-------------PLTRSDECAITGFLRDKLQYRNR-------------
F1S3F1_PIG/19-182--------------------------GLEVW-------------PVTSSEECAITGFLRDKLQYRNR-------------
IL34_RAT/23-184--------------------------NLEIW-------------TLAQDKECDLTGYLRGKLQYKNR-------------
D8UWE2_TAEGU/16-180--------------------------GLE..-------------.AAAPGECELTRLLQDKLQYEMR-------------

PF06875

Q9PUJ0_PLEJO/2-215-----SDPDYQLPHIKVVNLPTAAMDYDTFIRQTDETRLKNNLYFYSAIVEFL------------KEAMTEQE-D-LNPA
Q9PUJ2_PLEJO/2-215-----SDPDYQLPHIKVANLPTAAMDYDTFMKQTDETRLNNNLYFYSAIVEFL------------KEAMTEQE-D-LNPA

PF01110

CNTF_CHICK/1-195--------DASISVAAVDGVPTAAV--ERWAEQTGTQRLLDNLAAYRAFRTLL------------AQMLEEQR-ELLGDT
CNTF_HUMAN/1-199--------NKNINLDSADGMPVAST--DQWSELTEAERLQENLQAYRTFHVLL------------ARLLEDQQ-VHFTPT

PF01291

LIF_MOUSE/44-203-----PNNVEKLCAPNMTDFPSFHG------NGTEKTKLVELYRMVAYLSASL------------TNITRDQK-V-LNPT
LIF_BOVIN/43-202-----PNNLDKLCSPNVTDFPPFHA------NGTEKARLVELYRIIAYLGASL------------GNITRDQK-V-LNPY
ONCM_HUMAN/37-209-----P.KLREHCRERPGAFP.SEE------TLRGLGRRGFLQTLNATLGCVL------------HRLADLEQ-R-LPKA
ONCM_MOUSE/34-194-----P.DLRAACTQHSVAFP.SED------TLRQLSKPHFLSTVYTTLDRVL------------YQLDALRQ-K-FLKT
ONCM_BOVIN/34-194-----P.VLQEHCRERPGDFP.SED------ALWRLSRQDFLQTLNTTLGLIL------------RMLSALQQ-D-LPEA

PF03039

IL12A_MOUSE/1-215RD---QTSTLKTCLPLELHKNESCLATRETSSTTRGSCLPPQKTSLMMTLCLGSI----------YEDLKMYQ-TEFQAI
IL12A_PIG/1-222KD---KTSTVEACLPLELATNESCLAARETSLITNGNCLTSGKTSFMTTLCLSSI----------YEDLKMYH-VEFQAM
IL12A_MARMO/1-223KN---RTNTVKACLPQELAQNENCLASRETSFIIKRSSLTSGRTSWNTTLCFSSI----------YEDLKMYQ-LELKAI

PF00489

IL6_PIG/57-210KE...MCEKYEKCENSKEVLAENNLNLPKMA--EKDGCFQSG---FNQETCLMRI----------TTGLVEFQ-IYLDYL
CSF3_BOVIN/42-190ER...LCAAHKLCHPEELMLLRHSLGIPQA.--PLSSCSSQS---LQLTSCLNQL----------HGGLFLYQ-GLLQAL
IL6_FELCA/53-206KE...MCDNYNKCEDSKEALAENNLNLPKLA--EKDGCFQSG---FNQETCLTRI----------TTGLQEFQ-IYLKFL
CSF3_MOUSE/57-205EQ...LCATYKLCHPEELVLLGHSLGIPKA.--SLSGCSSQA---LQQTQCLSQL----------HSGLCLYQ-GLLQAL
IL6_CANFA/52-205KE...MCDKFNKCEDSKEALAENNLHLPKLE--GKDGCFQSG---FNQETCLTRI----------TTGLVEFQ-LHLNIL
IL6_CERAT/57-210KE...TCNRSNMCDSTKEALAENNLNLPKMA--EKDGCFQSG---FNEDTCLVKI----------ITGLLEFE-VYLEYL
CSF3_HUMAN/51-202EKLVSECATYKLCHPEELVLLGHSLGIPWA.--PLSSCPSQA---LQLAGCLSQL----------HSGLFLYQ-GLLQAL
IL6_BOVIN/57-206KE...ICEKNDECESSKETLAENKLNLPKME--EKDGCFQSG---FNQAICLIRT----------TAGLLEYQ-IYLDYL
IL6_MOUSE/55-209KE...LCNGNSDCMNNDDALAENNLKLPEIQ--RNDGCYQTG---YNQEICLLKI----------SSGLLEYH-SYLEYM
MGF_CHICK/46-196RA...VCDTFQLCTEEELQLVQPDPHLVQA.--PLDQCHKRG---FQAEVCFTQI----------RAGLHAYH-DSLGAV

PF07400

IL11_MACFA/1-199RQ---LTIQLKDKFPADGDHNLDSLPTLAMSAGALGA--------LQLPSVLTRL----------RADLLSYL-RHVQWL
IL11_HUMAN/1-199RQ---LAAQLRDKFPADGDHNLDSLPTLAMSAGALGA--------LQLPGVLTRL----------RADLLSYL-RHVQWL
IL11_MOUSE/1-199RQ---LAAQMRDKFPADGDHSLDSLPTLAMSAGTLGS--------LQLPGVLTRL----------RVDLMSYL-RHVQWL

PF02024

LEP_MACMU/22-167KT---IVTRINDISHTQSVSSKQRVTGLD---------FIPG---LHPVLTLSQM----------DQTLAIYQ-QILINL
LEP_PIG/22-167KT---IVTRISDISHMQSVSSKQRVTGLD---------FIPG---LHPVLSLSKM----------DQTLAIYQ-QILTSL
LEP_BOVIN/22-167KT---IVTRINDISHTQSVSSKQRVTGLD---------FIPG---LHPLLSLSKM----------DQTLAIYQ-QILTSL
LEP_MOUSE/22-167KT---IVTRINDISHTQSVSAKQRVTGLD---------FIPG---LHPILSLSKM----------DQTLAVYQ-QVLTSL
LEP_HUMAN/22-167KT---IVTRINDISHTQSVSSKQKVTGLD---------FIPG---LHPILTLSKM----------DQTLAVYQ-QILTSM
LEP_MELGA/1-145KT---IVTRINDISHTS.VSAKQSVTGLD---------FIPG---LHPILSLSKM----------DQTLAVYQ-QVLTSL
LEP_CANFA/22-167KT---IVARINDISHTQSVSSKQRVAGLD---------FIPG---LQPVLSLSRM----------DQTLAIYQ-QILNSL

PF02947

FLT3L_MOUSE/28-162SN---FKVKFRELTD---HLLKDYPVTVAVN--------------LQDEKHCKAL----------WS-LFLAQ-RWIEQL
FLT3L_HUMAN/27-159SD---FAVKIRELSD---YLLQDYPVTVASN--------------LQDEELCGGL----------WR-LVLAQ-RWMERL
Q61104_MOUSE/28-162SN---FKVKFRELTD---HLLKDYPVTVAVN--------------LQDEKHCKAL----------WS-LFLAQ-RWIEQL

PF00103

PLRP1_BOVIN/26-238..---.....KSCHTNSFHAPEERDIVQQTNIEDLSKWTLVLLYSWNNPLHHLVTELQHMKEL..SNAFLSSA-TRFENM
CSH2_BOVIN/26-238..---.....KSCHTNSFHTPEERDKAQQMNNEDLSKWTLVLLYSWNNPLYYLLLELRNMKNL..SEAVISSA-MEIENM
PLRP3_BOVIN/1-213..---.....KSCHTNSLHTPQEREKALRMNNEDLSKWILMLLYSWHRPLYLLVKDLQSMKEV..SDTILSSA-KENMRK
SOML_CYCLU/21-228..---.....YACITKTLPVPSSKNEIQQISDKWLLHSVLMLVQSWIEPLVYLQTSLDRYNAA..PEMLLNKT-KWVSEK
PR4A1_RAT/17-227..---.....TRCHTSSLSSPENKEQAQQFQLEVLLGLSHSLLQAWLNPLHHLWAEMCDRLGS..TPPTLYKA-LMLKES
CSH_HUMAN/9-215Q.---....TSFCFSDSIPTPSNMEETQQKSNLELLRISLLLIESWLEPVRFLR....SMFAN..NLVYDTSD-SDDYHL
CSH1_BOVIN/26-236..---....INSCHTEFMTTPNNKEAAANTEDEALLRLVISLLHSWDEPLHQAVTELLHRNGA..SPDILARA-KEIEDK
SOMA_ACABU/4-202L.---....QDFCNSDYIISPIDKHETQRSSVLKLLSISYRLVESWEFPSRSLAGG..SAPRN....QISPKL-SELKTG
PLRP4_BOVIN/26-239..---.....DKCHTNSLHLPEDMQHNPTDEQKGLIMWILMLLYSWQRPLYQLVTDLRSMKEV..SNTILSSA-RENVKK
PR3D4_RAT/16-223..---.....PLCHTASIHVPENREEVHEIKTEDLLRSIINISVSWKEPLKHFVSAVTDLPGA..SASMRKKA-VDMKDK
PR2C2_MOUSE/16-224..---.....MRCNTSFLPTPENKEQARLTHYSALLKSGAMILDAWESPLDDLVSELSTIKNV..PDIIISKA-TDIKKK
SOM2_HUMAN/9-215Q.---....TSLCFSESIPTPSNRVKTQQKSNLELLRISLLLIQSWLEPVQLLR....SVFAN..SLVYGASD-SNVYRH
PR8A5_RAT/17-238ET---VLKAGTYCHSNRAK.PKSR..GVNIDIEEYLKMSINFCGFMDQPLFHLVIELSAMEGV..PETILSKA-KDLEEN
PR6A1_RAT/20-234..---....LTACHRSPFTIAVSKEGTQQRLGVFLVKEMIGMLETWTFSLYHIANEMSHMEEP..PDEIISRA-KNIEEK
PRL_ANGAN/9-209..---.....SMCHTASLQTPHDKDQALRVPESELLSIARALLLSWNDPLLLLASEAPTLSHP.QNGAIYSKT-RELQDQ
PR7D1_MOUSE/17-240EN---ITKAFNSCHTVPINVPETVEDVRKTSFEEFLKMVLHMLLAWKEPLKHLVTELSALPEC..PYRILSKA-EAIEAK
PRL1_ONCTS/8-211..---.....SMCHTSSLQTPKDKEQALKVSENELISLARYLLLAWNDPLLLLSSEAPTLPHTPSNGDISSKI-RELQDY

PF00143

IFNA1_CHICK/35-193-------------HNASCSFNDTILDTSNTR..QADKTTHDILQHLFKIL---------------SSPSTP.A-HWNDSQ
IFNB1_BOVIN/27-186-------------ARMDFQMPEEMKQEQQFQKEDAILVMYEVLQHIFGIL---------------TRDFSS.T-GWSETI
IFNB_HORSE/27-186-------------DTMNFQVPEEIEQAQQFQKEDAALVIYEMLQHTWRIF---------------RRNFAS.T-GWNETI
IFNB_HUMAN/27-187-------------DRMNFDIPEEIKQLQQFQKEDAALTIYEMLQNIFAIF---------------RQDSSS.T-GWNETI
IFNB_MOUSE/27-182-------------YRADFKIPMEMT..EKMQKSYTAFAIQEMLQNVFLVF---------------RNNFSS.T-GWNETI
IFNW2_HORSE/26-187-------------DRKDFRFPQDMADGRQFPEAQAASVLHEMLQQIFSLF---------------HTERSS.A-AWNTTL
IFNW1_HORSE/26-187-------------HRTDFRFPQEQLDGRQFPEAQATSVLQEMLQQIVSLF---------------HTERSS.A-AWNTTL
IFNW1_HUMAN/26-187-------------DRRDFRFPQEMVKGSQLQKAHVMSVLHEMLQQIFSLF---------------HTERSS.A-AWNMTL
IFNT1_BOVIN/26-187-------------DRKDFGLPQEMVEGNQLQKDQAISVLHEMLQQCFNLF---------------YTEHSS.A-AWNTTL
IFNA1_MOUSE/26-187-------------DRKDFGFPQEKVDAQQIKKAQAIPVLSELTQQILNIF---------------TSKDSS.A-AWNTTL
IFNA4_MOUSE/27-183-------------DRKDFGFPLEKVDNQQIQKAQAILVLRDLTQQILNLF---------------TSKDLS.A-TWNATL
IFNA1_BOVIN/26-187-------------DRNDFAFPQEALGGSQLQKAQAISVLHEVTQHTFQLF---------------STEGSA.A-VWDESL
IFNA4_HUMAN/26-187-------------DRHDFGFPEEEFDGHQFQKAQAISVLHEMIQQTFNLF---------------STEDSS.A-AWEQSL
IFNA1_HUMAN/26-187-------------DRHDFGFPQEEFDGNQFQKAPAISVLHELIQQIFNLF---------------TTKDSS.A-AWDEDL
IFNA_FELCA/26-192-------------DRNDFAFPQDVFGGDQSHKAQALSVVHVTNQKIFHFF---------------CTEASSSA-AWNTTL

PF00714

IFNG_FELCA/15-153------------MFFKEIEELKGYFNASNPDVADGGSLFVDILKNWKE-----------------ESDKTIIQ-SQIVSF
IFNG_BOVIN/15-152------------QFFREIENLKEYFNASSPDVAKGGPLFSEILKNWKD-----------------ESDKKIIQ-SQIVSF
IFNG_MOUSE/14-150------------TVIESLESLNNYFNSSGIDVEE.KSLFLDIWRNWQK-----------------DGDMKILQ-SQIISF
IFNG_RABIT/15-152------------TLTRETEHLKAYLKANTSDVANGGPLFLNILRNWKE-----------------ESDNKIIQ-SQIVSF
IFNG_CERAT/15-152------------PYVKEAENLKKYFNAGDPDVADNGTLFLDILRNWKE-----------------ESDRKIMQ-SQIVSF
IFNG_RAT/14-151------------TLIESLESLKNYFNSSSMDAMEGKSLLLDIWRNWQK-----------------DGNTKILE-SQIISF
IFNG_HORSE/15-152------------AFFKEIENLKEYFNASNPDVGDGGPLFLDILKNWKE-----------------DSDKKIIQ-SQIVSF
IFNG_PIG/15-152------------PFFKEITILKDYFNASTSDVPNGGPLFLEILKNWKE-----------------ESDKKIIQ-SQIVSF
IFNG_CALJA/15-152------------PYVKEAENLKKYFNAGDSDVADNGTLFLDILRTWRE-----------------EGDRKIMQ-SQIISF

PF00727

IL4_PIG/25-131------------------------HK-CDITLQEIIKTLNILTAR.KNSCME---LPV-------TDVFAAPE-NTTEKE
IL4_MOUSE/25-140------------------------CD-.KNHLREIIGILNEVTGE.GTPCTE---MDV-------PNVLTATK-NTTESE
IL4_FELCA/25-131------------------------QN-FNNTLKEIIKTLNILTAR.NDSCME---LTV-------MDVLAAPK-NTSDKE
A7LBR6_BISBO/25-133------------------------HK-CDITLAEIIKTLNILTTR.KNSCME---LPV-------ADVFAAPK-NTTEKE
IL4_CERAT/25-149------------------------HN-CHIALREIIETLNSLTEQ.KTLCTK---LTI-------TDILAASK-NTTEKE
IL4_RAT/25-140------------------------CN-.DSPLREIINTLNQVTEK.GTPCTE---MFV-------PDVLTATR-NTTENE
IL4_MERUN/25-141------------------------QD-REAGLREIIHNLDQVLKK.ETPCTE---MFV-------PDVLIATK-NTTEKG
IL4_HORSE/24-131------------------------CK-YDITLQEIIKTLNLTDGKGKNSCME---LTV-------ADAFG.PK-NTDGKE

PF03487

IL13_HUMAN/15-57--------------------------------------------------MA---LLL-------TTVIA----------
IL13_BOVIN/1-43--------------------------------------------------MA---LLL-------TAVIV----------
IL13_MOUSE/1-47--------------------------------------------------MA---LWV-------TAVLA----------
IL13_CANFA/1-43--------------------------------------------------MA---LWL-------TVVIA----------

PF01109

CSF2_RAT/18-139--------------------TRPWKH-VDA.IKEALSLLNDM----RALENE---KNE-------.DVDIISN-EFSIQR
CSF2_MOUSE/18-136--------------------TRPWKH-VEA.IKEALNLLD..----.DMPVT---LN.-------EEVEVVSN-EFSFKK
CSF2_BOVIN/18-138--------------------TRPWQH-VDA.IKEALSLLNHS----SDTDAV---MN.-------.DTEVVSE-KFDSQE
CSF2_CAVPO/18-140--------------------TQSWKH-VDATINEALSLLNHT----SDPAAV---MNE-------.TVEVVYD-QFEPQE
CSF2_PIG/18-139--------------------TRPWQH-VDA.IKEALSLLNNS----NDTAAV---MNE-------.TVDVVCE-MFDPQE
CSF2_HUMAN/18-139--------------------TQPWEH-VNA.IQEARRLLNLS----RDTAAE---MNE-------.TVEVISE-MFDLQE
CSF2_CANFA/18-139--------------------TRPSQH-VDA.IQEALSLLNNS----NDVTAV---MNK-------.AVKVVSE-VFDPEG

PF02025

IL5_CAVPO/22-134---------------------KQSAT-LRALVRETLTLL-------STHRTL---LKG-------NETLRISV-PAHKNH
IL5_HUMAN/21-133---------------------PTEIP-TSALVKETLALL-------STHRTL---LIA-------NETLRIPV-PVHKNH
IL5_HORSE/21-133---------------------AVESP-MNRLVAETLTLL-------STHRTL---LIG-------DGNLMIPT-PEHKNH
IL5_SHEEP/19-131---------------------AVEST-MNRLVAETLTLL-------STHQTL---LIG-------DGNLMIPT-PQHTNH
IL5_MERUN/19-131---------------------ALEIP-MSAVVKETLIQL-------STHRAL---LTS-------NETVRLPV-PTHKNH
IL5_FELCA/21-133---------------------AVQSP-MNRLVAETLALL-------STHRTL---LIG-------DGNLMIPT-PEHNNH

PF02404

SCF_PIG/1-274--------------------LPSHCW-ISEMVEQLSVSLTDLLDKFSNISEG...LSN-------YSIIDKLV-KIVDDL
SCF_RAT/1-273--------------------LPSHCW-LRDMVTHLSVSLTTLLDKFSNISEG...LSN-------YSIIDKLG-KIVDDL
SCF_COTJA/1-287--------------------LPNHCW-LHLMVPEFSRSLHNLLQKFVDISDMSDVLSN-------YSIINNLT-RIINDL
SCF_CHICK/1-287--------------------LPNHCW-LHLMVPEFSRSLHNLLQKFSDISDMSDVLSN-------YSIINNLT-RIINDL

PF02059

IL3_MOUSE/27-138--------------------RLTRTLNCSSIVKEIIGKL-------P.....---..E-------PELKTDDE-GPSLRN
IL3_SAGOE/19-136--------------------KATQVN.CSNLREEIVTLL-------NQPPLP---SSN-------FNNLNRED-QRILMK
P97688_RAT/27-141--------------------HLLRTLDCRTIALEILVKL-------PY....---PQV-------SGLNNSDD-KANLRN
IL3_PANTR/20-137--------------------KTSWVN.CSNMIDEIITHL-------KQPPLP---LLD-------FNNLNGED-QDILME
IL3_BOVIN/18-132--------------------VTSRTP.YSMLMKEIMDDL-------K..KIT---PSP-------EGSLNSDE-KNFLTK

PF00715

IL2_MERUN/7-151----------.........PAKEAQQYLEQLLLDLQQLLRGINNYKNPKLPM---LLT-------FKFYMPRK.ATELKH
IL2_PIG/7-151----------..........TKNTKKQLEPLLLDLQLLLKEVKNYENADLSR---MLT-------FKFYMPKQ.ATELKH
IL2_FELCA/7-151----------..........TKETQQQLEQLLLDLRLLLNGVNNPENPKLSR---MLT-------FKFYVPKK.ATELTH
IL2_CERAT/7-151----------..........TKKTQLQLEHLLLDLQMILNGINNYKNPKLTR---MLT-------FKFYMPKK.ATELKH
IL2_BOVIN/7-152----------..........TGNTMKEVKSLLLDLQLLLEKVKNPENLKLSR---MHT-------FDFYVPKVNATELKH
IL2_MOUSE/7-165----------TAEAQQQQQQQQQQQQHLEQLLMDLQELLSRMENYRNLKLPR---MLT-------FKFYLPKQ.ATELKD
IL2_HORSE/7-146----------..........KRETQQQLKQLQMDLKLLLEGVNNNKNPKLSK---ILT-------FKINMPKK.ATELKH

PF00758

EPO_BOVIN/28-192----------ILEAREAENATMGCAEGCSFNENITVPDTKVNFYAWKRMEVQQQALEV-------WQGLALLS-EAILRG
TPO_CANFA/24-188----------LRDSHVLHSRLSQCPDIYPLSTPVLLPAVDFSLGEWKTQKEQTKAQDV-------WGAVALLL-DGVLAA
EPO_RABIT/31-195----------ILEAKEAENVTMGCAEGCSLGENITVPDTKVNFHHWKKSEAGRHAVEV-------WQGLALLS-EAMLRS
TPO_MOUSE/24-188----------LRDSHLLHSRLSQCPDVDPLSIPVLLPAVDFSLGEWKTQTEQSKAQDI-------LGAVSLLL-EGVMAA
EPO_MOUSE/29-192----------ILEAKEAENVTMGCAEGPRLSENITVPDTKVNFYAWKRMEVEEQAIEV-------WQGLSLLS-EAILQA
EPO_MACFA/30-192----------LLEAKEAENVTMGCSESCSLNENITVPDTKVNFYAWKRMEVGQQAVEV-------WQGLALLS-EAVLRG

PF00726

IL10_BOVIN/5-174----------AAFGKVKTFFQMKDQLHSLLLTQSLLDDFKGY-----LGCQALSEMIQ-------FYLEEVM--PQAENH
IL10H_EBVB9/7-167----------DAFSRVKTFFQTKDEVDNLLLKESLLEDFKGY-----LGCQALSEMIQ-------FYLEEVM--PQAENQ
IL10_MERUN/5-174----------AAFSQVKTFFQKKDQLDNILLTDSLQQDFKGY-----LGCQALSEMIQ-------FYLVEVM--PQAENH

PF14565

Q6NZ84_HUMAN/40-178-----------TFMLAKEASLADNNTDVRLIGEKLFHGVSMS-----ERCYLMKQVLN-------FTLEEVLF-PQSDRF
IL22_HUMAN/40-178-----------TFMLAKEASLADNNTDVRLIGEKLFHGVSMS-----ERCYLMKQVLN-------FTLEEVLF-PQSDRF
Q6NWP4_HUMAN/40-178-----------TFMLAKEASLADNNTDVRLIGEKLFHGVSMS-----ERCYLMKQVLN-------FTLEEVLF-PQSDRF
Q6NZ83_HUMAN/40-178-----------TFMLAKEASLADNNTDVRLIGEKLFHGVSMS-----ERCYLMKQVLN-------FTLEEVLF-PQSDRF
E1C1U2_CHICK/46-184-----------TYTLAEMARLSDQDTDNRLIGQQIYVNIREN-----NRCYMMKRITE-------IIVKDVLL-TEAKER

PF15036

B3DLJ8_DANRE/18-196----------RRYM--KMHFPINYTVQVRYEEVFRLRNISRLVNTSNEEEPVLPRDLQ-------DLWLYVSQ-QGIKKV
IL34_BOVIN/23-184----------LQYM--KHYFPINYRVSVPYEGVLRTANVTRL.....QRAQVSQQELR-------YLWVLVSL-SATEWV
F1S3F1_PIG/19-182----------LQYM--KHYFPINYRVSVPYEGVLRTANVTRL.....QRARVTQRELQ-------YLWVWVSL-SATESV
IL34_RAT/23-184----------LQYM--KHYFPINYRIAVPYEGVLRVANITRL......KAHVSERELR-------YLWVLVSL-NATESV
D8UWE2_TAEGU/16-180----------LQYM--KHYFPIDYTVQVQYEEVLRPSNITRL.....RNGTVSEAALR-------YLWFHVSS-QAVLRI

PF06875

Q9PUJ0_PLEJO/2-215ELA--------LKAKFEEAMANSNTLISKISDI--------MTQMGMSV--TITLP---KP-------LVVPFKGSAY--
Q9PUJ2_PLEJO/2-215ELS--------LKAKFEEAMANSNTLISKISDI--------MTQMGMSV--TITLP---KP-------LVVPFEGSAY--

PF01110

CNTF_CHICK/1-195DAE--------LGPALAAMLLQVSAFVYHLEEL--------LELESRGA--P.AEE---GS-------EPPAPPRLSL--
CNTF_HUMAN/1-199EGD--------FHQAIHTLLLQVAAFAYQIEEL--------MILLEYKI--PRNEA---DG-------MPINVGDGGL--

PF01291

LIF_MOUSE/44-203AVS........LQVKLNATIDVMRGLLSNVLCR--------LCNKYRVG....HVD---VP.......PVPDHSDKEA--
LIF_BOVIN/43-202AHG........LHSKLSTTADVLRGLLSNVLCR--------LCSKYHVS....HVD---VT.......YGPDTSGKDV--
ONCM_HUMAN/37-209QDLERSGLNIEDLEKLQMARPNILGLRNNIYCM--------AQLLDNSD...TAEP---TKAGRGASQPPTPTPASDA--
ONCM_MOUSE/34-194PAFP..........KLDSARHNILGIRNNVFCM--------ARLLNHSL..EIPEP---TQTDSG...ASRSTTTPDV--
ONCM_BOVIN/34-194AH..............QQAEMNVRGFGNNIHCM--------AQLLRGSSDPKAAEP---TQPGPGPT.PLPPTPPSST--

PF03039

IL12A_MOUSE/1-215NAA--------LQNHNHQQIILDKGMLVAIDEL--------MQSLNHNGETLRQKP---P..VGEADPYRVKMKLCIL--
IL12A_PIG/1-222NAK--------LLMDPKRQIFLDQNMLTAITEL--------MQALNFNSETVPQKP---S..LEELDFYKTKIKLCIL--
IL12A_MARMO/1-223SEK--------LLMDPKGQIYEDKALLAAVDYL--------MQAVNVNNETVPQTP---SPEAPSSNLYRTKTKLCIL--

PF00489

IL6_PIG/57-210QKE--------YESNK.GNV---EAVQISTKAL--------IQTLRQKGKNPDKAT---TPNPTTNAGLLDKLQSQNE--
CSF3_BOVIN/42-190AGI--------SPELA.PTL---DTLQLDVTDF--------ATNIWLQMED....L---GAAPAVQPTQGAMPTFTSA--
IL6_FELCA/53-206QDK--------YEGDE.ENA---KSVYTSTNVL--------LQMLKRKGKNQDEVT---IPVPTVEVGLQAKLQSQEE--
CSF3_MOUSE/57-205SGI--------SPALA.PTL---DLLQLDVANF--------ATTIWQQMEN....L---GVAPTVQPTQSAMPAFTSA--
IL6_CANFA/52-205QNN--------YEGDK.ENV---KSVHMSTKIL--------VQMLKSKVKNQDEVT---TPDPTTDASLQAILQSQDE--
IL6_CERAT/57-210QNR--------FESSE.EQA---RAVQMSTKVL--------IQLLQKKAKNLDAIT---TPEPTTNASLLTKLQAQNQ--
CSF3_HUMAN/51-202EGI--------SPELG.PTL---DTLQLDVADF--------ATTIWQQMEE....L---GMAPALQPTQGAMPAFASA--
IL6_BOVIN/57-206QNE--------YEGNQ.ENV---RDLRKNIRTL--------IQILKQKIAD....L---ITTPATNTDLLEKMQSSNE--
IL6_MOUSE/55-209KNN--------LKDNKKDKA---RVLQRDTETL--------IHIFNQEVKDLHKIV---LPTPISNALLTDKLESQKE--
MGF_CHICK/46-196LRL--------LPNHT.TLV---ETLQLDAANL--------SSNIQQQMEDLGLDT---VTLPAEQ..RSPPPTFSGP--

PF07400

IL11_MACFA/1-199RRA--------MGSSLKTLEPELGTLQTRLDRL--------LRRLQLLMSRL---A---LPQLPPDPPAPPLAPPSST--
IL11_HUMAN/1-199RRA--------GGSSLKTLEPELGTLQARLDRL--------LRRLQLLMSRL---A---LPQPPPDPPAPPLAPPSSA--
IL11_MOUSE/1-199RRA--------GGPSLKTLEPELGALQARLERL--------LRRLQLLMSRL---A---LPQAAPDQPVIPLGPPASA--

PF02024

LEP_MACMU/22-167PS---------------RNVIQISNDLENLRDL--------LHLLAFSKSC----H---LPLASGLETLESLGDVLEA--
LEP_PIG/22-167PS---------------RNVIQISNDLENLRDL--------LHLLASSKSC----P---LPQARALETLESLGGVLEA--
LEP_BOVIN/22-167PS---------------RNVVQISNDLENLRDL--------LHLLAASKSC----P---LPQVRALESLESLGVVLEA--
LEP_MOUSE/22-167PS---------------QNVLQIANDLENLRDL--------LHLLAFSKSC----S---LPQTSGLQKPESLDGVLEA--
LEP_HUMAN/22-167PS---------------RNVIQISNDLENLRDL--------LHVLAFSKSC----H---LPWASGLETLDSLGGVLEA--
LEP_MELGA/1-145PS---------------QNVLQIANDLENLRDL--------LHLLAFSKSC----S---LPQTSGLHKPESLDGVLEA--
LEP_CANFA/22-167HS---------------RNVVQISNDLENLRDL--------LHLLASSKSC----P---LPRARGLETFESLGGVLEA--

PF02947

FLT3L_MOUSE/28-162KTV--------AGSKM-------QTLLEDVNTE--------IHFVTS--------C---TFQPLPECLRFVQTNISHL--
FLT3L_HUMAN/27-159KTV--------AGSKM-------QGLLERVNTE--------IHFVTK--------C---AFQPPPSCLRFVQTNISRL--
Q61104_MOUSE/28-162KTV--------AGSKM-------QTLLEDVNTE--------IHFVTS--------C---TFQPLPECLRFVQTNISHL--

PF00103

PLRP1_BOVIN/26-238SEK--------LQAFIERQFSKIIVPVLNTMIQ--------ARSSWTGLPSLMSSD---EDRRHSEF---YNLFYCLR--
CSH2_BOVIN/26-238SEK--------LQAFIESQFRKIIVPVLKMIHE--------VSDTWSRFSSMTFSD---EDRSISEY---YNLFYCLR--
PLRP3_BOVIN/1-213IEE--------LQAFIERQFSQVIYPVIRTIFK--------ARIYWSGLASLVSND---EDVRHSAF---YKLFMCLY--
SOML_CYCLU/21-228LIS--------LEQGVVVLIKKMLDEGMLTINH--------SEQGLLQNG..VQPQ---MLESVMRD---YTLLSCFK--
PR4A1_RAT/17-227NIK--------LLDAIKNIAKKGNF..EINEKA--------NYTAWSELGFLQSPN---RDTRYFAF---YNLFHCLK--
CSH_HUMAN/9-215LKD--------LEEGIQTLMGRLEDGSRRTGQI--------LKQTYSKFDTN..SH---NHDALLKN---YGLLYCFR--
CSH1_BOVIN/26-236TKV--------LLEGVEMIQKRVH.PGEKKNEP--------YPVWSEKSS.LTADD---EDVRQTAF---YRMFHCLH--
SOMA_ACABU/4-202IHL--------LIRANEDGAELFPDSSALQLAP--------YGDYYHSPG......---TDESLRRT---YELLACFK--
PLRP4_BOVIN/26-239LKE--------LQALIERPFSQVIFTARRKMYI--------ARIYWFGLRSLLSSN---EDRRHSAF---YSLFFCLR--
PR3D4_RAT/16-223NLI--------ILEGLQKIFNRTQTKVEENENF--------DYPAWSGLKDLQSSD---EDTHLFAI---YNLCRCFK--
PR2C2_MOUSE/16-224INA--------VRNGVNALMSTMLQ..NGDEEK--------KNPAWFLQS....DN---EDARIHSL---YGMISCLD--
SOM2_HUMAN/9-215LKD--------LEEGIQTLMWRLEDGSPRTGQI--------FNQSYSKFD..TKSH---NDDALLKN---YGLLYCFR--
PR8A5_RAT/17-238NRQ--------LLDDLRWILTKVF..PTAEIKE--------EFPSWDYLSFLKSSN---KNHKFLAI---FNLSSCLD--
PR6A1_RAT/20-234IKE--------LMDVLKGILNKIQ..PGSPQNE--------RFPMWNELAYLRSPD---EERRHFAF---TNLFQCLL--
PRL_ANGAN/9-209SNS--------LSSGLDRLIHKIG.SSSKALSP--------LPLQGGDLG....SD---KNSRLINF---YFLLSCFR--
PR7D1_MOUSE/17-240NKD--------LLEYIIRIISKVN..PAIKENE--------DYPTWSDLDSLKSAD---KETQFFAL---YMFSFCLR--
PRL1_ONCTS/8-211SKS--------LGDGLDIMVNKMG.PSSQYISS--------IPFKGGDLG....ND---KTSRLINF---HFLMSCFR--

PF00143

IFNA1_CHICK/35-193RQS--------LLNRIHRYTQHLEQCLDSSDTR--------SRTRWPRNLHL....---TIKKHFSC---LHTFLQDN--
IFNB1_BOVIN/27-186IED--------LLKELYWQMNRLQPIQKEIMQ.--------KQNSTTEDTIV...P---HLGKYYFN---LMQYLESK--
IFNB_HORSE/27-186VKN--------LLVEVHLQMDRLETNLEEIME.--------EESSTWGNTTI...L---RLKKYYGR---ISQYLKAK--
IFNB_HUMAN/27-187VEN--------LLANVYHQINHLKTVLEEKLEK--------EDFTRGKLMSS...L---HLKRYYGR---ILHYLKAK--
IFNB_MOUSE/27-182VVR--------LLDELHQQTVFLKTVLEEKQE.--------ERLTWEMSSTA...L---HLKSYYWR---VQRYLKLM--
IFNW2_HORSE/26-187LDE--------LCTGLLRQLEDLDTCLEQEMGE--------EESALGTVRPT...L---AVKRYFRG---IHLYLKEK--
IFNW1_HORSE/26-187LDR--------LLAGLHQQLEDLNTCLDEQTGE--------EESALGTVGPT...L---AVKRYFRR---IRLYLTEK--
IFNW1_HUMAN/26-187LDQ--------LHTGLHQQLQHLETCLLQVVGE--------GESAGAISSPA...L---TLRRYFQG---IRVYLKEK--
IFNT1_BOVIN/26-187LEQ--------LCTGLQQQLEDLDACLGPVMGE--------KDSDMGRMGPI...L---TVKKYFQG---IHVYLKEK--
IFNA1_MOUSE/26-187LDS--------FCNDLHQQLNDLQGCLMQQVGV--------QEFPLTQEDAL...L---AVRKYFHR---ITVYLREK--
IFNA4_MOUSE/27-183LDS--------FCNDLHQQLNDLKACVMQ....--------.EPPLTQEDSL...L---AVRTYFHR---ITVYLRKK--
IFNA1_BOVIN/26-187LDR--------LRTALDQQLTDLQACLRQEEGL--------PGAPLLKEDSS...L---AVRKYFHR---LTLYLQEK--
IFNA4_HUMAN/26-187LEK--------FSTELYQQLNDLEACVIQEVGV--------EETPLMNEDSI...L---AVRKYFQR---ITLYLTEK--
IFNA1_HUMAN/26-187LDK--------FCTELYQQLNDLEACVMQEERV--------GETPLMNADSI...L---AVKKYFRR---ITLYLTEK--
IFNA_FELCA/26-192LEE--------FCTGLDRQLTRLEACVLQEVEE--------GEAPLTNEDIHPEDS---ILRNYFQR---LSLYLQEK--

PF00714

IFNG_FELCA/15-153YLK--------MFENLKDDDQRIQRSMDTIKED--------MLDKLLNTSSSKRDD---FLKLIQIP---VNDLQVQR--
IFNG_BOVIN/15-152YFK--------LFENLKDN.QVIQRSMDIIKQD--------MFQKFLNGSSEKLED---FKKLIQIP---VDDLQIQR--
IFNG_MOUSE/14-150YLR--------LFEVLKDN.QAISNNISVIESH--------LITTFFSNSKAKKDA---FMSIAKFE---VNNPQVQR--
IFNG_RABIT/15-152YFK--------LFDNLKDH.EVIKKSMESIKED--------IFVKFFNSNLTKMDD---FQNLTRIS---VDDRLVQR--
IFNG_CERAT/15-152YFK--------LFKSFKDD.QRIQKSVETIKED--------INVKFFNSNKKKRDD---FEKLTNYS---VTDLNVQR--
IFNG_RAT/14-151YLR--------LFEVLKDN.QAISNNISVIESH--------LITNFFSNSKAKKDA---FMSIAKFE---VNNPQIQH--
IFNG_HORSE/15-152YFK--------LFENLKDN.QVIQKSMDTIKED--------LFVKFFNSSTSKLED---FQKLIQIP---VNDLKVQR--
IFNG_PIG/15-152YFK--------FFEIFKDN.QAIQRSMDVIKQD--------MFQRFLNGSSGKLND---FEKLIKIP---VDNLQIQR--
IFNG_CALJA/15-152YFK--------LFKNFKDN.QSIQKSMETIKED--------MNVKFFNSNKRKQDD---FERLTNYS---VNDLNVQR--

PF00727

IL4_PIG/25-131TFC--------RASTV--LRHIYRHH.................TCMKSLLSGLDRN---LSS-MANM---.TCSVHEA--
IL4_MOUSE/25-140LVC--------RASKV--LRIFYLKHGKTPCLK........KNSSVLMELQRLFRA---FRC-LDSS---ISCTMNES--
IL4_FELCA/25-131IFC--------RATTV--LRQIYTHH.................NCSTKFLKGLDRN---LSS-MANR---.TCSVNEV--
A7LBR6_BISBO/25-133TFC--------RVGIE--LRRIYRSH.................TCLNKFLGGLDRN---LNS-LASK---.TCSVNEA--
IL4_CERAT/25-149TFC--------RAATV--LRQFYSHHEKDTRCLGASAQQFHRHKQLIRFLKRLDRN---LWG-LAGL---NSCPVKEA--
IL4_RAT/25-140LIC--------RASRV--LRKFYFPRDVPPCLK........NKSGVLGELRKLCRG---VSG-LNSL---RSCTVNES--
IL4_MERUN/25-141LLC--------RATRV--LRKFYFPREVTPCLK........NNSGVLSILRKLCRS---IST-LHPQ---ESCSVSTP--
IL4_HORSE/24-131.IC--------RAAKV--LQQ.YKRH...............DRSLIKECLSGLDRN---LKG-MANG---TCCTVNEA--

PF03487

IL13_HUMAN/15-57LTC--------------------------------------------------------LGG-FASP---GPVPPST.--
IL13_BOVIN/1-43LIC--------------------------------------------------------FGG-LTSP---SPVPSAT.--
IL13_MOUSE/1-47LAC--------------------------------------------------------LGG-LAAP---GPVPRSVS--
IL13_CANFA/1-43LTC--------------------------------------------------------LGG-LASP---SPVTPSP.--

PF01109

CSF2_RAT/18-139PTC--------VQTRL----KLYKQGLRG------------NLTKLNGALTMIASH---YQT-NCPP---TPETDCEI--
CSF2_MOUSE/18-136LTC--------VQTRL----KIFEQGLRG------------NFTKLKGALNMTASY---YQT-YCPP---TPETDCET--
CSF2_BOVIN/18-138PTC--------LQTRL----KLYKNGLQG------------SLTSLMGSLTMMATH---YEK-HCPP---TPETSCGT--
CSF2_CAVPO/18-140PTC--------LQTRL----ALFMKGLRG------------NLTRLEGSLTLMANF---YKQ-HCPP---TPETSCMT--
CSF2_PIG/18-139PTC--------VQTRL----NLYKQGLRG------------SLTRLKSPLTLLAKH---YEQ-HCPL---TEETSCET--
CSF2_HUMAN/18-139PTC--------LQTRL----ELYKQGLRG------------SLTKLKGPLTMMASH---YKQ-HCPP---TPETSCAT--
CSF2_CANFA/18-139PTC--------LETRL----QLYKEGLQG------------SLTSLKNPLTMMANH---YKQ-HCPP---TPESPCAT--

PF02025

IL5_CAVPO/22-134QLC--------IEEIFQGIDTLKNQTTQGE-----------ALATLFQNLSLIKKH---IDL---------QKQKCGE--
IL5_HUMAN/21-133QLC--------TEEIFQGIGTLESQTVQGG-----------TVERLFKNLSLIKKY---IDG---------QKKKCGE--
IL5_HORSE/21-133QLC--------IEEVFQGIDTLKNQTVQGD-----------AVAKLFQNLSLIKGY---IDL---------QKKKCGG--
IL5_SHEEP/19-131QLC--------IEEVFQGIDTLKNQTAQGD-----------AVKKIFRNLSLIKEY---IDL---------QKRKCGG--
IL5_MERUN/19-131QLC--------IGEIFQGLDILKNQTARGG-----------AVETLFQNLSLIKKY---IDR---------QKEKCGE--
IL5_FELCA/21-133QLC--------IEEVFQGIDTLKNRTVPGD-----------AVEKLFRNLSLIKEH---IDR---------QKKKCGG--

PF02404

SCF_PIG/1-274VEC--------MEEHS--FEN.VKKSSKSPEPRLF------TPEKFFGIFNRSIDA---FKDLEMVA---PKTSECVI.S
SCF_RAT/1-273VAC--------MEENA--PKN.VKESLKKPETRNF------TPEEFFSIFNRSIDA---FKD.FMVA---SDTSDCVL.S
SCF_COTJA/1-287MAC--------LAFDK--NKDFIKENGHLYEEDRF------IPENFFRLFNRTIEV---YKE.FADS---LDKNDCIMPS
SCF_CHICK/1-287MAC--------LAFDK--NKDFIKENGHLYEEDRF------IPENFFRLFNSTIEV---YKE.FADS---LDKNDCIMPS

PF02059

IL3_MOUSE/27-138KSF--------RRVNLSKFVESQGEVDPE------------DRYVIKSNLQKLNCC---LPT-SAND---SALPGVFI--
IL3_SAGOE/19-136PNL--------RRPNLEAFQ.KAVKSLQN------------A.TAIESSLKDLPLC---LPM-ATNA---SMQHPIRI--
P97688_RAT/27-141STL--------RRVNLDEFLKSQEEFDSQ------------DTTDIKSKLQKLKCC---IPA-AASD---SVLPGVYN--
IL3_PANTR/20-137NNL--------RRPNLEAFN.RAVKSLQN------------A.SAIESILKNLLPC---LPL-ATAA---PTRHPIRI--
IL3_BOVIN/18-132ESL--------LQANLKVFMTFATDTFGS------------D.SKIMKNLKEFQPV---LPT-AT..---PTEDPIFI--

PF00715

IL2_MERUN/7-151LQC--------LEEELGPLHDVLNLVQSKNLYL--------ED..AGNFISNIRVT---VMK-LKGS---ENTLNCEF--
IL2_PIG/7-151LQC--------LVEELKALEGVLNLGQSKNSDS--------AN..IKESMNNINVT---VLE-LKGS---ETSFKCEY--
IL2_FELCA/7-151LQC--------LVEELKPLEEVLYLAQSKNFHL--------N..HIKELMSNINVT---VLK-LKGS---ETRFTCNY--
IL2_CERAT/7-151LQC--------LEEELKPLEEVLNLAQSKNFHL--------RDT..KDLISNINVI---VLE-LKGS---ETTLMCEY--
IL2_BOVIN/7-152LKC--------LLEELKLLEEVLNLAPSKNLNP--------R..EIKDSMDNIKRI---VLE-LQGS---ETRFTCEY--
IL2_MOUSE/7-165LQC--------LEDELGPLRHVLDLTQSKSFQL--------ED..AENFISNIRVT---VVK-LKGS---DNTFECQF--
IL2_HORSE/7-146LQC--------LEEELKPLEEMLKNFLSK....--------...DIKELMSNINVT---VLG-LKGS---ETRFTCEY--

PF00758

EPO_BOVIN/28-192QAL--------LANASQPCEALRLHVDKAVSGLR-------SLTSLLRALGAQKEA---ISL-PDAT---P.SAAPLR--
TPO_CANFA/24-188RGQ--------LGPSCLSSLLGQLSG.QVRLLLG-------ALQGLLGTQLPPQGR---TTT-HKDP---NAIFLSFQ--
EPO_RABIT/31-195QAL--------LANSSQLPETLQVHVDKAVSGLR-------SLTSLLRALGVQKEA---VSP-PEAA---S.SAAPLR--
TPO_MOUSE/24-188RGQ--------LEPSCLSSLLGQLSG.QVRLLLG-------ALQGLLGTQLPLQGR---TTA-HKDP---NALFLSLQ--
EPO_MOUSE/29-192QAL--------LANSSQPPETLQLHIDKAISGLR-------SLTSLLRVLGAQKEL---MSP-PDTT---P..PAPLR--
EPO_MACFA/30-192QAV--------LANSSQPFEPLQLHMDKAISGLR-------SITTLLRALGAQ.EA---ISL-PDAA---S..AAPLR--

PF00726

IL10_BOVIN/5-174GPD--------IKEHVNS---LGEKLKTLRLRL--------RRCHRFLPCENKSKA---VEK-VKRV---FSELQERG--
IL10H_EBVB9/7-167DPE--------AKDHVNS---LGENLKTLRLRL--------RRCHRFLPCENKSKA---VEQ-IKNA---FNKLQEKG--
IL10_MERUN/5-174GPE--------IKENLNS---LGEKLKTLRMQL--------RRCHRFLPCENKSKA---VEQ-VKND---FNKLQEKG--

PF14565

Q6NZ84_HUMAN/40-178QPY--------MQEVVPF---LA----RLSNRL--------STCHIEGDDLHIQRN---VQK-LKDT---VKKLEESG--
IL22_HUMAN/40-178QPY--------MQEVVPF---LA----RLSNRL--------STCHIEGDDLHIQRN---VQK-LKDT---VKKLGESG--
Q6NWP4_HUMAN/40-178QPY--------MQEVVPF---LA----RLSNRL--------STCHIEGDDLHIQRN---VQK-LKDT---VKKLGESG--
Q6NZ83_HUMAN/40-178QPY--------MQEVVPF---LA----RLSNRL--------STCHIEGDDLHIQRN---VQK-LKDT---VKKLGESG--
E1C1U2_CHICK/46-184YPY--------AEDVAQF---LA----SLTSEL--------SRCKYSGNREHIEKN---LEE-MKSK---MKELGENG--

PF15036

B3DLJ8_DANRE/18-196LRV--------LPERHPTRRKYLSDLENLFKKF--------ETVFKEGNHEDQENVRERPES-LQTIWDHLTEQDYKG--
IL34_BOVIN/23-184QEV--------LLEGHPS.WKYLEEVHTLLLDV--------KQGLG.....GVEVS.PQVEA-VLNL...LS.APG.S--
F1S3F1_PIG/19-182QEV--------LLEGHPS.WKYLEEVHTLLLDV--------RQGLA...VSSVEVQLPRILD-RLSI...LAEAGGPA--
IL34_RAT/23-184LDV--------LLEGHPS.WKYLQEVQTLLENV--------QRSLM.....DVEIG.PHVEA-VLSL...LS.TPGLS--
D8UWE2_TAEGU/16-180REV--------LPEKHPS.WKYTQELCQLFDAL--------GEEYSKYRQTDVETV...VAD-LVKL...IYSAGAES--

PF06875

Q9PUJ0_PLEJO/2-215-----------------------------------------------------FSKKLRGGVVC--------KEYKERVF
Q9PUJ2_PLEJO/2-215-----------------------------------------------------FRKKLRGGVVC--------KEYKERVL

PF01110

CNTF_CHICK/1-195-----------------------------------------------------FEQKLRGLRVL--------RELAQWAV
CNTF_HUMAN/1-199-----------------------------------------------------FEKKLWGLKVL--------QELSQWTV

PF01291

LIF_MOUSE/44-203-----------------------------------------------------FQRKKLGCQLL--------GTYKQVIS
LIF_BOVIN/43-202-----------------------------------------------------FQKKKLGCQLL--------GKYKQVIA
ONCM_HUMAN/37-209-----------------------------------------------------FQRKLEGCRFL--------HGYHRFMH
ONCM_MOUSE/34-194-----------------------------------------------------FNTKIGSCGFL--------WGYHRFMG
ONCM_BOVIN/34-194-----------------------------------------------------FQRKLRNCGFL--------RGYHRFMR

PF03039

IL12A_MOUSE/1-215-----------------------------------------------------LHAFSTRVVTI--------NRVMGYLS
IL12A_PIG/1-222-----------------------------------------------------LHAFRIRAVTI--------DRMMSYLN
IL12A_MARMO/1-223-----------------------------------------------------LHALRIRAVTI--------NRVMSYLN

PF00489

IL6_PIG/57-210-----------------------------------------------------WMKNTKIILIL--------RSLEDFLQ
CSF3_BOVIN/42-190-----------------------------------------------------FQRRAGGVLVA--------SQLHRFLE
IL6_FELCA/53-206-----------------------------------------------------WLRHTTIHLTL--------RRLEDFLQ
CSF3_MOUSE/57-205-----------------------------------------------------FQRRAGGVLAI--------SYLQGFLE
IL6_CANFA/52-205-----------------------------------------------------CVKHTTIHLIL--------RSLEDFLQ
IL6_CERAT/57-210-----------------------------------------------------WLQDMTTHLIL--------RSFKEFLQ
CSF3_HUMAN/51-202-----------------------------------------------------FQRRAGGVLVA--------SHLQSFLE
IL6_BOVIN/57-206-----------------------------------------------------WVKNAKIILIL--------RNLENFLQ
IL6_MOUSE/55-209-----------------------------------------------------WLRTKTIQFIL--------KSLEEFLK
MGF_CHICK/46-196-----------------------------------------------------FQQQVGGFFIL--------ANFQRFLE

PF07400

IL11_MACFA/1-199-----------------------------------------------------WGGIRAAHAIL--------GGLHLTLD
IL11_HUMAN/1-199-----------------------------------------------------WGGIRAAHAIL--------GGLHLTLD
IL11_MOUSE/1-199-----------------------------------------------------WGSIRAAHAIL--------GGLHLTLD

PF02024

LEP_MACMU/22-167-----------------------------------------------------SL-YSTEVVAL--------SRLQGSLQ
LEP_PIG/22-167-----------------------------------------------------SL-YSTEVVAL--------SRLQGALQ
LEP_BOVIN/22-167-----------------------------------------------------SL-YSTEVVAL--------SRLQGSLQ
LEP_MOUSE/22-167-----------------------------------------------------SL-YSTEVVAL--------SRLQGSLQ
LEP_HUMAN/22-167-----------------------------------------------------SG-YSTEVVAL--------SRLQGSLQ
LEP_MELGA/1-145-----------------------------------------------------LL-YSTEVVAL--------SRLQGSLQ
LEP_CANFA/22-167-----------------------------------------------------SL-YSTEVVAL--------NRLQAALQ

PF02947

FLT3L_MOUSE/28-162-----------------------------------------------------LKDTCTQLLALKPCIGKACQNFSRCLE
FLT3L_HUMAN/27-159-----------------------------------------------------LQETSEQLVALKPWITR..QNFSRCLE
Q61104_MOUSE/28-162-----------------------------------------------------LKDTCTQLLALKPCIGKACQNFSRCLE

PF00103

PLRP1_BOVIN/26-238------------------------------------------------R------DSRKVDMYI--------KILTCRTH
CSH2_BOVIN/26-238------------------------------------------------R------DSRKVDMYI--------KILTCRTR
PLRP3_BOVIN/1-213------------------------------------------------R------DSRKLDMYT--------EILACRIT
SOML_CYCLU/21-228------------------------------------------------K------DAHKMEAFL--------KLLKCRQT
PR4A1_RAT/17-227------------------------------------------------K------DSNNVEMYL--------KLLKCRLI
CSH_HUMAN/9-215------------------------------------------------K------DMDKVETFL--------RMVQCR.S
CSH1_BOVIN/26-236------------------------------------------------R------DSSKISTYI--------NLLKCR.F
SOMA_ACABU/4-202------------------------------------------------K------DMHKVETYL--------TVAKCRLS
PLRP4_BOVIN/26-239------------------------------------------------R------DTRKLDIYT--------KFVACRLI
PR3D4_RAT/16-223------------------------------------------------S------DIHKIDTYL--------KVLRCRVV
PR2C2_MOUSE/16-224------------------------------------------------N------DFKKVDIYL--------NVLKCYML
SOM2_HUMAN/9-215------------------------------------------------K------DMDKVETFL--------RIVQCR.S
PR8A5_RAT/17-238------------------------------------------------Y------DTQVHYTLS--------QILNCLIT
PR6A1_RAT/20-234------------------------------------------------Q------DSRKFDSKV--------RLLKCRLI
PRL_ANGAN/9-209------------------------------------------------R------DSHKIDNFL--------KLLRCRAA
PR7D1_MOUSE/17-240------------------------------------------------I------DLETVDFLV--------NFLKCLLL
PRL1_ONCTS/8-211------------------------------------------------R------DSHKIDSFL--------KVLRCRAT

PF00143

IFNA1_CHICK/35-193------------------------------------------------DYSACAWEHVRLQARA--------WFLHI.HN
IFNB1_BOVIN/27-186------------------------------------------------EYDRCAWTVVQVQILT--------NVSFL.MR
IFNB_HORSE/27-186------------------------------------------------KYSHCAWTVVQAEMLR--------NLAFL.NG
IFNB_HUMAN/27-187------------------------------------------------EYSHCAWTIVRVEILR--------NFYFI.NR
IFNB_MOUSE/27-182------------------------------------------------KYNSYAWMVVRAEIFR--------NFLII.RR
IFNW2_HORSE/26-187------------------------------------------------KYSDCAWEIVRMEIMR--------SFSSS.AN
IFNW1_HORSE/26-187------------------------------------------------KYSDCAWEIVRVDIMR--------SFSSS.AN
IFNW1_HUMAN/26-187------------------------------------------------KYSDCAWEVVRMEIMK--------SLFLS.TN
IFNT1_BOVIN/26-187------------------------------------------------EYSDCAWEIIRVEMMR--------ALSSS.TT
IFNA1_MOUSE/26-187------------------------------------------------KHSPCAWEVVRAEVWR--------ALSSS.AN
IFNA4_MOUSE/27-183------------------------------------------------KHSLCAWEVIRAEVWR--------ALSSS.TN
IFNA1_BOVIN/26-187------------------------------------------------RHSPCAWEVVRAQVMR--------AFSSS.TN
IFNA4_HUMAN/26-187------------------------------------------------KYSPCAWEVVRAEIMR--------SLSFS.TN
IFNA1_HUMAN/26-187------------------------------------------------KYSPCAWEVVRAEIMR--------SLSLS.TN
IFNA_FELCA/26-192------------------------------------------------KYSPCAWEIVRAEIMR--------SLYYSSTA

PF00714

IFNG_FELCA/15-153------------------------------------------------K------AINELFKVM--------NDLSPRSN
IFNG_BOVIN/15-152------------------------------------------------K------AINELIKVM--------NDLSPKSN
IFNG_MOUSE/14-150------------------------------------------------Q------AFNELIRVV--------HQLLPESS
IFNG_RABIT/15-152------------------------------------------------K------AVSELSNVL--------NFLSPKSN
IFNG_CERAT/15-152------------------------------------------------K------AVHELIQVM--------AELSPAAK
IFNG_RAT/14-151------------------------------------------------K------AVNELIRVI--------HQLSPESS
IFNG_HORSE/15-152------------------------------------------------K------AISELIKVM--------NDLSPKAN
IFNG_PIG/15-152------------------------------------------------K------AISELIKVM--------NDLSPRSN
IFNG_CALJA/15-152------------------------------------------------K------AIHELIQVM--------AELSPAPK

PF00727

IL4_PIG/25-131-----------------------------------------------------KKST..LKDFL--------ERLKTIMK
IL4_MOUSE/25-140-----------------------------------------------------KSTS..LKDFL--------ESLKSIMQ
IL4_FELCA/25-131-----------------------------------------------------KKCT..LKDFL--------ERLKAIMQ
A7LBR6_BISBO/25-133-----------------------------------------------------KTSTSTLKDLL--------ERLKTIMK
IL4_CERAT/25-149-----------------------------------------------------SQST..LEDFL--------ERLKTIMR
IL4_RAT/25-140-----------------------------------------------------TLTT..LKDFL--------ESLKSILR
IL4_MERUN/25-141-----------------------------------------------------TLTT..LNDFL--------GRLRGIMQ
IL4_HORSE/24-131-----------------------------------------------------KKST..LKDFL--------ERLKTIMK

PF03487

IL13_HUMAN/15-57-----------------------------------------------------...A--LRELI--------EELVNITQ
IL13_BOVIN/1-43-----------------------------------------------------...A--LKELI--------EELVNITQ
IL13_MOUSE/1-47-----------------------------------------------------LPLT--LKELI--------EELSNITQ
IL13_CANFA/1-43-----------------------------------------------------...T--LKELI--------EELVNITQ

PF01109

CSF2_RAT/18-139-----------------------------------------------------EVTT--FEDFI--------KNLKGFLF
CSF2_MOUSE/18-136-----------------------------------------------------QVTT--YADFI--------DSLKTFLT
CSF2_BOVIN/18-138-----------------------------------------------------QFIS--FKNFK--------EDLKEFLF
CSF2_CAVPO/18-140-----------------------------------------------------QIIT--FKSFK--------ENLKRFLF
CSF2_PIG/18-139-----------------------------------------------------QSIT--FKSFK--------DSLNKFLF
CSF2_HUMAN/18-139-----------------------------------------------------QIIT--FESFK--------ENLKDFLL
CSF2_CANFA/18-139-----------------------------------------------------QNIN--FKSFK--------ENLKDFLF

PF02025

IL5_CAVPO/22-134-----------------------------------------------------ERRR--VKQFL--------DYLQEFLA
IL5_HUMAN/21-133-----------------------------------------------------ERRR--VNQFL--------DYLQEFLG
IL5_HORSE/21-133-----------------------------------------------------ERWR--VKQFL--------DYLQEFLG
IL5_SHEEP/19-131-----------------------------------------------------ERWR--VKQFL--------DYLQVFLG
IL5_MERUN/19-131-----------------------------------------------------ERRR--ARQFL--------DYLQEFLG
IL5_FELCA/21-133-----------------------------------------------------ERWR--VKKFL--------DYLQVFLG

PF02404

SCF_PIG/1-274STLTPEKDSRVSVTKPFMLPPVAASSLRNDS......SSSNRKASDSIEDSSLQWAAVALPAFF--------SLVIGFAF
SCF_RAT/1-273STLGPEKDSRVSVTKPFMLPPVAASSLRNDS......SSSNRKAAKSPEDPGLQWTAMALPALI--------SLVIGFAF
SCF_COTJA/1-287TVETPENDSRVAVTKTISFPPVAASSLRNDSIGSNTSSNSNKEALGFISSSSLQGISIALTSLL--------SLLIGFIL
SCF_CHICK/1-287TVETPENDSRVAVTKTISFPPVAASSLRNDSIGSNTSSNSNKEALGFISSSSLQGISIALTSLL--------SLLIGFIL

PF02059

IL3_MOUSE/27-138-----------------------------------------------------RDLD--..DFR--------KKLRFYMV
IL3_SAGOE/19-136-----------------------------------------------------KDGD--WNDFR--------MKLKFYLK
P97688_RAT/27-141-----------------------------------------------------KDLD--..DFK--------KKLRFYVI
IL3_PANTR/20-137-----------------------------------------------------KDGD--WNEFR--------RKLTFYLK
IL3_BOVIN/18-132-----------------------------------------------------ENKN--LGDFR--------MKLEEYLV

PF00715

IL2_MERUN/7-151-----------------------------------------------------DDETVTVVEFL--------SRWITFCQ
IL2_PIG/7-151-----------------------------------------------------DDETVTAVEFL--------NKWITFCQ
IL2_FELCA/7-151-----------------------------------------------------DDETATIVEFL--------NKWITFCQ
IL2_CERAT/7-151-----------------------------------------------------ADETATIVEFL--------NRWITFCQ
IL2_BOVIN/7-152-----------------------------------------------------DDATVNAVEFL--------NKWITFCQ
IL2_MOUSE/7-165-----------------------------------------------------DDESATVVDFL--------RRWIAFCQ
IL2_HORSE/7-146-----------------------------------------------------DNETETIVEFL--------NKWITFCQ

PF00758

EPO_BOVIN/28-192-----------------------------------------------------AFTVDALSKLF--------RIYSNFLR
TPO_CANFA/24-188-----------------------------------------------------QLLRGKVRFLL--------LVAGPTLC
EPO_RABIT/31-195-----------------------------------------------------TVAADTLCKLF--------RIYSNFLR
TPO_MOUSE/24-188-----------------------------------------------------QLLRGKVRFLL--------LVEGPTLC
EPO_MOUSE/29-192-----------------------------------------------------TLTVDTFCKLF--------RVYANFLR
EPO_MACFA/30-192-----------------------------------------------------TITADTFCKLF--------RVYSNFLR

PF00726

IL10_BOVIN/5-174-----------------------------------------------------VYKAMSEFDIF--------INYIETYM
IL10H_EBVB9/7-167-----------------------------------------------------IYKAMSEFDIF--------INYIEAYM
IL10_MERUN/5-174-----------------------------------------------------VYKAMNEFDIF--------INCIEAYM

PF14565

Q6NZ84_HUMAN/40-178-----------------------------------------------------EIKAIGELDLL--------FMSLRNAC
IL22_HUMAN/40-178-----------------------------------------------------EIKAIGELDLL--------FMSLRNAC
Q6NWP4_HUMAN/40-178-----------------------------------------------------EIKAIGELDLL--------FMPLRNAC
Q6NZ83_HUMAN/40-178-----------------------------------------------------EIKAIGELDLL--------FMSLRNAC
E1C1U2_CHICK/46-184-----------------------------------------------------KNKAIGELDLL--------FDYIENAC

PF15036

B3DLJ8_DANRE/18-196-----------------------------------------------------W.KSVTPKSIL--------DNCYRTML
IL34_BOVIN/23-184-----------------------------------------------------L.KLVRPKALL--------DNCFRVMQ
F1S3F1_PIG/19-182-----------------------------------------------------I.SLM...ALL--------SSWVGGLE
IL34_RAT/23-184-----------------------------------------------------L.KLVRPKALL--------DNCFRVME
D8UWE2_TAEGU/16-180-----------------------------------------------------RSKAVRPKALL--------DNCLKVMR

PF06875

Q9PUJ0_PLEJO/2-215LTKRDFMLLAEKYQG------PL-----------------------
Q9PUJ2_PLEJO/2-215LTKRDFEFLAKKYQG------HL-----------------------

PF01110

CNTF_CHICK/1-195RSVRDLRQLSKH..G.PGSGAALGLPESQ-----------------
CNTF_HUMAN/1-199RSIHDLRFISSHQTGIPARGSHYIANNKK-----------------

PF01291

LIF_MOUSE/44-203VVVQAF----------------------------------------
LIF_BOVIN/43-202VLAQAF----------------------------------------
ONCM_HUMAN/37-209SVGRVF----------------------------------------
ONCM_MOUSE/34-194SVGRVF----------------------------------------
ONCM_BOVIN/34-194TAGQVL----------------------------------------

PF03039

IL12A_MOUSE/1-215SA--------------------------------------------
IL12A_PIG/1-222SS--------------------------------------------
IL12A_MARMO/1-223SS--------------------------------------------

PF00489

IL6_PIG/57-210FSLRAIR---------------------------------------
CSF3_BOVIN/42-190LAYRGLR---------------------------------------
IL6_FELCA/53-206FSLRAVR---------------------------------------
CSF3_MOUSE/57-205TARLALH---------------------------------------
IL6_CANFA/52-205FSLRAVR---------------------------------------
IL6_CERAT/57-210SSLRALR---------------------------------------
CSF3_HUMAN/51-202VSYRVLR---------------------------------------
IL6_BOVIN/57-206FSLRAIR---------------------------------------
IL6_MOUSE/55-209VTLRSTR---------------------------------------
MGF_CHICK/46-196TAYRALR---------------------------------------

PF07400

IL11_MACFA/1-199WAVRGLLLLKTRL---------------------------------
IL11_HUMAN/1-199WAVRGLLLLKTRL---------------------------------
IL11_MOUSE/1-199WAVRGLLLLKTRL---------------------------------

PF02024

LEP_MACMU/22-167DMLWQLDLSPGC----------------------------------
LEP_PIG/22-167DMLRQLDLSPGC----------------------------------
LEP_BOVIN/22-167DMLRQLDLSPGC----------------------------------
LEP_MOUSE/22-167DILQQLDVSPEC----------------------------------
LEP_HUMAN/22-167DMLWQLDLSPGC----------------------------------
LEP_MELGA/1-145DILQQLDISPEC----------------------------------
LEP_CANFA/22-167DMLRRLDLSPGC----------------------------------

PF02947

FLT3L_MOUSE/28-162VQCQ------------------------------------------
FLT3L_HUMAN/27-159LQCQ------------------------------------------
Q61104_MOUSE/28-162VQCQ------------------------------------------

PF00103

PLRP1_BOVIN/26-238KT....C---------------------------------------
CSH2_BOVIN/26-238KT....C---------------------------------------
PLRP3_BOVIN/1-213NT....C---------------------------------------
SOML_CYCLU/21-228DRYN..C---------------------------------------
PR4A1_RAT/17-227RS...KC---------------------------------------
CSH_HUMAN/9-215VEG..SC---------------------------------------
CSH1_BOVIN/26-236TP....C---------------------------------------
SOMA_ACABU/4-202PEAN..C---------------------------------------
PLRP4_BOVIN/26-239YK...KC---------------------------------------
PR3D4_RAT/16-223FKN..EC---------------------------------------
PR2C2_MOUSE/16-224KIDN..C---------------------------------------
SOM2_HUMAN/9-215VEG..SC---------------------------------------
PR8A5_RAT/17-238GKD...C---------------------------------------
PR6A1_RAT/20-234YNR..DC---------------------------------------
PRL_ANGAN/9-209KQ..DRC---------------------------------------
PR7D1_MOUSE/17-240YDD..VC---------------------------------------
PRL1_ONCTS/8-211NMRPETC---------------------------------------

PF00143

IFNA1_CHICK/35-193LTGNTRT---------------------------------------
IFNB1_BOVIN/27-186LTGYVRD---------------------------------------
IFNB_HORSE/27-186LTDYLQN---------------------------------------
IFNB_HUMAN/27-187LTGYLRN---------------------------------------
IFNB_MOUSE/27-182LTRNFQN---------------------------------------
IFNW2_HORSE/26-187LQGRLRM---------------------------------------
IFNW1_HORSE/26-187LQGRLGM---------------------------------------
IFNW1_HUMAN/26-187MQERLRS---------------------------------------
IFNT1_BOVIN/26-187LQKRLRK---------------------------------------
IFNA1_MOUSE/26-187VLGRLRE---------------------------------------
IFNA4_MOUSE/27-183LLARLSE---------------------------------------
IFNA1_BOVIN/26-187LQERFRR---------------------------------------
IFNA4_HUMAN/26-187LQKRLRR---------------------------------------
IFNA1_HUMAN/26-187LQERLRR---------------------------------------
IFNA_FELCA/26-192LQKRLRS---------------------------------------

PF00714

IFNG_FELCA/15-153LRKR------------------------------------------
IFNG_BOVIN/15-152LRKR------------------------------------------
IFNG_MOUSE/14-150LRKR------------------------------------------
IFNG_RABIT/15-152LKKR------------------------------------------
IFNG_CERAT/15-152IGKR------------------------------------------
IFNG_RAT/14-151LRKR------------------------------------------
IFNG_HORSE/15-152LRKR------------------------------------------
IFNG_PIG/15-152LRKR------------------------------------------
IFNG_CALJA/15-152IGKR------------------------------------------

PF00727

IL4_PIG/25-131E---KYS---------------------------------------
IL4_MOUSE/25-140M---DYS---------------------------------------
IL4_FELCA/25-131K---KYS---------------------------------------
A7LBR6_BISBO/25-133E---KYS---------------------------------------
IL4_CERAT/25-149E---KYS---------------------------------------
IL4_RAT/25-140G---KYL---------------------------------------
IL4_MERUN/25-141M---KNW---------------------------------------
IL4_HORSE/24-131E---KYS---------------------------------------

PF03487

IL13_HUMAN/15-57N---Q-----------------------------------------
IL13_BOVIN/1-43N---Q-----------------------------------------
IL13_MOUSE/1-47D---Q-----------------------------------------
IL13_CANFA/1-43N---Q-----------------------------------------

PF01109

CSF2_RAT/18-139DIPFDCW---------------------------------------
CSF2_MOUSE/18-136DIPFECK---------------------------------------
CSF2_BOVIN/18-138IIPFDCW---------------------------------------
CSF2_CAVPO/18-140AIPFDCW---------------------------------------
CSF2_PIG/18-139TIPFDCW---------------------------------------
CSF2_HUMAN/18-139VIPFDCW---------------------------------------
CSF2_CANFA/18-139NIPFDCW---------------------------------------

PF02025

IL5_CAVPO/22-134VINTEWTIE-------------------------------------
IL5_HUMAN/21-133VMNTEWIIE-------------------------------------
IL5_HORSE/21-133VINTEWTIE-------------------------------------
IL5_SHEEP/19-131VINTEWTME-------------------------------------
IL5_MERUN/19-131VMSTEWTME-------------------------------------
IL5_FELCA/21-133VINTEWTME-------------------------------------

PF02404

SCF_PIG/1-274GA--LYWKKKQP.NLTRTVENIQIN..EEDNEISMLQEKEREFQEV
SCF_RAT/1-273GA--LYWKKKQS.SLTRAVENIQIN..EEDNEISMLQQKEREFQEV
SCF_COTJA/1-287GV--IYWKKTHPKSRPESNETTQCHGCQEENEISMLQQKEKEHLQV
SCF_CHICK/1-287GA--IYWKKTHPKSRPESNETIQCHGCQEENEISMLQQKEKEHLQV

PF02059

IL3_MOUSE/27-138HL--------------------------------------------
IL3_SAGOE/19-136TL--------------------------------------------
P97688_RAT/27-141HL--------------------------------------------
IL3_PANTR/20-137TL--------------------------------------------
IL3_BOVIN/18-132II--------------------------------------------

PF00715

IL2_MERUN/7-151SAIS------------------------------------------
IL2_PIG/7-151SIYS------------------------------------------
IL2_FELCA/7-151SIFS------------------------------------------
IL2_CERAT/7-151SIIS------------------------------------------
IL2_BOVIN/7-152SIYS------------------------------------------
IL2_MOUSE/7-165SIIS------------------------------------------
IL2_HORSE/7-146SIIS------------------------------------------

PF00758

EPO_BOVIN/28-192GKLTLYTGEACRRGDR------------------------------
TPO_CANFA/24-188AKQSQPTTAVPTNTSL------------------------------
EPO_RABIT/31-195GKLKLYTGEACRRGDR------------------------------
TPO_MOUSE/24-188VRRTLPTTAVPSSTSQ------------------------------
EPO_MOUSE/29-192GKLKLYTGEVCRRGDR------------------------------
EPO_MACFA/30-192GKLKLYTGEACRRGDR------------------------------

PF00726

IL10_BOVIN/5-174TT--------------------------------------------
IL10H_EBVB9/7-167TI--------------------------------------------
IL10_MERUN/5-174TI--------------------------------------------

PF14565

Q6NZ84_HUMAN/40-178----------------------------------------------
IL22_HUMAN/40-178----------------------------------------------
Q6NWP4_HUMAN/40-178----------------------------------------------
Q6NZ83_HUMAN/40-178----------------------------------------------
E1C1U2_CHICK/46-184----------------------------------------------

PF15036

B3DLJ8_DANRE/18-196CLFKECFTKEDD----------------------------------
IL34_BOVIN/23-184LLYCPCCKESSV----------------------------------
F1S3F1_PIG/19-182PIWGTGCVPSSV----------------------------------
IL34_RAT/23-184LLYCSCCKQSPI----------------------------------
D8UWE2_TAEGU/16-180MLFGGPCRWEST----------------------------------

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window