Sequence alignment for CL0066

PF08709

ITPR1_MOUSE/4-229------------------KMSSFLHIGDICSLYAEGSTN.........GFISTLGLVD----------------------
A7SEK1_NEMVE/3-227------------------QVTSFLHIGDIVSLYAEGNVT.........GFISTLGLID----------------------
A8HAL5_DANRE/4-229------------------HRSSFLHIGDIVSLYAEGTVN.........GFISTLGLVD----------------------
O13054_MAKNI/9-216------------------EEIQFLRTDDHVVLQCTASILKE....QIKLCLSCEGFGN----------------------
O77089_PANAR/5-231------------------GSASFLHMGDIVSLYAEGSVS.........GFISTLGLVD----------------------
P91905_CAEEL/13-215------------------DDVSFLRTGDIVCLSCVASHNRDGVLGSERVCLCTEGFGN----------------------
ITPR3_HUMAN/3-230------------------EMSSFLHIGDIVSLYAEGSVN.........GFISTLGLVD----------------------
RY44_DROME/11-206------------------DDVSFLRTEDMVTLSCTAT..G......ERVCLAAEGFGN----------------------
Q27J07_APLCA/1-225------------------MATNFVHIGDIVSLYAEGTVN.........GFLSTLGLVD----------------------
Q4DBL7_TRYCC/3-204------------------RKQRIIKYGSLVHFSCEE............GYIAASGLEA----------------------
Q4QEZ2_LEIMA/11-201------------------MLVQPLRYGSLISLYKQSLD..........GYVVATSSSE----------------------
Q4RLR0_TETNG/15-213------------------DNLS....DDEVVLQCVACIQKE....NRKFCLAAEGLGN----------------------
Q4RY06_TETNG/4-165------------------KMSSFLHIGDICSLYAEGSTN.........GFISTLGLVD----------------------
Q57XB2_TRYB2/3-212------------------QSRVPIRYGAFIHLSCDE............GYVTAGGLGN----------------------
Q5TQX0_ANOGA/7-234------------------GSVSFLHLGDIVSLYSEGSVS.........GFLSTLGLVD----------------------
Q66S77_OIKDI/1-221------------------MQKQIL..GDVISIYAEGS...........GFISTLGLVD----------------------
Q8TA74_HEMPU/8-204------------------DEVSFLRTGDQLNLVCSSQSLG.......HVLLGAEGFGN----------------------
ITPR_ASTPE/4-229------------------MSASFLHFGDIVSLYAEGSVN.........GFISTLGLVD----------------------
Q9Y0A1_CAEEL/78-317------------------GNNGNLHIGDIISLYTESSSNQE.....QRGFLSTLGLVD----------------------

PF02815

RYR2_RABIT/226-406---------------------GYLIGGDVLRL..--------------.....LHGHM----------------------
Q6J9T9_ASPFM/358-545---------------------GYLHSHAHMYP..--------------.....TGSKQ----------------------
RYR3_HUMAN/216-398---------------------GYLLGGHVVRL..--------------.....FHGH.----------------------
Q759J8_ASHGO/342-519---------------------GYLHSHNHMYQ..--------------.....GGSEQ----------------------
ITPR_ASTPE/231-419---------------------DGLKGGDVVRL..--------------.....FHAEQ----------------------
Q6FL03_CANGA/354-530---------------------GYLHSHSHAYP..--------------.....TGSEQ----------------------
Q9GS15_CAEBR/327-562---------------------NSVKSGDVVRL..--------------.....FHADQ----------------------
PMT1_SCHPO/329-505---------------------GYLHSSELLYP..--------------.....EGTEQ----------------------
Q91313_LITCT/214-394---------------------GYVTGGDVLRL..--------------.....FHGHM----------------------
Q7SH94_NEUCR/369-558---------------------GYLHSHPLMYP..--------------.....TGSKQ----------------------
O13054_MAKNI/219-399---------------------GFLIGGYVLRL..--------------.....FHGHM----------------------
ITPR_DROME/239-453---------------------HILKGGDVVRL..--------------.....FHAEQ----------------------
Q6W3E4_RAT/232-432---------------------DVLKGGDVVRL..--------------.....FHAEQ----------------------
ITPR1_HUMAN/232-433---------------------DILKGGDVVRL..--------------.....FHAEQ----------------------
Q6BFC5_PARTE/240-444---------------------GFLSIQDTVWI..--------------.....NYSEQ----------------------
Q8TA74_HEMPU/220-400---------------------GFLNGLDTLRF..--------------.....SRGHM----------------------
Q6FK90_CANGA/355-531---------------------AFLHSHLARYPLR--------------YEDDRVSSQG----------------------
Q8MXI9_CAEEL/274-503---------------------NSVKSGDVVRL..--------------.....FHADQ----------------------
Q96WN5_EMEND/353-528---------------------GLLHSHVQTYP..--------------.....EGSSQ----------------------
P91905_CAEEL/220-400---------------------GFLFGNDVLRL..--------------.....FHGN.----------------------
O77089_PANAR/234-422---------------------GVLKGGDVIRL..--------------.....FHAEQ----------------------
Q6CPY0_KLULA/347-524---------------------GYLHSHKHIYE..--------------.....TGSKQ----------------------
Q6CAY4_YARLI/355-531---------------------GLLHSHVQTYP..--------------.....EGSEQ----------------------
Q6C5U6_YARLI/339-516---------------------GYLHSHESLYE..--------------.....TGSKQ----------------------
RY44_DROME/211-392---------------------GYVFGGDVLRF..--------------.....FHGG.----------------------
RYR1_PIG/212-391---------------------GYVTGGHVLRL..--------------.....FHGHM----------------------
PMT5_YEAST/339-517---------------------GYLHSHLHNYP..--------------.....AGSMQ----------------------
PMT1_CANAL/359-534---------------------GYLHSHEHFYQ..--------------.....TGSKQ----------------------
PMT1_YEAST/343-520---------------------GYLHSHSHNYP..--------------.....AGSEQ----------------------
ITPR3_RAT/233-432---------------------EVLKGGDVVRL..--------------.....FHAEQ----------------------

PF06268

FASC_STRPU/393-496-----------------PH-GFVGMKE---------------------------------------------------G-
Q6AXQ1_RAT/24-138-----------------AG-TYLTFEA---------------------------------------------------Y-
SING_DROME/33-147-----------------QH-KYMTAET---------------------------------------------------F-
FSCN2_HUMAN/389-492-----------------LD-GFVCHHR---------------------------------------------------G-
FSCN3_HUMAN/271-381-----------------KT-GRFISVI---------------------------------------------------Y-
FSCN1_HUMAN/268-378-----------------AN-ERNVSTR---------------------------------------------------Q-
Q6PBS5_DANRE/19-131-----------------EN-RYLTAEA---------------------------------------------------F-
FASC_XENLA/382-483-----------------EH-GFIGCRK---------------------------------------------------M-
FASC_STRPU/138-254-----------------VC-MKNVQHQ---------------------------------------------------R-
FSCN2_HUMAN/20-133-----------------TD-RYLTAES---------------------------------------------------F-
Q6AZJ6_XENLA/277-387-----------------AN-GRNVSTR---------------------------------------------------Q-
Q6EEB3_PRODO/230-340-----------------GN-DRNVFTR---------------------------------------------------Q-
FSCN2_HUMAN/141-254-----------------AH-LLSVSRR---------------------------------------------------R-
FSCN1_HUMAN/391-493-----------------EH-GFIGCRK---------------------------------------------------V-
FSCN2_HUMAN/266-376-----------------AN-HRYVSVR---------------------------------------------------Q-
Q6EE45_SCYCA/96-208-----------------AN-LFSVTRK---------------------------------------------------R-
FSCN1_HUMAN/20-134-----------------GN-KYLTAEA---------------------------------------------------F-
Q6AZJ6_XENLA/152-265-----------------FT-LYSVTRK---------------------------------------------------R-
FASC_STRPU/16-130-----------------AG-RYLTAEK---------------------------------------------------F-
Q6AZJ6_XENLA/32-144-----------------NN-KYLTAEA---------------------------------------------------F-
FSCN1_HUMAN/142-256-----------------VN-IYSVTRK---------------------------------------------------R-
SING_DROME/155-270-----------------VN-LRSIGRK---------------------------------------------------R-
Q6PBS5_DANRE/139-252-----------------AN-LLSVARK---------------------------------------------------R-

PF06229

Q7QC94_ANOGA/71-260-----------------QA-YVKALDN---------------------------------------------------G-
A7RWZ5_NEMVE/69-257-----------------GS-YVEALNN---------------------------------------------------G-
Q15ER4_SCHMA/95-286-----------------AC-YLSATDE---------------------------------------------------G-
A1D4G2_NEOFI/89-280-----------------AS-ELENLIE---------------------------------------------------G-
Q96MD3_HUMAN/4-156-----------------GT-YIHALDN---------------------------------------------------G-
Q2UKA8_ASPOR/84-274-----------------AS-EIENLIE---------------------------------------------------G-
FRG1_DROME/72-260-----------------RS-YLKAMDN---------------------------------------------------G-
Q6DDA8_XENTR/66-254-----------------GA-YIHALDT---------------------------------------------------G-
FRG1_CAEEL/78-273-----------------RT-YVAAMDN---------------------------------------------------G-
Q0UA03_PHANO/83-265-----------------AS-ALENMVD---------------------------------------------------G-
A2Q890_ASPNC/96-312-----------------AS-ALENMIE---------------------------------------------------G-
Q566W5_DANRE/65-253-----------------NS-YIHALDT---------------------------------------------------G-
A6SI98_BOTFB/86-272-----------------AS-ALENMIE---------------------------------------------------N-

PF04601

Q9LJJ2_ARATH/1-141MEIFKKAETVRLRS..YHD-KYLLAEE---------------------------------------------------D-
Q9LQ43_ARATH/1-142MEIFQKAKAVRLRS..HHD-KYLVADE---------------------------------------------------D-
Q9CAS3_ARATH/251-396MEIFRDAKSVRLRSYAHHG-KYLIADD---------------------------------------------------D-
O04559_ARATH/227-368MEFFQKAKAIRMRN..SHN-KYLTADD---------------------------------------------------D-
O04559_ARATH/1-144MELFTKGNNVKLRS..HLD-KFLVADD---------------------------------------------------D-
Q9CAS2_ARATH/1-139MDFFNQAKAVRMRN..VHD-KYLTADE---------------------------------------------------D-
Q9CAS3_ARATH/1-144MELFNNGTAVRLRS..CHD-TYIYAVE---------------------------------------------------D-

PF00167

Q28XC7_DROPS/16-141-----------------DE-YVLTLKKH--------------------------------------------------N-
Q4S3V1_TETNG/61-182-----------------DP-KRLYCKN.--------------------------------------------------G-
P91672_DROME/249-377-----------------RK-IQLYIK..--------------------------------------------------.-
Q8R5L5_RAT/84-205-----------------RQ-RRLYCNVG--------------------------------------------------I-
B1AK17_HUMAN/79-205-----------------IV-TKLYSRQ.--------------------------------------------------.-
FGF1_CHICK/25-148-----------------KP-KLLYCSN.--------------------------------------------------G-
Q8I6J6_CIOIN/91-218-----------------RR-ERLYCRVG--------------------------------------------------I-
Q9YH31_NOTVI/72-193-----------------RL-RRLYCNVG--------------------------------------------------I-
FGF16_MOUSE/61-187-----------------RR-RQLYCRT.--------------------------------------------------.-
Q5TLD5_DANRE/43-168-----------------RI-RRLYNRT.--------------------------------------------------.-
A1YJ27_NPVSF/70-196-----------------NN-IVLYFN..--------------------------------------------------.-
Q90XQ4_AMBME/55-181-----------------RT-YQLYSRP.--------------------------------------------------S-
Q86GG2_CIOSA/55-180-----------------RY-YEIYAKA.--------------------------------------------------T-
Q8I6J7_CIOIN/133-264-----------------RM-YRLYNRN.--------------------------------------------------.-
FG17_DANRE/53-178-----------------RV-YQLYSRT.--------------------------------------------------S-
Q9E225_9ABAC/33-160-----------------RP-IQIVMR..--------------------------------------------------.-
Q8I6J5_CIOIN/56-181-----------------RY-CEIYSKR.--------------------------------------------------T-
Q4SAA6_TETNG/81-202-----------------RV-RRLYCNVG--------------------------------------------------I-
Q2NP32_NPVHC/29-154-----------------RL-THIVIR..--------------------------------------------------.-
Q4RWE4_TETNG/71-205-----------------IV-TRLYCRQ.--------------------------------------------------.-
FGF1_NOTVI/2-125-----------------KP-KLLYCSN.--------------------------------------------------G-
Q544I6_MOUSE/65-189-----------------RV-RRLFCRT.--------------------------------------------------.-
Q8VI79_RAT/32-156-----------------RW-RRLFSST.--------------------------------------------------.-
A3EXK2_NEMVE/57-180-----------------RV-TQLYSRN.--------------------------------------------------S-
Q4RSP6_TETNG/17-145-----------------RM-RKLFSFQ.--------------------------------------------------.-
FGFH_NPVOP/29-156-----------------RL-VQVLIH..--------------------------------------------------.-
Q5M7N7_XENTR/65-189-----------------RI-RKLFCRT.--------------------------------------------------.-
FGF1_XENLA/25-148-----------------KP-KLLYCNN.--------------------------------------------------G-
O92401_NPVBM/28-154-----------------IP-GRLFIN..--------------------------------------------------.-
A6Y7S4_DIDAL/29-153-----------------DP-KRLYCKN.--------------------------------------------------G-
Q66IF7_XENTR/61-197-----------------RN-RKLYCAT.--------------------------------------------------.-
Q4T869_TETNG/30-155-----------------RV-YQLYSRT.--------------------------------------------------S-
Q91BB2_NPVST/26-158-----------------RQ-IQLFVK..--------------------------------------------------.-
Q9N1B9_SHEEP/84-207-----------------RW-RKLFSFT.--------------------------------------------------.-
A7RZP2_NEMVE/41-163-----------------RE-TQLYSRS.--------------------------------------------------S-
LE756_CAEEL/72-207-----------------RR-GALFCRS.--------------------------------------------------.-
Q8R5L6_RAT/78-192-----------------RL-RRLYCNVG--------------------------------------------------I-
Q8T8A3_CIOSA/159-283-----------------RR-KMLYCKN.--------------------------------------------------.-
A7YT71_DANRE/25-149-----------------SL-IKLHCRN.--------------------------------------------------G-
Q4SCS5_TETNG/71-197-----------------IV-TRLYSQH.--------------------------------------------------.-
A7SH09_NEMVE/102-230-----------------RK-VKLYCKT.--------------------------------------------------.-
FGF1_DANRE/17-138-----------------KL-TRLYCMN.--------------------------------------------------G-
Q287N3_NPVAS/32-156-----------------NH-VHLFLN..--------------------------------------------------.-
Q80LI4_NPVAH/49-164-----------------NH-KLLYDCN.--------------------------------------------------.-
Q5TKR7_DANRE/53-179-----------------RV-YQIYSRT.--------------------------------------------------S-
Q8QLI3_9ABAC/34-158-----------------KN-VQIFIN..--------------------------------------------------.-
Q2LGG1_DANRE/81-202-----------------RV-RRLYCNVG--------------------------------------------------I-
FGF18_MOUSE/53-178-----------------RL-YQLYSRT.--------------------------------------------------S-
Q9J897_9ABAC/33-159-----------------NH-VHIFLN..--------------------------------------------------.-
Q0PV85_HALRO/186-312-----------------RR-RQLYCRN.--------------------------------------------------.-
Q1LXT4_DANRE/17-141-----------------RL-RRLYSAN.--------------------------------------------------.-
Q1HGX9_NPVAP/32-158-----------------RL-VQLFIN..--------------------------------------------------.-
Q4SFA3_TETNG/9-140-----------------RL-RRLYCNVG--------------------------------------------------I-
Q9DFC9_DANRE/67-188-----------------RL-RRLYCNVG--------------------------------------------------I-
A5PM81_DANRE/55-181-----------------IV-TRLFSQQ.--------------------------------------------------.-
A7SRV3_NEMVE/407-534-----------------RI-VKMFCRV.--------------------------------------------------.-
Q8NF90_HUMAN/87-216-----------------RT-GSLYCRVG--------------------------------------------------I-
FGF11_HUMAN/71-197-----------------IV-TKLFCRQ.--------------------------------------------------.-
Q0KJ02_ORYLA/70-196-----------------RR-RQLYCRT.--------------------------------------------------.-
FGF4B_XENLA/68-189-----------------RL-RRLYCNVG--------------------------------------------------I-
A7RFG7_NEMVE/73-195-----------------AV-RRLYSEH.--------------------------------------------------.-
Q4VBV7_DANRE/72-196-----------------RR-RKLFSYQ.--------------------------------------------------.-
FGF3_DANRE/62-204-----------------RR-RKLYCAT.--------------------------------------------------.-
Q4SJV9_TETNG/17-140-----------------RL-ARLYCMN.--------------------------------------------------G-
Q6VTW1_NPVCD/28-157-----------------RL-VHIFVH..--------------------------------------------------.-
Q8QG59_AMBME/67-191-----------------RL-RRLLCVT.--------------------------------------------------.-
Q3YAG3_STRPU/203-330-----------------QP-TQLFCRT.--------------------------------------------------.-
FGF17_RAT/53-178-----------------RE-YQLYSRT.--------------------------------------------------S-
A7SHR3_NEMVE/45-169-----------------RH-VRIYSRS.--------------------------------------------------S-
Q5TLE2_DANRE/41-170-----------------RT-GRLYCRVG--------------------------------------------------I-
Q6E7C8_OIKDI/1583-1704-----------------RP-VQLYART.--------------------------------------------------.-
Q9PVY1_XENLA/62-188-----------------RR-RQLYCRT.--------------------------------------------------.-
Q8JMA6_9ABAC/35-159-----------------NN-VRIFIN..--------------------------------------------------.-
Q1XG75_DANRE/59-183-----------------RQ-RRLFSFQ.--------------------------------------------------.-
Q0IIQ7_DANRE/50-175-----------------RI-YQLYSRT.--------------------------------------------------T-
A7T359_NEMVE/53-177-----------------KI-AFLYSSN.--------------------------------------------------S-
Q5GAD8_9VIRU/23-148-----------------QY-KILYCKT.--------------------------------------------------.-

PF00340

IL1B_BOVIN/144-261-----------------LL-SQEMNRE---------------------------------------------------V-
IL1RA_MOUSE/61-174-----------------LQ-GPNIKLE---------------------------------------------------E-
IL1RA_HUMAN/60-173-----------------LQ-GPNVNLE---------------------------------------------------E-
IL1B_FELCA/146-263-----------------LN-GQNMNQQ---------------------------------------------------V-
Q9GL09_SHEEP/72-185-----------------SD-CSDNAPQ---------------------------------------------------T-
IL1A_MOUSE/158-269-----------------TW-LNDLQQE---------------------------------------------------V-
Q96KJ8_HUMAN/72-185-----------------SD-CRDNAPR---------------------------------------------------T-
IL1B_CERAT/147-264-----------------LQ-GQDVEQQ---------------------------------------------------V-
Q9I8D2_CHICK/66-187-----------------QE-VKS.GSG---------------------------------------------------M-
IL1B_PIG/145-262-----------------LL-TGDLKRE---------------------------------------------------V-
IL1B_MOUSE/148-264-----------------LN-GQNINQQ---------------------------------------------------V-
IL1A_RABIT/156-266-----------------AP-LQNLGDA---------------------------------------------------V-
IL1A_BOVIN/156-265-----------------TT-LNNLEEA---------------------------------------------------V-
Q91Z66_SIGHI/73-186-----------------AD-QKANEAQ---------------------------------------------------T-
IL1A_CERAT/155-266-----------------AA-IHNLDEA---------------------------------------------------V-
IL1RA_RABIT/60-173-----------------LQ-GPNAKLE---------------------------------------------------E-

PF05270

OTOG_MOUSE/1241-1384-----------------PY..QLSSV..--------------------------------------------------.-
ABFB_ASPOR/358-502-----------------IS.LQVTTAGY--------------------------------------------------T-
Q82P18_STRAW/329-465-----------------VS.RSFQSVNY--------------------------------------------------P-
Q829S7_STRAW/176-312-----------------VW.KSVRSVNY--------------------------------------------------P-
Q55841_SYNY3/35-174-----------------PY.VRYESVNY--------------------------------------------------P-
Q9HEY2_COCCA/355-499-----------------VS.LRATTSGY--------------------------------------------------T-
Q86ZN9_FUSOX/351-495-----------------IS.LKVTTSGY--------------------------------------------------T-
Q82P90_STRAW/346-481-----------------VTPVRFSSYNY--------------------------------------------------P-
ABFB_EMENI/357-506-----------------VS.LKVTTSGY--------------------------------------------------D-
ABF1_HYPJE/352-496-----------------IS.LRATTACC--------------------------------------------------T-
ABFB_ASPKW/350-494-----------------VS.LRVTTPGY--------------------------------------------------T-

PF00197

IT2_PSOTE/2-176-------------ELVDVE-GKTVRNGG----------------------------------------------------
IAAS_ORYSJ/26-193-------------PVYDTE-GHELSADG----------------------------------------------------
MIRA_RICDU/35-216-------------PVLDID-GEKLRTGT----------------------------------------------------
ALB1_PSOTE/4-171-------------PVYDAE-GNKLVNRG----------------------------------------------------
ASP_THECC/30-208-------------PVLDTD-GDELQTGV----------------------------------------------------
IAAS_HORVU/27-199-------------PVHDTD-GHELRADA----------------------------------------------------
API8_SOLTU/39-219-------------PVLDTN-GKELNPDS----------------------------------------------------
ICW3_PSOTE/27-198-------------DLVDAE-GNLVENGG----------------------------------------------------
IDE3_ERYCA/1-168-------------VLLDGN-GEVVQNGG----------------------------------------------------
IECI_ERYVA/2-173-------------PLVDLE-GNLVENGG----------------------------------------------------
IT1A_PSOTE/2-168-------------PLLDSE-GELVRNGG----------------------------------------------------
ITRA_SOYBN/26-199-------------FVLDNE-GNPLENGG----------------------------------------------------
ITRY_ACACO/2-171-------------ELLDAD-GDILRNGG----------------------------------------------------
KTI1_SOYBN/27-197-------------FVLDTD-DDPLQNGG----------------------------------------------------
CPI1_SOLTU/47-221-------------EVYDQD-GNPLRIGE----------------------------------------------------
SPOR1_IPOBA/42-216-------------PVLDIN-GDEVRAGG----------------------------------------------------
GWIN3_POPSP/32-195-------------AVLDFY-GREVQAGA----------------------------------------------------

PF07951

BXB_CLOBO/1075-1291-----YKIQSYSEYLKDFW-GNPLMYNK----------------------------------------------------
BXE_CLOBU/1063-1250-----YNNEPNANILKDFW-GNYLLYDK----------------------------------------------------
TETX_CLOTE/1105-1314-----YTSYLSITFLRDFW-GNPLRYDT----------------------------------------------------
BXA1_CLOBO/1088-1293-----YDNQSNSGILKDFW-GDYLQYDK----------------------------------------------------
BXG_CLOBO/1083-1297-----YWIQSSTNTLKDFW-GNPLRYDT----------------------------------------------------
BXC1_CLOBO/1089-1291-----FNSLQYTNVVKDYW-GNDLRYNK----------------------------------------------------
Q45851_9CLOT/1072-1268-----YHSEPDSTILKDFW-GNYLLYNK----------------------------------------------------
Q45967_CLOBO/1085-1285-----FNSLQYTNVVKDYW-GNDLRYDK----------------------------------------------------
BXF_CLOBO/1083-1274-----YSNEPDPSILKNYW-GNYLLYNK----------------------------------------------------
BXD_CLOBO/1076-1276-----YEGQILRNVIKDYW-GNPLKFDT----------------------------------------------------

PF14200

C6I1A8_9BACE/97-198------------------E-SQVWNLIP...C....G..........DG.....C.......YSIV...SP..L....T.
A8NAT6_COPC7/44-145------------------D-SQHWEIRT...S....E..L.......PN.....Q.......YTIL...NA..L....Y.
A8P1Y0_COPC7/90-188------------------P-NQKWTTNW...T....G...........K.....G.......WTLR...SV..A....S.
A8PCJ2_COPC7/37-137------------------D-NQHWDIEQ...T....D..........DG.....H.......FHIK...NA..E....S.
A1Z5I4_BEABA/43-129------------------D-NQRWTCQD..................................RRLV...NV..R....P.
A6EHX4_9SPHI/63-161------------------L-GQVWTILP...A....K..........DG.....T.......FTIT...SS..K....Y.
A6ERL3_9BACT/65-184------------------K-HQHWKFIA...S....GD.G.......SK.....M.......YYIV...NV..SPQTKK.
A6G9W3_9DELT/412-502------------------A-SAQWELVD...I....G..........GG.....R.......YHLI...NQ..A....T.
A6G9W3_9DELT/550-640------------------A-KAHWRFER...I....S..........GD.....Q.......YHLV...NL..N....T.
A7EWX9_SCLS1/45-151------------------D-NAKWQVAL...V....AG.S.......GD.....SA.....EYLII...NV..H....S.
A7WK54_LYSSH/385-485------------------R-NAHWDFSY........DS.Q.......RG.....A.......YVIR...NS..Q...FH.
A8NDJ7_COPC7/40-145------------------G-YQQWEARR...G.......I.......AG.....Y.......WKFR...NV..A....T.
A8NDJ7_COPC7/189-287------------------R-NQLWEATA...Y....EN.E.......KY.....M.......WSFK...NV..S....N.
A9E912_9FLAO/86-187------------------D-NSLFKFEA...A....G..........NG.....Y.......YIIR...SK..Q....N.
B0DSD3_LACBS/40-138------------------D-NQKWVAST...........Q.......NG.....L.......WYFK...SV..A....T.
B0MJQ2_9FIRM/249-352------------------K-HAVWYFER...R....D..........DG.....S.......YKIT...NC..K....N.
B1VUB2_STRGG/50-155------------------A-SQVWRLAP...V....HE.G.......AA.....L.......FHLV...NE..H....S.
B2WIQ5_PYRTR/45-143------------------K-NTHFEIVA...A....GG.TSAKPEIGDR.....E.......YHII...AG..N....S.
B2ZRS9_CLINE/46-144------------------G-NQQWTLVQ...L....P..H.......TT.....I.......YTMQ...AV..N....P.
B3C971_9BACE/378-483------------------P-HQKWTITA...V....PN.G.......GG.....YLG..GPYYKIV...IE..G....T.
B3PKR2_CELJU/520-621------------------N-CQKWTFTH...T....D..........NG.....Y.......YQVK...PL..H...NS.
B4V2C9_9ACTO/39-139------------------A-AQQWLISP...V....HS.G.......GG.....L.......FHLV...SA..H....N.
B4V8E2_9ACTO/575-676------------------A-AQQWNLTR...SVPGDWS.S.......TA.....A.......YRVT...NA..G....S.
B5GTM6_STRCL/44-154------------------G-PERWQLVP...V....PA.P.......QG.....GQAPDQPAYVIR...NA..V....S.
B6SS31_MAIZE/56-169------------------W-YKDMRFST..RV....KD.E.......EGM...PA.......FALV...NK..A....T.
B8P008_POSPM/56-152------------------L-NQLWTVEP...V....ACIS.......DN.....A.......WKII...NA..A....S.
B8P2U3_POSPM/41-134------------------L-NQLWQFEK...V....G..........DN.....T.......WKIL...NA..A....S.
B8PDH6_POSPM/53-148------------------D-AQLWTVQI...V....DE.S.......KG.....H.......VKLL...NA..A....G.
C0PSY5_PICSI/62-180------------------P-SQQWIMDTSWSV....KA.K.......DD.....AGF...PAFALV...NK..A....T.
C3I9T1_BACTU/507-614------------------L-NAEWHFIY........EE.E.......KK.....A.......YTVW...NS.RR....P.
C4LYE8_ENTHI/157-265------------------K-NQLFKIKQ...LE..IPG.H.......ER.....C.......IVLQ...CN..Y....S.
C4M3J3_ENTHI/137-243------------------E-NQMFQLIK...C....KE.P.......GH.....TC.....CVLIR...AV..H....S.
D9STT7_CLOC7/601-707------------------A-TSLWRIVA.........G.D.......TG.....Y.......VNLV...AQVGS....A.
C6D9K8_PECCP/404-505------------------D-SQRFYFNA...I....G..........NG.....Y.......FNLV...NV..N....S.
C6L2F6_APOCT/307-416------------------L-NQRWEFIY........DS.S.......KK.....A.......YKIK...SK.LN....A.
C6L2F6_APOCT/611-715------------------N-NQKWSFVY........DE.N.......KK.....A.......YKIK...SG.IN....S.
C7PHL4_CHIPD/338-435------------------S-TGQFNVQN...I....D..........YG.....Y.......FALR...TK..G....K.
C9YYM1_STRSW/484-581------------------A-TQYWHVV.........TK.S.......DG.....A.......VTLL...NK..S....G.
D1BKB8_SANKS/626-731------------------G-SQLWTAHA...L....PQ.G.......SG.....S.......HALRYVLEA..A....D.
D1Q0S6_9BACT/375-479------------------P-HQKWTITP...A....GK.........GGYLGGPY.......YKIC...IE..G....T.
D2QTB1_SPILD/373-478------------------P-HQKWTITD...A....PD.T.......TG.....YLG..GPYYKIV...LA..G....T.
D2S061_HALTV/623-726------------------S-GQVWDVTE...L....E..........DG.....V.......FRIS...PA.DA....G.
D2VXQ3_NAEGR/45-151------------------R-SQFVLIKS...S....DT.G.......NN.....QND...LIVLIK...CE..A....S.
D3Q6V6_STANL/130-238------------------Y-PKVMTWKP...V....K..........DR.....Q.......YTVG...LA..Y....TK
D4J5M3_9FIRM/492-590------------------P-YRQFQFTY...Q....G..........NG.....Y.......YKIK...NM..G....S.
D4J5M3_9FIRM/739-837------------------A-FRRFKFTY...Q.......S.......NG.....Y.......YTIK...NE..G....S.
Q8A5P7_BACTN/65-167------------------E-SQVWNLIP...C....E..Q.......EG.....C.......YTIT...SP..L....T.
Q8X123_9AGAR/44-154------------------W-HQLWLAEP...I....PN.V.......AD.....T.......FTLC...NL..F....S.
Q9L153_STRCO/584-686------------------S-ARQWRLSA...V....RH.DG....GVRD.....R.......YVFT...RP..E....D.

PF00652

GALT3_MOUSE/505-627------------------I-SGYIKSVG-----------------------------------------..-------Q-
CRBG3_HUMAN/888-1017------------------P-AVYIRIKN-----------------------------------------RA-------Q-
GLT10_CAEEL/536-662------------------A-EGEIRNVG-----------------------------------------..-------T-
CUPF_DICDI/32-142------------------A-KSLFKGSN-----------------------------------------NI-------T-
Q7QIK5_ANOGA/491-617------------------A-FGRLASQA-----------------------------------------..-------D-
Q7PZM5_ANOGA/438-564------------------A-SGRVQSVA-----------------------------------------N.-------P-
Q7Q0E9_ANOGA/461-587------------------A-NGAIQSVA-----------------------------------------N.-------A-
Q7QDR0_ANOGA/437-565------------------A-SGSIQSVA-----------------------------------------D.-------S-
ML1_VISAL/440-560------------------A-PREVTIYG-----------------------------------------F.-------R-
O96048_LUMTE/132-255------------------K-FFYIKSEL-----------------------------------------..-------N-
GALT7_CAEEL/478-592------------------V-WGEARNPA-----------------------------------------..-------T-
GLTL2_HUMAN/505-628------------------F-SGKLHNTG-----------------------------------------..-------L-
GLT13_DROME/435-548------------------A-TGTLRN..-----------------------------------------..-------E-
Q7NQK0_CHRVO/5-133------------------S-VPYFITYS-----------------------------------------..-------Q-
GALT4_CAEEL/461-580------------------K-SFQMKI..-----------------------------------------..-------G-
Q8W2E8_IRIHO/447-569------------------T-RPFLTPII-----------------------------------------GL-------N-
Q9SLV9_CUCSA/35-159------------------V-PGATHLVG-----------------------------------------R.-------D-
AGALA_ASPNG/424-536------------------V-VPTGLVFN-----------------------------------------TA-------S-
GALT1_MOUSE/430-548------------------S-LGEIRNVE-----------------------------------------..-------T-
GALT3_DROME/512-658------------------A-EELMALID-----------------------------------------LE-------R-
Q7Y0V1_9FABA/7-131------------------F-ESTVRIGG-----------------------------------------R.-------D-
GLT12_MOUSE/440-569------------------F-FGMLQNRG-----------------------------------------L.-------R-
Q9ADL1_SORCE/171-307------------------T-DTTYTLVG-----------------------------------------VQ-------S-
Q8C2S1_MOUSE/660-788------------------I-YFRLRNKA-----------------------------------------..-------T-
Q9X583_9ACTO/367-502------------------S-GTVYTLSN-----------------------------------------AA-------A-
GALT9_MACFA/467-595------------------T-YGEVRNSK-----------------------------------------A.-------S-
Q8KKH3_BACCI/270-405------------------S-DGIYTIAS-----------------------------------------KA-------S-
GALT5_HUMAN/810-932------------------A-SGVLINVA-----------------------------------------..-------L-
Q7SBD7_NEUCR/100-230------------------G-DGGMLVVS-----------------------------------------TL-------T-
O04071_SAMNI/439-558------------------V-VPLVTFIV-----------------------------------------GY-------N-
Q9HFA9_9TREE/43-172------------------S-GGQLIHPG-----------------------------------------SH-------T-
Q9EWL6_STRCO/70-209------------------N-DNIFYLKV-----------------------------------------KH-------S-
Q824Z7_STRAW/111-218------------------S-PGDLQNEA-----------------------------------------..-------T-
Q9HFB1_9ASCO/416-528------------------V-TPTGLIFN-----------------------------------------TL-------S-
Y1454_MYCBO/33-153------------------A-DGPVQLKS-----------------------------------------RL-------G-
Q6TBQ9_CRYPV/535-659------------------F-VGEIRNKK-----------------------------------------L.-------D-
Q825I1_STRAW/713-838------------------V-QGRIRNAD-----------------------------------------..-------S-
Q7TLZ3_9ZZZZ/377-504------------------G-SGEIHAVG-----------------------------------------..-------A-
Q7X2C9_STRTE/266-386------------------D-GGQIKGVA-----------------------------------------..-------S-
GALT9_DROME/521-640------------------A-HGEIRNLG-----------------------------------------YG-------G-
GLT10_DROME/483-615------------------F-SGVIESVA-----------------------------------------F.-------P-
Q825L5_STRAW/296-417------------------G-APITGL..-----------------------------------------..-------A-
Q6BE06_BACTU/699-826------------------N-SSVVTS..-----------------------------------------..-------E-
ENVE_SALTY/53-170------------------D-AEQIRTT.-----------------------------------------..-------D-
Q6YBY0_TOXGO/500-612------------------Y-LGPLRNDK-----------------------------------------..-------I-
O86669_STRCO/329-444------------------I-GRTTYFTG-----------------------------------------GE-------P-
FLVS_FLAME/296-437------------------N-GTYTLTTS-----------------------------------------LA-------G-
Q8RTY5_9GAMM/861-988------------------I-HRWVSLRD-----------------------------------------KR-------A-
Q7VN40_HAEDU/61-177------------------H-YRYTGEIR-----------------------------------------TY-------W-
GLTL3_HUMAN/465-591------------------A-YGELRNNK-----------------------------------------A.-------K-
Q82LA2_STRAW/332-460------------------S-ATYETLTA-----------------------------------------RH-------S-
GALT3_CAEEL/484-604------------------S-LGAIVNRF-----------------------------------------..-------T-
GLTL1_HUMAN/431-552------------------L-PGIIKQ..-----------------------------------------..-------G-
Q825H7_STRAW/402-529------------------T-PRQTRLRN-----------------------------------------LA-------A-
GALT7_DROME/467-582------------------H-WGELRSVA-----------------------------------------..-------S-
Q8VUT1_9PSED/305-438------------------S-ATSIKGRQ-----------------------------------------..-------S-
Q70US9_ADEVO/400-521------------------T-VPTVTTIV-----------------------------------------GY-------D-
GALT8_DROME/446-570------------------A-SGVLQSIS-----------------------------------------S.-------P-
Q9K438_STRCO/427-551------------------V-GQVTTPWV-----------------------------------------..-------A-
Q7SIF1_TRIKI/2-122------------------A-AATVRIAG-----------------------------------------R.-------D-
GALT4_MOUSE/444-574------------------W-HGAIRSMG-----------------------------------------I.-------S-
GALT4_DROME/511-641------------------A-AGIIQNVA-----------------------------------------N.-------P-
GALT6_CAEEL/475-606------------------F-GRMTSSSN-----------------------------------------..-------S-
GLT11_CAEEL/482-602------------------K-KYLIKMAN-----------------------------------------..-------G-
Q8GB62_9GAMM/313-450------------------P-SGYTNLQV-----------------------------------------AH-------S-
Q6BE03_BACTU/674-805------------------I-YQIVTALN-----------------------------------------..-------N-
O68641_CELCE/306-433------------------L-PTGTGAVR-----------------------------------------AA-------N-
Q8RTY5_9GAMM/724-853------------------L-PTYVRIVN-----------------------------------------RA-------S-
Q9RDQ1_STRCO/383-509------------------D-SPMIVHIH-----------------------------------------AA-------S-
Q9SLV9_CUCSA/165-289------------------L-NSMVANIE-----------------------------------------WL-------N-
GLT11_DROME/425-535------------------I-GKIMPFVA-----------------------------------------..-------P-
Q9L0N4_STRCO/326-472------------------M-NVMLRNAT-----------------------------------------..-------T-
GALT7_MOUSE/533-649------------------E-WGEIRGLE-----------------------------------------..-------T-
GALT2_DROME/507-627------------------D-PQEVGQFR-----------------------------------------QD-------S-
GLT10_HUMAN/459-587------------------A-WGEIRNVG-----------------------------------------..-------T-
Q9K473_STRCO/837-959------------------R-SGEVKGV.-----------------------------------------..-------G-
GLT12_DROME/433-546------------------A-SGHVKTLE-----------------------------------------F.-------P-
GALT1_DROME/473-597------------------G-WGKVHAVN-----------------------------------------..-------S-
AHV_ACTSK/47-157------------------A-SVTIRNAQ-----------------------------------------..-------T-
Q8LKQ3_VISAL/8-135------------------S-EPTVRFVG-----------------------------------------R.-------N-
Q82HL7_STRAW/418-544------------------N-GSFAQVVN-----------------------------------------AD-------S-
GALT9_CAEEL/450-571------------------A-YGALHTVV-----------------------------------------SG-------T-
O62004_BRAFL/490-604------------------A-GKSFYLIY-----------------------------------------RK-------D-
Q7NYA5_CHRVO/248-356------------------A-RGPIAN..-----------------------------------------..-------G-
O96048_LUMTE/2-124------------------A-GRPFLLVS-----------------------------------------KH-------S-
Q86S91_9CILI/376-511------------------S-GTKYVIVN-----------------------------------------RM-------S-
Q97TI2_CLOAB/443-579------------------G-WYYIKNIN-----------------------------------------..-------A-
O04071_SAMNI/311-434------------------V-VDVTRRIS-----------------------------------------GR-------D-
Q9ZBF7_STRCO/336-461------------------V-APGTTIYG-----------------------------------------HA-------S-
Q868M7_CUCEC/115-242------------------E-QVATEIIN-----------------------------------------LA-------S-
GALT6_MOUSE/497-619------------------F-YGAIKNLG-----------------------------------------..-------T-
Q9EWL5_STRCO/41-182------------------D-STVRYLVN-----------------------------------------KH-------S-
Q82P89_STRAW/370-505------------------T-PTAYTIVN-----------------------------------------RN-------S-
Q7Y0V1_9FABA/137-258------------------T-SPFVTSIA-----------------------------------------GY-------L-
GLT11_HUMAN/479-604------------------V-LQRGRLYH-----------------------------------------LQ-------T-
GALT2_HUMAN/446-563------------------A-FGALQQ..-----------------------------------------..-------G-
GLT14_MOUSE/420-545------------------Q-KGNIRQ..-----------------------------------------..-------R-

PF03498

Q46102_CAMJU/29-187------------------M-VSIRSLET----------------------------------------------------
Q6UPC3_ECOLX/79-232------------------A-VSLMN.MD----------------------------------------------------
Q7DK11_AGGAC/39-178------------------R-ISLRSLLT----------------------------------------------------
Q9RFY4_HELHT/29-183------------------P-FSLRSLAT----------------------------------------------------
O32587_ECOLX/37-179------------------L-FTFRNLQS----------------------------------------------------
CDTA_HELHP/86-226------------------.-ISIMS.SS----------------------------------------------------
CDTA_HAEDU/77-221------------------F-MTLMG.QN----------------------------------------------------
Q6EZE1_ECOLX/49-197------------------E-VSIMS.TG----------------------------------------------------
CDTA_CAMJJ/115-260------------------F-LTILG.PS----------------------------------------------------
Q47090_ECOLX/44-187------------------L-VNIRNVLT----------------------------------------------------

PF05588

O06016_CLOBO/1-147------------------M-TAERTFLP-----------------------------------------HG---------
Q9LBT0_CLOBO/1-146------------------M-SSERTFLP-----------------------------------------NG---------
Q45841_CLOBO/1-146------------------M-SAERTFLP-----------------------------------------NG---------

PF07468

Q38719_AMAHP/2-154-----AGLPVIMCLKSNNN-QKYLRYQS--------------------------------------------------DN
Q38719_AMAHP/159-299-----FQFPKTYVTFKGNN-GKYLGVIT--------------------------------------------------..

PF08709

ITPR1_MOUSE/4-229---DRCVVQ----------PEAGDLNNP-------------...PK.KFRDCLFKL.CPMNRYSAQK-----------QF
A7SEK1_NEMVE/3-227---DRCVVQ----------PGAGDLSNP-------------...PK.KFRDCLFKI.CPMNRYSAQK-----------QF
A8HAL5_DANRE/4-229---DRCVVQ----------PETGDLTNP-------------...PK.KFRDCLFKV.CPMNRYSAQR-----------QF
O13054_MAKNI/9-216---RLCFLE----------TTSNAQNVP-------------...P..DLAICCFIL.EQSLSVRALQ-----------EM
O77089_PANAR/5-231---ARCVVN----------PEAGDLSTP-------------...PK.KFRDCLFSI.CPSNRYSAQK-----------QF
P91905_CAEEL/13-215---RMCTLE----------NVSD.KDIP-------------...P..DIAMCMLYI.DNALSMRALQ-----------EM
ITPR3_HUMAN/3-230---DRCVVE----------PAAGDLDNP-------------...PK.KFRDCLFKV.CPMNRYSAQK-----------QY
RY44_DROME/11-206---RHCFLE----------NIAD.KNVP-------------...P..DLSQCVFVI.EQALSVRALQ-----------EL
Q27J07_APLCA/1-225---DRSVVQ----------PDAGDLNNP-------------...PK.KFRDCLFKI.CPMNRYSAQK-----------QF
Q4DBL7_TRYCC/3-204---EDLFIR----------EKNDTDIDE-------------EPLPLLGFETSVFRIEAPASSLAAKA-----------QE
Q4QEZ2_LEIMA/11-201---APVGLQ----------RD.......-------------................TPETPLRHEH-----------TV
Q4RLR0_TETNG/15-213---RLCYLE----------PTSEAKYVP-------------...P..DLCICTFVL.EQSLSVRALQ-----------EM
Q4RY06_TETNG/4-165---DRCVVQ----------PDAGDLNNP-------------...PK.KFR.......APP...PEEQ-----------QV
Q57XB2_TRYB2/3-212---EGLFIR----------NKNELSDDA-------------EPLPLFGFETSVFQILPPTVAKVAAE-----------EG
Q5TQX0_ANOGA/7-234---DRVVVC----------PGAGDLNEP-------------...PE.KFRDCLIKI.CPMNRYSAQK-----------QF
Q66S77_OIKDI/1-221---DRCVTN----------SAAGSLQSP-------------...PI.KYRDCLFRI.CPPCRYSAHR-----------QY
Q8TA74_HEMPU/8-204---RNCVLE----------EASN.QNVP-------------...P..DLSICVFVL.NQALSVRALQ-----------EM
ITPR_ASTPE/4-229---DRCVVQ----------PDFGDLNNP-------------...PK.KFRDCLFKI.CPMNRYTAQK-----------QF
Q9Y0A1_CAEEL/78-317---DRCIVE----------LKDGRPESP-------------...PK.KFRDCLFKV.CPVNRYAAQK-----------HL

PF02815

RYR2_RABIT/226-406---DECLTV..........PSGEHGEE.----------------....QRRTVHY--EGGAVSVHAR-----------SL
Q6J9T9_ASPFM/358-545---QQITLY..........PHKDENNV.----------------...........--..........-----------..
RYR3_HUMAN/216-398---DECLTI..........PSTDQNDS.----------------....QHRRIFY--EAGGAGTRAR-----------SL
Q759J8_ASHGO/342-519---QQVTLY..........PHLDQNNH.----------------...........--..........-----------..
ITPR_ASTPE/231-419---EKFLTC..........DEYKKKSY.----------------...IFLRTTGR--VSATAATSSK-----------AL
Q6FL03_CANGA/354-530---QQITLY..........PFLDDNNK.----------------...........--..........-----------..
Q9GS15_CAEBR/327-562---QTFLTL..........DTIPKTNPP----------------KDVVFLRMTNR--PSAADATSSR-----------AL
PMT1_SCHPO/329-505---QIISLV..........DEPNQNAL.----------------...........--..........-----------..
Q91313_LITCT/214-394---DECLTI..........SSTDQGEE.----------------....QRRIPHY--EGGAVCSHAR-----------SL
Q7SH94_NEUCR/369-558---QQITLY..........PHKDDNNI.----------------...........--..........-----------..
O13054_MAKNI/219-399---DECLAI..........PGADQGDD.----------------....QRRVAHY--EGGAVCSHAR-----------SL
ITPR_DROME/239-453---EKFLTM..........DEYKKQYH.----------------...VFLRTTGR--TSATAATSSK-----------AL
Q6W3E4_RAT/232-432---EKFLTC..........DDYEKKQH.----------------...IFLRTTLR--QSATSATSSK-----------AL
ITPR1_HUMAN/232-433---EKFLTC..........DEHRKKQH.----------------...VFLRTTGR--QSATSATSSK-----------AL
Q6BFC5_PARTE/240-444---DVILLILFTIAQPHCHQRLNQKSEL----------------HIFFEQCTQSA--NYTKFVGNSN-----------GL
Q8TA74_HEMPU/220-400---DEYLTV..........PPVGCKDD.----------------...DNISEVSY--DTGAVAQYAR-----------SL
Q6FK90_CANGA/355-531---QQVTCY..........THEDVNNQ.----------------...........--..........-----------..
Q8MXI9_CAEEL/274-503---QTFLTL..........DTIPKQNPP----------------TDVVFLRMTNR--PSAADATSSR-----------AL
Q96WN5_EMEND/353-528---QQVTCY..........HHKDANND.----------------...........--..........-----------..
P91905_CAEEL/220-400---DECLTI..........PENWSEHP.----------------....QHNMVIY--EGGAAVTQAR-----------SL
O77089_PANAR/234-422---EKFLTM..........DEYKKKQH.----------------...VFLRTTGR--TTATAATSSK-----------AL
Q6CPY0_KLULA/347-524---QQVTLY..........SHLDANND.----------------...........--..........-----------..
Q6CAY4_YARLI/355-531---QQITTY..........HHKDANNE.----------------...........--..........-----------..
Q6C5U6_YARLI/339-516---QQVTLY..........PHSDQNND.----------------...........--..........-----------..
RY44_DROME/211-392---DECLTI..........PSTWGREA.----------------....GQNIVIY--EGGVVMAQAR-----------SL
RYR1_PIG/212-391---DECLTI..........SPAD.SDD.----------------....QRRLVYY--EGGSVCTHAR-----------SL
PMT5_YEAST/339-517---QQVTLY..........PHIDQNNK.----------------...........--..........-----------..
PMT1_CANAL/359-534---QQITLY..........PHLDSNNK.----------------...........--..........-----------..
PMT1_YEAST/343-520---QQSTLY..........PHMDANND.----------------...........--..........-----------..
ITPR3_RAT/233-432---EKFLTC..........DEYRGKLQ.----------------...VFLRTTLR--QSATSATSSN-----------AL

PF06268

FASC_STRPU/393-496---KAEVAC----------N---------------------R-----..----.-SNF.....--......-------DV
Q6AXQ1_RAT/24-138---KSTVTA----------T---------------------A-----KS----L-GRR.....--......-------QT
SING_DROME/33-147---GFKLNA----------N---------------------G-----AS----L-KKK.....--......-------QL
FSCN2_HUMAN/389-492---SNQLDT----------N---------------------R-----..----.-SVY.....--......-------DV
FSCN3_HUMAN/271-381---DGEVRA----------A---------------------S-----ER----L-NRM.....--......-------SL
FSCN1_HUMAN/268-378---GMDLSA----------N---------------------Q-----DE----E-TDQ.....--......-------ET
Q6PBS5_DANRE/19-131---GFKVNA----------S---------------------A-----PS----L-KKK.....--......-------QI
FASC_XENLA/382-483---TGTLDS----------N---------------------R-----..----.-SIY.....--......-------DV
FASC_STRPU/138-254---YAHLKT----------S---------------------E-----EG----E-DSVVVDEL--VPWGAD-------ST
FSCN2_HUMAN/20-133---GFKVNA----------S---------------------A-----PS----L-KRK.....--......-------QT
Q6AZJ6_XENLA/277-387---GVDLSA----------N---------------------Q-----DE----E-SDQ.....--......-------ET
Q6EEB3_PRODO/230-340---GMDLSA----------N---------------------Q-----DE----E-SDQ.....--......-------ET
FSCN2_HUMAN/141-254---YVHLCP----------R---------------------.-----ED----E-MAA..DGD--KPWGVD-------AL
FSCN1_HUMAN/391-493---TGTLDA----------N---------------------R-----..----.-SSY.....--......-------DV
FSCN2_HUMAN/266-376---GVNVSA----------N---------------------Q-----DD----E-LDH.....--......-------ET
Q6EE45_SCYCA/96-208---YAHLSA----------K---------------------.-----.D----E-LAI..DRD--TPWGVD-------SL
FSCN1_HUMAN/20-134---GFKVNA----------S---------------------A-----SS----L-KKK.....--......-------QI
Q6AZJ6_XENLA/152-265---YARLNG----------R---------------------.-----GD----E-LSV..ERD--VPWGVD-------SL
FASC_STRPU/16-130---GGKVNA----------S---------------------G-----AT----L-KAR.....--......-------QV
Q6AZJ6_XENLA/32-144---GFKINA----------S---------------------A-----SS----L-KKK.....--......-------QV
FSCN1_HUMAN/142-256---YAHLSA----------R---------------------P-----AD----E-IAV..DRD--VPWGVD-------SL
SING_DROME/155-270---FAHLSE----------S---------------------.-----QD----E-IHV..DAN--IPWGED-------TL
Q6PBS5_DANRE/139-252---YAHLAS----------P---------------------.-----EG----E-IAV..DCN--IPWGVD-------AL

PF06229

Q7QC94_ANOGA/71-260---LFTLGA----------P---------------------H-----NE----.-GDP---------PDPE-------EI
A7RWZ5_NEMVE/69-257---LFTAGE----------P---------------------R-----ED----G-VNS---------PAPV-------EV
Q15ER4_SCHMA/95-286---LVVIGP----------P---------------------R-----KY----.-GEP---------PAPE-------EI
A1D4G2_NEOFI/89-280---DAATAE----------P---------------------H-----DV----.-...---------...R-------QV
Q96MD3_HUMAN/4-156---LFTLGA----------P---------------------H-----KE----V-DEG---------PSPP-------EQ
Q2UKA8_ASPOR/84-274---DPGTAE----------P---------------------H-----DV----.-...---------...R-------QV
FRG1_DROME/72-260---LFTLGA----------P---------------------H-----NA----.-GDG---------PDPE-------EI
Q6DDA8_XENTR/66-254---LFTIGA----------P---------------------H-----KD----.-DDG---------PSPP-------EQ
FRG1_CAEEL/78-273---KFTIGF----------P---------------------H-----PE----.-GEG---------PNPE-------EI
Q0UA03_PHANO/83-265---DLGTAE----------P---------------------H-----DV----.-...---------...R-------QV
A2Q890_ASPNC/96-312---DPRTAE----------P---------------------H-----DV----.-...---------...R-------QV
Q566W5_DANRE/65-253---LFTVGS----------P---------------------H-----KE----.-DEG---------PDPP-------EQ
A6SI98_BOTFB/86-272---NPTTAE----------P---------------------H-----DV----.-...---------...R-------QV

PF04601

Q9LJJ2_ARATH/1-141---EESVSQ----------D---------------------R-----DG----R-SMN--------------------AR
Q9LQ43_ARATH/1-142---EESVTQ----------E---------------------R-----NG----S-AGA--------------------AK
Q9CAS3_ARATH/251-396---EEGVIM----------G---------------------K-----NG----S-SKE--------------------AR
O04559_ARATH/227-368---EETVTQ----------N---------------------R-----NG----S-TKN--------------------AR
O04559_ARATH/1-144---QETIRQ----------S---------------------R-----KG----D-ARR--------------------AV
Q9CAS2_ARATH/1-139---EETVTQ----------D---------------------R-----NG----S-DKR--------------------AR
Q9CAS3_ARATH/1-144---EKTVRQ----------S---------------------S-----DG----T-SRQ--------------------SL

PF00167

Q28XC7_DROPS/16-141---DRALHI----------N---------------------A.....HG....K-V...TAED--..ISLA-------QS
Q4S3V1_TETNG/61-182---GFFLRI----------K---------------------S.....DG....V-V.DGIREK--..SDPH-------IK
P91672_DROME/249-377---NRILQI----------L---------------------R.....DG....V-V.NGTQDE--..NSEF-------TI
Q8R5L5_RAT/84-205---GFHLQV----------P---------------------P.....DG....R-I.SGTHEE--...NPY-------SL
B1AK17_HUMAN/79-205---GYHLQL----------Q---------------------A.....DG....T-I.DGTKDE--..DSTY-------TL
FGF1_CHICK/25-148---GHFLRI----------L---------------------P.....DG....K-V.DGTRDR--..SDQH-------IQ
Q8I6J6_CIOIN/91-218---GYQLEV----------R---------------------K.....DG....K-V.TARHQS--...TKN-------GI
Q9YH31_NOTVI/72-193---GFHLQV----------L---------------------P.....DG....R-I.HGMHSE--...SRY-------SL
FGF16_MOUSE/61-187---GFHLEI----------F---------------------P.....NG....T-V.HGTRHD--..HSRF-------GI
Q5TLD5_DANRE/43-168---QWFLTI----------D---------------------E.....YG....N-I.TGTQDP--..NNCY-------SV
A1YJ27_NPVSF/70-196---HYLLRM----------N---------------------L.....VG....D-I.DGTKLE--..NSND-------TV
Q90XQ4_AMBME/55-181---GKHVQV----------L---------------------G.....NK....K-I.NAMADD--..GDSH-------AK
Q86GG2_CIOSA/55-180---SSRVQI----------L---------------------G......K....R-V.NAKGVR--..GNKY-------SK
Q8I6J7_CIOIN/133-264---HYFIEI----------K---------------------Q.....DG....K-V.RGSYNK--...SPQ-------TE
FG17_DANRE/53-178---GKHVQI----------R---------------------G......H....R-V.SATADD--..GNSY-------AR
Q9E225_9ABAC/33-160---HRYLSV----------A---------------------R.....NG....T-V.WGITNS--..TDSH-------SV
Q8I6J5_CIOIN/56-181---SNHIRI----------L---------------------G......K....K-V.DGRGRR--..GSNH-------AK
Q4SAA6_TETNG/81-202---GFHLQV----------L---------------------P.....DG....T-V.SGAHSE--...SPH-------SL
Q2NP32_NPVHC/29-154---NRFLAV----------R---------------------P.....DG....V-V.NGTNDA--..SDLD-------IV
Q4RWE4_TETNG/71-205---GYYLQM----------N---------------------P.....DG....S-L.DGTKDD--..SSNS-------SL
FGF1_NOTVI/2-125---GYFLRI----------F---------------------P.....DG....K-V.DGTRDR--..SDPY-------IQ
Q544I6_MOUSE/65-189---QWYLRI----------D---------------------K.....RG....K-V.KGTQEM--..KNSY-------NI
Q8VI79_RAT/32-156---HFFLRV----------D---------------------P.....GG....R-V.QGTRWR--..HGQD-------SI
A3EXK2_NEMVE/57-180---LDHIRI----------L---------------------K.....NR....R-V.DAKGRD--..GDQY-------AK
Q4RSP6_TETNG/17-145---KFFLRI----------D---------------------K.....NG....Q-V.NGTKSK--..DDPL-------SI
FGFH_NPVOP/29-156---NRYLAV----------R---------------------S.....DG....T-V.GGTTYA--..SSLD-------TV
Q5M7N7_XENTR/65-189---QWYLWI----------D---------------------K.....RG....N-V.KGTQDP--..NNSF-------SI
FGF1_XENLA/25-148---GYFLRI----------L---------------------P.....EG....V-V.DGTRDR--..NDLY-------IT
O92401_NPVBM/28-154---RRFLAV----------N---------------------P.....NG....T-VYGGTIES--..DNAD-------TT
A6Y7S4_DIDAL/29-153---GFFLRI----------H---------------------P.....DG....R-V.DGIREK--..SDPN-------IK
Q66IF7_XENTR/61-197---KYHLQI----------H---------------------L.....NG....K-I.NGTLEK--..NSVF-------SI
Q4T869_TETNG/30-155---GQHVQI----------Q---------------------G......R....R-V.TATAAD--..GSPH-------AR
Q91BB2_NPVST/26-158---NQYIAV----------D---------------------G.....NG....D-V.MGSRDR--..TASR-------TV
Q9N1B9_SHEEP/84-207---KYFLKI----------E---------------------......NG....K-V.SGTKKE--..NCPY-------SI
A7RZP2_NEMVE/41-163---RGHLRI----------F---------------------N......R....Q-I.DAEGKD--..GDPY-------AK
LE756_CAEEL/72-207---GTWLEM----------L---------------------PIENPDDGSTRVK-V.HGTKEE--..SSKF-------SI
Q8R5L6_RAT/78-192---GFHLQV----------L---------------------P.....DG....R-I.GGVPRG--...H..-------..
Q8T8A3_CIOSA/159-283---GYNIQI----------L---------------------P.....NG....R-I.SGTQES--..HSEY-------AV
A7YT71_DANRE/25-149---GFHLRI----------L---------------------P.....SG....T-V.DASRQD--..NDIN-------TL
Q4SCS5_TETNG/71-197---GYYLQM----------Q---------------------P.....DG....T-M.DSTRDE--..NSSF-------SQ
A7SH09_NEMVE/102-230---GFHLVM----------L---------------------P.....GG....T-L.KGSLSA--NITSMY-------GL
FGF1_DANRE/17-138---GFHLQI----------L---------------------A.....DG....T-V.AGAADE--...NTY-------SI
Q287N3_NPVAS/32-156---HWFLQM----------N---------------------T.....DG....I-I.NGSSTN--..DPEQ-------TL
Q80LI4_NPVAH/49-164---......----------.---------------------......NG....T-L.RGIQND--PIANDG-------IY
Q5TKR7_DANRE/53-179---GKHVQV----------L---------------------G......K....K-I.TAMGED--..GDKY-------AQ
Q8QLI3_9ABAC/34-158---HHLLRM----------N---------------------L.....DG....I-V.NGTQTG--..ESSE-------TV
Q2LGG1_DANRE/81-202---GFHLQV----------L---------------------P.....DG....R-I.NGVHNE--...NQY-------SL
FGF18_MOUSE/53-178---GKHIQV----------L---------------------G......R....R-I.SARGED--..GDKY-------AQ
Q9J897_9ABAC/33-159---HYFLQM----------N---------------------A.....DG....V-V.DGALTD--..ASNQ-------TI
Q0PV85_HALRO/186-312---GYHLQI----------L---------------------P.....RG....Q-V.MGTRKD--..HSRY-------AI
Q1LXT4_DANRE/17-141---KFFLCI----------D---------------------K.....TG....K-V.DGTRRK--..NYAD-------SL
Q1HGX9_NPVAP/32-158---HRYLAV----------R---------------------P.....NG....I-V.EGTSDA--..LSAD-------TV
Q4SFA3_TETNG/9-140---GFHIQV----------L---------------------P.....DG....K-I.TGAHNE--...NKY-------SL
Q9DFC9_DANRE/67-188---GFHLQV----------L---------------------P.....GG....K-I.TGVHNE--...NRY-------SL
A5PM81_DANRE/55-181---GFYLQM----------Q---------------------P.....DG....S-I.DGIKDE--..NSDY-------TL
A7SRV3_NEMVE/407-534---GRFLAM----------N---------------------E.....NG....T-I.SGTLSQ--...GVN-------ET
Q8NF90_HUMAN/87-216---GFHLQI----------Y---------------------P.....DG....K-V.NGSHEA--...NML-------SV
FGF11_HUMAN/71-197---GFYLQA----------N---------------------P.....DG....S-I.QGTPED--..TSSF-------TH
Q0KJ02_ORYLA/70-196---GFHLEI----------H---------------------P.....DG....T-V.QGTRRD--..HSRF-------GI
FGF4B_XENLA/68-189---GFHIQV----------L---------------------P.....DG....R-I.NGMHNE--...NRY-------SL
A7RFG7_NEMVE/73-195---KFVIMI----------D---------------------R.....KG....A-V.RGTTDI--..YSRY-------AL
Q4VBV7_DANRE/72-196---KFFLRI----------D---------------------K.....NG....K-V.NGTKSK--..DDPY-------ST
FGF3_DANRE/62-204---KYHLQI----------H---------------------P.....NG....K-I.DGSLEE--..NNPL-------SI
Q4SJV9_TETNG/17-140---GHHLQI----------L---------------------P.....DG....T-V.RGLRDD--..GDAH-------TI
Q6VTW1_NPVCD/28-157---NRYLAV----------H---------------------T.....DG....V-V.NGTLYP--..YSLN-------TV
Q8QG59_AMBME/67-191---NYFLKI----------D---------------------A.....DG....K-V.SGTTKV--..DCPY-------SV
Q3YAG3_STRPU/203-330---NFRLAV----------H---------------------E.....DG....T-I.NGTRDN--..MDVY-------AS
FGF17_RAT/53-178---GKHVQV----------T---------------------G......R....R-I.SATAED--..GNKF-------AK
A7SHR3_NEMVE/45-169---KWYLRV----------A---------------------G.....SK....I-D.ARSKTT--..DDPN-------AV
Q5TLE2_DANRE/41-170---GFHLQI----------H---------------------I.....DG....R-V.NGSHEP--...DSL-------SV
Q6E7C8_OIKDI/1583-1704---GHFMDV----------N---------------------A.....KG....R-V.RQTNNH--..NRLT-------SL
Q9PVY1_XENLA/62-188---GFHLQI----------L---------------------P.....DG....N-V.QGTRQD--..HSRF-------GI
Q8JMA6_9ABAC/35-159---HHFLRM----------N---------------------L.....DK....T-V.NGSQVG--..DSNE-------TV
Q1XG75_DANRE/59-183---KFFLRI----------G---------------------K.....DG....K-V.NGTKSE--..DDPY-------SI
Q0IIQ7_DANRE/50-175---GKHVQI----------L---------------------G......K....K-I.NANGDD--..GGKY-------AL
A7T359_NEMVE/53-177---GKFVRI----------H---------------------S......A....H-A.DGAGNR--..QENK-------AK
Q5GAD8_9VIRU/23-148---NFMLEV----------.---------------------......NG...TA-V.SGGTNK--..QSQT-------AK

PF00340

IL1B_BOVIN/144-261---VFCMSF----------V---------------------Q-----GE----E-RDNKIPVA..LGIKDK-------NL
IL1RA_MOUSE/61-174---KIDMVP----------I---------------------D-----..----.-.....LHSVFLGIHGG-------KL
IL1RA_HUMAN/60-173---KIDVVP----------I---------------------E-----..----.-.....PHALFLGIHGG-------KM
IL1B_FELCA/146-263---VFRMSF----------V---------------------H-----GE----E-NSKKIPVV..LCIKKN-------NL
Q9GL09_SHEEP/72-185---IFIIYM----------Y---------------------K-----.D----S-LTRGLAVT..ISVQCK-------KM
IL1A_MOUSE/158-269---KFDMYA----------Y---------------------S-----SG----G-DDSKYPVT..LKISDS-------QL
Q96KJ8_HUMAN/72-185---IFIISM----------Y---------------------K-----.D----S-QPRGMAVT..ISVKCE-------KI
IL1B_CERAT/147-264---VFSMSF----------V---------------------Q-----GE----E-SNDKVPVA..LGLKAK-------NL
Q9I8D2_CHICK/66-187---YFDIHC----------Y---------------------K-----TT----A-PSAGMPVAFSVQVEDK-------SY
IL1B_PIG/145-262---VFCMSF----------V---------------------Q-----GD----D-SNNKIPVT..LGIKGK-------NL
IL1B_MOUSE/148-264---IFSMSF----------V---------------------Q-----GE----P-SNDKIPVA..LGLKGK-------NL
IL1A_RABIT/156-266---KFDMGV----------Y---------------------M-----TS----.-EDSILPVT..LRISQT-------PL
IL1A_BOVIN/156-265---KFDMVA----------Y---------------------V-----SE----.-EDSQLPVT..LRISKT-------QL
Q91Z66_SIGHI/73-186---RLIIYM----------Y---------------------K-----TD----F-NPGGLPVT..LSVRDR-------TM
IL1A_CERAT/155-266---KFDMGA----------Y---------------------T-----SS----K-DDTKVPVI..LRISKT-------QL
IL1RA_RABIT/60-173---RIDVVP----------L---------------------E-----..----.-.....PQLLFLGIQRG-------KL

PF05270

OTOG_MOUSE/1241-1384---....AA----------G---------------------G-----TL----V-ATKAVDSDIA.LVRAEDLAPGDISS
ABFB_ASPOR/358-502---TRYLAH----------D---------------------G-----ST----V-NTQVVSSSSTTALRQQ.......AS
Q82P18_STRAW/329-465---TRYWQE----------Q---------------------S-----SL----L-NLPVVSSAASSAEKAA.......SA
Q829S7_STRAW/176-312---DRYWHL----------G---------------------G-----DT----G-RLDPVSSGSSATTRQD.......AT
Q55841_SYNY3/35-174---QRYIRH----------R---------------------N-----YL----G-YIEPVKTSLD...ELD.......SS
Q9HEY2_COCCA/355-499---DRYLAH----------S---------------------G-----AT----V-NTQVVSSSSTALLKRQ.......AS
Q86ZN9_FUSOX/351-495---DRYLTH----------S---------------------D-----ST----V-NTQVVSSSSATALKQS.......AS
Q82P90_STRAW/346-481---DRYIRH----------W---------------------D-----FR----A-RIEANVTNLA.....D.......SQ
ABFB_EMENI/357-506---TRYIAH----------T---------------------G-----ST----I-NTQVVSSSSSSTLKQQ.......AS
ABF1_HYPJE/352-496---TRYIAH----------S---------------------G-----ST----V-NTQVVSSSSATALKQQ.......AS
ABFB_ASPKW/350-494---TRYIAH----------T---------------------D-----TT----V-NTQVVDDDSSTTLKEE.......AS

PF00197

IT2_PSOTE/2-176---TYYLVP----------Q----LRPG-------------G-----GG....M-EAAKVGNEDCPL-TVV-------KS
IAAS_ORYSJ/26-193---SYYVLP----------A----SPGH-------------G-----GG....L-TMAPRV.LPCPL-LVA-------QE
MIRA_RICDU/35-216---NYYIVP----------V----LRDH-------------G-----GG.LTVS-ATTPNGTFVCPP-RVV-------QT
ALB1_PSOTE/4-171---KYTIVS----------F----SDGA-------------G-----ID....V-VATGNENPEDPL-SIV-------KS
ASP_THECC/30-208---QYYVLS----------S----ISGA-------------G-----GGGLALG-RATGQS...CPE-IVV-------QR
IAAS_HORVU/27-199---NYYVLS----------A----NRAH-------------G-----GG....L-TMAPGHGRHCPL-FVS-------QD
API8_SOLTU/39-219---SYRIIS----------I----GRGA-------------L-----GGDVYLG-KSPNSDAP.CPD-GVF-------RY
ICW3_PSOTE/27-198---TYYLLP----------H----IWAH-------------G-----GG....I-ETAKTGNEPCPL-TVV-------RS
IDE3_ERYCA/1-168---TYYLLP----------Q----VWAQ-------------G-----GG....V-QLAKTGEETCPL-TVV-------QS
IECI_ERYVA/2-173---TYYLLP----------H----IWAL-------------G-----GG....I-EAARTGKETCPL-TVV-------QS
IT1A_PSOTE/2-168---TYYLLP----------D----RWAL-------------G-----GG....I-EAAATGTETCPL-TVV-------RS
ITRA_SOYBN/26-199---TYYILS----------D----ITAF-------------G-----G.....I-RAAPTGNERCPL-TVV-------QS
ITRY_ACACO/2-171---AYYILP----------A----LRGK-------------G-----GG....L-TLAKTGDESCPL-TVV-------QA
KTI1_SOYBN/27-197---TYYMLP----------V----MRGK-------------G-----GG....I-EVDSTGKEICPL-TVV-------QS
CPI1_SOLTU/47-221---RYIINN----------P----LLGA-------------G-----AV....Y-LYNIGN.LQCPN-AVL-------QH
SPOR1_IPOBA/42-216---NYYMVS----------A----IWGA-------------G-----GGGLRLA-HLDMMSK..CAT-DVI-------VS
GWIN3_POPSP/32-195---SYLIDQ----------E----DFRV-------------V-----N......-...ATINPICNS-DVI-------LS

PF07951

BXB_CLOBO/1075-1291---EYYMFN----------A----GNKNSYIKLKKDSPV..G-----EIL....-....TRSKYNQN.SKY-------IN
BXE_CLOBU/1063-1250---EYYLLN----------V----LKPNNFI.....NRR..T-----DST...L-SINNIR.....S.TIL-------LA
TETX_CLOTE/1105-1314---EYYLIP----------V----ASSSKDV.....QLKNIT-----DYM...Y-LTNAPSYTNGKL.NIY-------..
BXA1_CLOBO/1088-1293---PYYMLN----------L----YDPNKYV.....DVN..N-----VGIRGYM-YLKGPRGSVMTT.NIY-------LN
BXG_CLOBO/1083-1297---QYYLFN----------Q----GMQNIYI.....KYF..S-----K.....A-SMGETAPR.TNFNNAA-------IN
BXC1_CLOBO/1089-1291---EYYMVN----------I----DYLNRYM.....YAN..S-----RQI....-..........VF.NTR-------RN
Q45851_9CLOT/1072-1268---KYYLLN----------L----LKPNMSV.....TKN..S-----D.I...L-NINRQRGIYSKT.NIF-------SN
Q45967_CLOBO/1085-1285---EYYMIN----------V----NYMNRYM.....SKK..G-----NGI....-..........VF.NTR-------KN
BXF_CLOBO/1083-1274---KYYLFN----------L----LRKDKYI.....TLN..S-----G.I...L-NINQQRGV.TEG.SVF-------LN
BXD_CLOBO/1076-1276---EYYIIN----------D----NYIDRYI.....APE..S-----NVL....-..........VL.VQY-------PD

PF14200

C6I1A8_9BACE/97-198...ELGIDN----------S--G.NG.S-------------K-----ECPVIQW.DPNK.....ENP-N---------QQ
A8NAT6_COPC7/44-145...RVHVTY----------P--Q.APPA-------------E-----GEFPTLE...SG......SA-P---------QK
A8P1Y0_COPC7/90-188...GQYLSI----------A--G.PP.A-------------N-----GTKLVLS...........AA-A---------FE
A8PCJ2_COPC7/37-137...GGYLAI----------V--D.GAPG-------------D-----GVDAVHW...........ED-P---------FA
A1Z5I4_BEABA/43-129...NLYLTF----------K--N.LQPE-------------S-----.TATQEG.YC........GD-G---------QR
A6EHX4_9SPHI/63-161...KSSIDN----------G--N.RPDD-------------E-----MTLMLQW.TASK.....ENP-N---------QQ
A6ERL3_9BACT/65-184...ANYLEV----------S--SFEVGK-------------N-----GGKVQMW.GFNGGSSSSTGA-N---------QV
A6G9W3_9DELT/412-502...GRYLDG----------D--G.TATL-------------V-----GTSSSA............AS-D---------DE
A6G9W3_9DELT/550-640...GRWLDG----------D--G.AG..-------------.-----.NRVGTS.SSP.......AA-D---------DV
A7EWX9_SCLS1/45-151...GYFLTA----------T--K.ENHI-------------V-----STPQI...SP.......TDP-S---------AR
A7WK54_LYSSH/385-485...NLVLSA----------D--S....P-------------R-----TNNVFGY.PFSN......FD-S---------QH
A8NDJ7_COPC7/40-145...GLNLGF----------D--V.GRIA-------------E-----NGTLTIG.T.........AA-E---------FL
A8NDJ7_COPC7/189-287...GHYLSI----------S--G..TAK-------------E-----GTRIIGS.PTP.........-.---------FV
A9E912_9FLAO/86-187...NKVLDI----------R--G.GSQE-------------N-----NAVLQMW.DQAN......VE-N---------QK
B0DSD3_LACBS/40-138...GRYLAI----------Q--G.EASD-------------N-----ASVVGST.NPFG........-.---------..
B0MJQ2_9FIRM/249-352...NQALDV----------K--G.CSAE-------------P-----EANVQTY.ESND......TD-A---------QR
B1VUB2_STRGG/50-155...GKRLDV----------A--G.AATE-------------N-----GTRIQQW.KANN......FG-A---------QE
B2WIQ5_PYRTR/45-143...GLYLAC----------D--......-------------.-----...VQLR.APL.......DA-S---------IR
B2ZRS9_CLINE/46-144...QSYVRV----------R--D.DNLV-------------D-----GAALVGS.QQP.........-.---------TP
B3C971_9BACE/378-483...NRALAA----------T--A.....-------------.-----GAEIMTV.PEF.T....GAP-E---------QL
B3PKR2_CELJU/520-621...SACMQV----------S--G.SSTS-------------A-----GTSLVQG.SCSG.......N-A---------AQ
B4V2C9_9ACTO/39-139...GKRLDV----------A--N.ASTD-------------S-----GTRMQVW.KANA......FG-A---------QE
B4V8E2_9ACTO/575-676...GRALAV----------A--D.GA..-------------.-----...LTLL.PPGP......SA-Q---------QQ
B5GTM6_STRCL/44-154...GKVLDN----------P--A.AA..-------------D-----.RGIRQG.DAAA.....GKK-S---------QQ
B6SS31_MAIZE/56-169...GLAIKH----------S--L.GQ..-------------.-----SHPVKLA.PFSPD...QEDA-S---------VL
B8P008_POSPM/56-152...GTYVVA----------P--V.HAVN-------------Q-----G.IVGGM.PP..........-.---------DT
B8P2U3_POSPM/41-134...GTYVLA----------P--V.HAIN-------------Q-----G..IVG.....G......TP-P---------DV
B8PDH6_POSPM/53-148...GTYARA----------P--D.HI..-------------I-----GGQVVG...........SNV-S---------ET
C0PSY5_PICSI/62-180...GQALRH----------.--G.RSEK-------------D-----KVTLGPY.HPDD.....LNE-A---------VL
C3I9T1_BACTU/507-614...GLVMAW----------N--D.YG..-------------D-----GWNVFGT.PFER.....DKD-E---------HY
C4LYE8_ENTHI/157-265...QKYLGR----------K--H.NKTK-------------P-----GTKVTQT.N..GI...ESLE-E---------NH
C4M3J3_ENTHI/137-243...GKFLGR----------E--D.GKNY-------------F-----GVNVCQT.NANP.....NDE-T---------NH
D9STT7_CLOC7/601-707...SKVIDI----------P--G.ASTD-------------N-----GVQLQIW.GGTA.....GAD-W---------QQ
C6D9K8_PECCP/404-505...GKYIDI----------A--S.SAND-------------E-----GAQIIQM.YNTG......HF-S---------QQ
C6L2F6_APOCT/307-416...NLLLSW----------D--S.NANP-------------K-----EMILRGY.TVSG......SN-N---------QY
C6L2F6_APOCT/611-715...ALWLSW----------D--S.NAAS-------------K-----EILLRAY.TESG......SL-N---------QY
C7PHL4_CHIPD/338-435...KNTMTL----------A--W.DTYY-------------S-----QDTLRQA.AFSG......DD-N---------QQ
C9YYM1_STRSW/484-581...GRAASV----------W--T.GSAT-------------A-----GQRIGQW.VDD.......SA-A---------GT
D1BKB8_SANKS/626-731...GRVLGA----------T--P.SGVA-------------L-----KTQSVA..DAL.......AD-P---------SS
D1Q0S6_9BACT/375-479...TRCLTA----------T--A.GH..-------------.-----..DVVAKPEFTG......ED-A---------QL
D2QTB1_SPILD/373-478...DRALAA----------.--....TT-------------D-----AEVITVP.AFTG......TP-E---------QL
D2S061_HALTV/623-726...GLALET----------A--D.GGTD-------------T-----GTNLELG.AWED......AD-H---------QK
D2VXQ3_NAEGR/45-151...GKYVCA----------D--N.GYMN-------------E-----GVSIIQW.DNPA......WK-N---------YQ
D3Q6V6_STANL/130-238DNWNACLTA----------D--K.PADE-------------M-----GYLFAGQ.DCGKK...DNKD-L---------QT
D4J5M3_9FIRM/492-590...GLYLSA----------A--G.QRGS-------------S-----GTNVEQS.SS..........-A---------TL
D4J5M3_9FIRM/739-837...GLYLSV----------K--G.QGSA-------------S-----GSNVELS.SS..........-A---------TQ
Q8A5P7_BACTN/65-167...QMNVDN----------S--G.KGK.-------------V-----ECSVIQW.SADP.....KNP-N---------QQ
Q8X123_9AGAR/44-154...GTYMDL----------Y--N.GSSE-------------A-----GTAVNGW.QGTAF...TTNP-H---------QL
Q9L153_STRCO/584-686...GTRLAV----------R--D.D...-------------.-----.VPVAE..PDTGR....RDR-A---------AE

PF00652

GALT3_MOUSE/505-627---PLCLDV----------G...-ENNQ-------------G-----GKPLILY-TCHG.....LGG-N..-------QY
CRBG3_HUMAN/888-1017---GEYLTV----------TG.S-LADT-------------R-----ATSVCIS-PYSG......KN-T..-------QI
GLT10_CAEEL/536-662---NFCIDT----------Q...-.FKE-------------Q-----NQRFGLR-KCTSDD.KDGGG-E..-------QD
CUPF_DICDI/32-142---PYYLST----------S...-....-------------.-----....NTF-QCVA.....SES-I..-------QT
Q7QIK5_ANOGA/491-617---NLCLDT----------L..Q-QNAD-------------K-----PWNLGIY-TCFKP...EVSA-S..-------QL
Q7PZM5_ANOGA/438-564---RLCLDS----------L...-.NHQ-------------A-----KEPIGLY-ACAFNK.THPQN-N..-------QF
Q7Q0E9_ANOGA/461-587---ALCVDT----------L...-.NHG-------------E-----KQTIGLY-SCAEDK.KQPQP-N..-------QF
Q7QDR0_ANOGA/437-565---SLCIDT----------M...-.QRG-------------R-----GEPIGLY-PCSNSLIEPTNH-N..-------QY
ML1_VISAL/440-560---DLCMES----------N...-....-------------.-----GGSVWVE-TCVI.....SQQ-N..-------QR
O96048_LUMTE/132-255---GKVLDI----------E..G-QNPA-------------P-----GSKIITW-DQKK.....GPT-AVN-------QL
GALT7_CAEEL/478-592---GKCLDR----------M...-..GG-------------I-----PGPMGAT-GCHG.....YGG-N..-------QL
GLTL2_HUMAN/505-628---GLCADC----------Q..A-EGDI-------------L-----GCPMVLA-PCSD.....SRQ-Q..-------QY
GLT13_DROME/435-548---DRCVHA----------R...-...Q-------------K-----DSQPILA-SCYL.....SDI-T..-------Q.
Q7NQK0_CHRVO/5-133---NTTLGI----------AAND-S..I-------------S-----GSQLSLK-PIQG........-...-------NF
GALT4_CAEEL/461-580---NLCLDS----------M...-.ARK-------------E-----SEAPGLF-GCHG.....TGG-N..-------QE
Q8W2E8_IRIHO/447-569---GLCMQR----------N...-....-------------D-----QEDVGLV-TCDD.....NNS-N..-------QK
Q9SLV9_CUCSA/35-159---GLCLEM----------SPWY-KPAG-------------I-----NFPTRLS-PCDE.....KKQ-T..-------QL
AGALA_ASPNG/424-536---GNCLTA----------A...-....-------------S-----NSSVAFQ-SCNG......ET-S..-------QI
GALT1_MOUSE/430-548---NQCLDN----------M...-.ARK-------------E-----NEKVGIF-NCHG.....MGG-N..-------QV
GALT3_DROME/512-658---DKCLRP----------LKED-VPRS-------------S-----LSAVTVG-DCTS......HA-QSM-------DM
Q7Y0V1_9FABA/7-131---GMCLDV----------S..N-NVYN-------------N-----GNPIIMW-KCKD......QL-EEN-------QL
GLT12_MOUSE/440-569---GYCLDY----------NPPN-ENHV-------------E-----GHQVLLY-LCHG.....MGQ-N..-------QF
Q9ADL1_SORCE/171-307---GLCVDV----------DA.A-VITA-------------D-----DVVLQLW-DCNG......GT-N..-------QQ
Q8C2S1_MOUSE/660-788---GLFMST----------N...-GNLE-------------D-----LKLLRVQ-VMED......VG-ADD-------QI
Q9X583_9ACTO/367-502---GRVLDE----------P..A-GQND-------------N-----GTPLQVW-DASG......AS-N..-------QQ
GALT9_MACFA/467-595---GYCLDQ----------G...-..AE-------------D-----GDRAILY-PCHG......MS-S..-------QL
Q8KKH3_BACCI/270-405---GKVMDV----------V..D-VSTA-------------R-----GAKIQQW-TNYV......AN-N..-------QR
GALT5_HUMAN/810-932---GKCISI----------E...-....-------------.-----NTTVILE-DCDG.....SKE-L..-------QQ
Q7SBD7_NEUCR/100-230---QACFSY----------D...-PRRA-------------A-----GNQVILF-SCGGRADGGGEV-TDS-------QI
O04071_SAMNI/439-558---QMCLRA----------N...-...T-------------Q-----NNPLWLE-DCVL.....NRR-E..-------QM
Q9HFA9_9TREE/43-172---GLCVDV----------A..G-ANFA-------------N-----GTPVQVY-ECNG......SN-A..-------QS
Q9EWL6_STRCO/70-209---GKCLTV----------R..G-ASKA-------------E-----NAVVNQY-RCVS.....GAK-N..-------QW
Q824Z7_STRAW/111-218---LKCLDG----------S...-....-------------.-----SRGIRLL-KCND......SK-Y..-------QR
Q9HFB1_9ASCO/416-528---MKCLTD----------D...-....-------------E-----SGQVSFK-ACDG......SD-G..-------QT
Y1454_MYCBO/33-153---DVCLDA----------P...-.SGS-------------W-----FSPLVIN-PCNG........-TDF-------QR
Q6TBQ9_CRYPV/535-659---NICLDS----------M...-GGQT-------------D-----GDKIGVF-HCHG.....KKG-T..-------QA
Q825I1_STRAW/713-838---GLCIGI----------G..K-NKAV-------------A-----GAEAVLV-DCTS......SA-T..-------QR
Q7TLZ3_9ZZZZ/377-504---GKCLDV----------P..G-LATT-------------A-----GTQLDIW-TCNG......GT-N..-------QI
Q7X2C9_STRTE/266-386---GRCLDV----------P..N-ASTT-------------D-----GTGVQLY-DCHS......NS-N..-------QQ
GALT9_DROME/521-640---RTCLDA----------P..A-GKKH-------------Q-----KKAVGTY-PCHR.....QGG-N..-------QY
GLT10_DROME/483-615---GFCVDS----------L...-.NCR-------------H-----TKPVVLA-RCTGHNSMPGEH-...-------QN
Q825L5_STRAW/296-417---GKCVDV----------A..G-SSSA-------------N-----GAPVQLY-DCNG......TT-A..-------QK
Q6BE06_BACTU/699-826---EFCMGI----------G...-..LT-------------T-----RCGVNLW-SNNG........-NTL-------QK
ENVE_SALTY/53-170---GLCLDA----------G...-..PD-------------Q-----QNRLTLR-ECKH......VQ-S..-------QL
Q6YBY0_TOXGO/500-612---GMCLDN----------M...-GWAS-------------P-----GHAVGLE-YCHG......GD-T..-------QT
O86669_STRCO/329-444---AQCLSA----------A...-AGPP-------------G-----LGEVSIR-SCDG......SA-S..-------QK
FLVS_FLAME/296-437---DKNIDI----------T..G-SSTA-------------D-----GTDVILY-SATT......GN-N..-------QK
Q8RTY5_9GAMM/861-988---GLCISA----------P...-EQAQ-------------S-----GSLVNLD-NCSN......RQ-G..-------QK
Q7VN40_HAEDU/61-177---GECLDQ----------S...-..RS-------------N-----YKGIISY-RCHG......GD-N..-------QR
GLTL3_HUMAN/465-591---DVCLDQ----------G...-..PL-------------E-----NHTAILY-PCHG......WG-P..-------QL
Q82LA2_STRAW/332-460---AKCADV----------P..S-QSLL-------------T-----GVALTQY-TCNG......GN-N..-------QK
GALT3_CAEEL/484-604---EKCVDT----------N...-.GKK-------------D-----GQAPGIQ-ACHG.....AGG-N..-------QA
GLTL1_HUMAN/431-552---VNCLES----------Q..G-QNTA-------------G-----DFLLGMG-ICRGSAKNPQPA-...-------QA
Q825H7_STRAW/402-529---DLCLDV----------R..G-EA.K-------------A-----GAGTKLA-VCSS......AW-T..-------QQ
GALT7_DROME/467-582---DGCLDS----------M...-.GHQ-------------P-----PAIMGLT-YCHG.....GGN-N..-------QL
Q8VUT1_9PSED/305-438---GKCIDL----------A..S-GSSA-------------N-----GANIQQW-ACGT.....NNA-N..-------QK
Q70US9_ADEVO/400-521---DLCLET----------N...-....-------------.-----GNGVWLA-NCVK.....GKA-Q..-------QR
GALT8_DROME/446-570---KLCLDR----------K...-..DP-------------S-----HGQPKLA-PCSSDHVFPSPE-...-------QY
Q9K438_STRCO/427-551---GKCLDV----------D..T-NTSR-------------N-----GNAAQLW-DCST......AT-G..-------QR
Q7SIF1_TRIKI/2-122---GFCADV----------N...-GEGQ-------------N-----GAAIILK-KCAE......ND-N..-------QL
GALT4_MOUSE/444-574---SECLDY----------NA.P-DNNP-------------T-----GANLSLF-GCHG.....QGG-N..-------QF
GALT4_DROME/511-641---VYCLDN----------M...-.GKS-------------T-----EEAVGMF-SCADNRTHPQPN-...-------QF
GALT6_CAEEL/475-606---SVCLAW----------T...-LRSS-------------G-----IKTASTA-DCLKI....FHK-T..-------QL
GLT11_CAEEL/482-602---THCLSA----------ENSQ-GRIA-------------N-----GNRVEMR-KCNH.....MER-M..-------QQ
Q8GB62_9GAMM/313-450---NLCLDV----------K..S-GALW-------------N-----GSTYQQW-SCNT.....GNN-N..-------QR
Q6BE03_BACTU/674-805---SSVVDM----------D..P-GTWG-------------T-----RHNVHLW-QNNN......TN-N..-------QK
O68641_CELCE/306-433---GMCVDV----------P..W-ADPT-------------D-----GNPVQIV-TCSG......NA-A..-------QT
Q8RTY5_9GAMM/724-853---DKCMDI----------PGNG-SDMV-------------N-----GTDVILY-DCER.......D-AWD-------QR
Q9RDQ1_STRCO/383-509---DKCLEV----------A..G-NSKA-------------D-----GAVVQMY-TCNG......GA-N..-------QK
Q9SLV9_CUCSA/165-289---NLCLQS----------T...-...D-------------D-----SSHVGLN-GCNT.....DNK-Y..-------QR
GLT11_DROME/425-535---HFCLSI----------K...-....-------------.-----GGFPVIR-KCHS......TN-F..-------ED
Q9L0N4_STRCO/326-472---HMCADI----------PG.R-DKGK-------------I-----NGIVQQA-NCHE.....EGD-N..-------EF
GALT7_MOUSE/533-649---AYCIDS----------M...-.GKT-------------N-----GGFVELG-PCHR.....MGG-N..-------QL
GALT2_DROME/507-627---TECLDT----------M...-.GHL-------------I-----DGTVGIF-PCHN.....TGG-N..-------QE
GLT10_HUMAN/459-587---GLCADT----------K...-.HGA-------------L-----GSPLRLE-GCVRGRGEAAWN-N.M-------QV
Q9K473_STRCO/837-959---GKCLDV----------D..G-AQTA-------------D-----GTGIQIW-TCNG......TG-A..-------QN
GLT12_DROME/433-546---KKCLTI----------N...-...A-------------K-----SQNLFLE-RCST.......N-NTL-------QN
GALT1_DROME/473-597---NICLDD----------L..L-QNNE-------------K-----PYNAGLY-PCGKV....LQK-S..-------QL
AHV_ACTSK/47-157---GRLLDS----------N...-....-------------Y-----NGNVYTL-PANG......GN-Y..-------QR
Q8LKQ3_VISAL/8-135---GLCLDV----------P..E-GDYH-------------D-----GSRIQLW-PCKS......NS-DQN-------QL
Q82HL7_STRAW/418-544---GLCLDI----------R..D-GVMD-------------L-----GTDVVTA-PCTS......SR-T..-------QR
GALT9_CAEEL/450-571---RMCTDT----------L..Q-RDEK-------------M-----SQLLGVF-HCQG......KG-SSP-------QL
O62004_BRAFL/490-604---DLVLQA----------S...-..GG-------------K-----GSEINVA-KRSY......PE-KKE-------QL
Q7NYA5_CHRVO/248-356---GQCLDA----------S...-GGVG-------------E-----GAAAITY-GCHG......GG-N..-------QA
O96048_LUMTE/2-124---GHALSD----------P...-...G-------------S-----HGAPVIV-NTRN......EN-DPR-------QL
Q86S91_9CILI/376-511---KKAVGV----------H..W-DSTD-------------N-----GANVHQW-TVNG......KT-S..-------EE
Q97TI2_CLOAB/443-579---QKYLQV----------A..S-NTGK-------------A-----GQNVELG-SGSG......AA-G..-------QK
O04071_SAMNI/311-434---GLCVDV----------R..D-GLAK-------------D-----GNPVQLL-SCGQ......QS-S..-------QQ
Q9ZBF7_STRCO/336-461---NRCIEV----------A..G-HKWR-------------D-----GAPLQIA-DCTG......KN-W..-------QK
Q868M7_CUCEC/115-242---GKCLDV----------E...-.GSD-------------G-----TGDIGVY-DCQN......LD-D..-------QY
GALT6_MOUSE/497-619---NQCLDV----------G...-ENNR-------------G-----GKPLIMY-VCHN.....LGG-N..-------QY
Q9EWL5_STRCO/41-182---GKCLTV----------Y..R-ASGA-------------D-----NANVNQY-QCVG......AR-N..-------QQ
Q82P89_STRAW/370-505---GKCLDV----------E..G-GNTA-------------D-----GTDIFQW-TCGG......GA-N..-------QK
Q7Y0V1_9FABA/137-258---DLCMEA----------H...-....-------------.-----GSNVWLA-DCDS.....NKE-E..-------QQ
GLT11_HUMAN/479-604---NKCLVA----------Q..G-RPSQ-------------K-----GGLVVLK-ACDY.....SDP-N..-------QI
GALT2_HUMAN/446-563---TNCLDT----------L...-.GHF-------------A-----DGVVGVY-ECHN.....AGG-N..-------QE
GLT14_MOUSE/420-545---QKCLES----------Q...-.KQK-------------K-----QEILRLS-PCAKVKGDGAKS-...-------QV

PF03498

Q46102_CAMJU/29-187---GIFLSA----------F----RDTS-------------K-----DPIDQNW-NIKEIVLSDELK-Q---------KD
Q6UPC3_ECOLX/79-232---GSVLTM----------W----SRGA-------------G-----SSL...W-AYYISDSNSFGE-L---------RN
Q7DK11_AGGAC/39-178---AQPIKN----------D----HYDS-------------H-----NYLSTHW-ELIDYKGKEYEK-L---------RD
Q9RFY4_HELHT/29-183---GDLLAP----------.----....-------------.-----DYRKPNW-NLKQVDLDEQIR-K---------SD
O32587_ECOLX/37-179---GLMLHN----------.----RLDL-------------H-----GREITGW-EVVPVKTPAEAL-V---------TD
CDTA_HELHP/86-226---GGLLTL----------W----ALKP-------------R-----NWV...W-GYTPIDSFEFGR-A---------KF
CDTA_HAEDU/77-221---GALLTV----------W----ALAK-------------R-----NWL...W-AYPNIYSQDFGN-I---------RN
Q6EZE1_ECOLX/49-197---GALLTI----------W----ARPV-------------R-----NWL...W-GYTPFDSVNFGE-N---------RN
CDTA_CAMJJ/115-260---GAALTV----------W----ALAQ-------------G-----NWI...W-GYTLIDSKGFGD-A---------RV
Q47090_ECOLX/44-187---GGIIRN----------.----.PVG-------------S-----DFNVNNW-VISEVKTNDLDL-I---------SA

PF05588

O06016_CLOBO/1-147---NYKIKS----------IFSDSLYLT-------------P-----LSEIITFLNTSS------EN-N---------QK
Q9LBT0_CLOBO/1-146---NYKIKS----------LFSNSLYLT-------------Y-----SSGALSFSNTSS------LD-N---------QK
Q45841_CLOBO/1-146---NYNIKS----------IFSGSLYLS-------------P-----VSGSLTFSNESS------AN-N---------QK

PF07468

Q38719_AMAHP/2-154IQQYGLLQF----------SADKILDPL-------------A-----QFEVEPS-KTYDGLVHIKSR-YTN-------KY
Q38719_AMAHP/159-299INQLPCLQF----------GYDNLNDPK-------------V-----AHQMFV.-.TSNGTICIKSN-YMN-------KF

PF08709

ITPR1_MOUSE/4-229W-------KA..AKPGANSTTDAVLLNKLHHAADLEKKQNETENRKLLGTVIQYGNVIQ.LLHLKSNKYLTVNKRL----
A7SEK1_NEMVE/3-227W-------KA..AKP.TTSATDAVLLKKLHHAAELEKKQNESEYKKMLSSVVQYGSVMQ.LLHVKSNKFLTVNKRL----
A8HAL5_DANRE/4-229W-------KAKQGKHGNNTQADLFK..KLQHAAELEQKQNDSENKKLLGEVVKYSRVIQ.LLHIKSNKYLTVNKRL----
O13054_MAKNI/9-216L-------SNT....SVDEAVDLD....KW.SSQGGGHRT...........LLYGHAIL.LKHTHSSMYLSCLTTS----
O77089_PANAR/5-231W-------KA..AKHSGNSTTDPSLLNRLHDAAKTEKRQNEAESKKLMGTVINYGITIQ.LLHLKSNKYLTVNKRL----
P91905_CAEEL/13-215M-------SADSDHKSASG...............AGGHKT...........LLYGHAVQ.LKHVQSEMYLACLSSC----
ITPR3_HUMAN/3-230W-------KAKQTKQDKEKIADVVLLQKLQHAAQMEQKQNDTENKKVHGDVVKYGSVIQ.LLHMKSNKYLTVNKRL----
RY44_DROME/11-206V-------TAA.GSETGKG..............TGSGHRT...........LLYGNAIL.LRHHNSDMYLACLSTS----
Q27J07_APLCA/1-225W-------KA..AKQ.PSSMPDSVLLQRLRHAAELEKKQNDVENKKLKGTVVQYSHVIQ.LLHVKSNKFLTVNKRL----
Q4DBL7_TRYCC/3-204A-------VADRFSNNNTLLME........HFSNINTAPE...........LMYGKPFL.LLHSVSQMCVAVFPSK----
Q4QEZ2_LEIMA/11-201L-------LLQRGDP...............AEANVNRQPD........SDVVKYGQTIR.LLHYAHQKYLSYHAER----
Q4RLR0_TETNG/15-213L-------ANS..GQNSEG............AAHSGGHKT...........LLYGHAIL.LRHSFSSMYLACLKTS----
Q4RY06_TETNG/4-165P-------DGEQASS...............RPAGEERHEGDAGHSRKRRLLVLHPTLLQTALHWRQR.........----
Q57XB2_TRYB2/3-212L-------SKGNRAPNSNPLSD........GVSNIYSTQQ...........VTFGQLFV.LVHAVSRLHVAALPSE----
Q5TQX0_ANOGA/7-234W-------KA..AKQSTTTNTDTSLLKRLHHAAEIEKKQNESENKKLLGTVVQYGSVVQ.LLHLKSNKYVTVNIRL----
Q66S77_OIKDI/1-221W-------RS..VKPGQSRLVEVFV.RKLSEAADVEREQNEKEKKKQHGQEVRYGQIVQ.LLHIKSNKYLTVNKRL----
Q8TA74_HEMPU/8-204V-------ITDQIDQGGQA.................GHRT...........LLYGHAML.LQHSLSSMHLACLPTS----
ITPR_ASTPE/4-229W-------KS..AKPNVSSATDAVLLKKLQHAAEMEKKQNETENKKLMGSVIVYGNVIQ.LLHIKSHKYMTVNKRL----
Q9Y0A1_CAEEL/78-317W-------TEQKRFQTGDSMFDDDLMNKLKVAADKEREENESEFQKTLGNVIQYGSMVQ.LLHVKSNKYITVQKNS----

PF02815

RYR2_RABIT/226-406W-------RLET.LRVAW...........SGSHIRW....--------......GQPFR-LRHVTTGKYLSLMEDK....
Q6J9T9_ASPFM/358-545F-------ILENQTQPLGPF.......GQVEGPYAWDNIT--------TEYIQDGAVVR-LYHAMTHRRLHSHDER....
RYR3_HUMAN/216-398W-------RVEP.LRISW...........SGSNIRW....--------......GQAFR-LRHLTTGHYLALTEDQ....
Q759J8_ASHGO/342-519W-------YIEHYNASNT...........VPTTFEGL...--------....EHGTKIR-LKHVLTGHRLHSHDHK....
ITPR_ASTPE/231-419W-------ETEVVQHDPC...........RGGAGHW....--------......NSLFR-FKHLATGQYMAAEVDND...
Q6FL03_CANGA/354-530W-------VIERSHLP.............GASLKDFIG..--------...LKNGESIS-LLHLATGVRLHSHDHK....
Q9GS15_CAEBR/327-562W-------EVQVVQSNAY...........RGGTAKW....--------......NKTYR-FKHLASDMYLTVEESQMKAK
PMT1_SCHPO/329-505W-------IIEHEHSQ.............DNNRSNIEL..--------...LKDGSVVR-LRHVMTGRALHSHEHK....
Q91313_LITCT/214-394W-------RSEP.LRISW...........SGSHMRW....--------......GMPFR-ARHVTTGRYLAREEER....
Q7SH94_NEUCR/369-558W-------LLENQTQPLGIDGQPINGTGAWDHLPETPY..--------...IKDGAILR-LYHLPTHRRLHSHDVR....
O13054_MAKNI/219-399W-------RLEP.LRIAW...........SGGHIKW....--------......GQSFR-RHEITTGRYLCLEEEK....
ITPR_DROME/239-453W-------EIEVVQHDSC...........RGGAGDW....--------......NSLYR-FKHLATGHYLAAEAEIDVSA
Q6W3E4_RAT/232-432W-------EIEVVHHDPC...........RGGAGQW....--------......NSLFR-FKHLATGNYLAAELNPDYRD
ITPR1_HUMAN/232-433W-------EVEVVQHDPC...........RGGAGYW....--------......NSLFR-FKHLATGHYLAAEVDPDFEE
Q6BFC5_PARTE/240-444F-------TIE..SESMF...........QGGLVKWDT..--------...PMISSSYR-LRHLTTKKYLKVVEEK....
Q8TA74_HEMPU/220-400W-------RAEL.ILKKW...........NGSYVSW....--------......GPPCR-IRHLTSGKYLAVLENG....
Q6FK90_CANGA/355-531W-------EILP.................VADKAKGDN..--------...IRFGDEFR-LRHVGTDSYLLAHDVA....
Q8MXI9_CAEEL/274-503W-------EVQVVQTNAY...........RGGTAKW....--------......NKAYR-FKHLATDMYLSAEPSQVQVK
Q96WN5_EMEND/353-528W-------FIYPNRKEPQ...........YDAEAPLRF..--------...VGDGDVIR-LIHGQTGRNLHSHNIP....
P91905_CAEEL/220-400W-------RVEL.IRMKW...........HGALVGW....--------......EQVFR-IKHITSGRYLGVLDNS....
O77089_PANAR/234-422W-------EVEVVQHDPS...........RGGAGHW....--------......NSLFR-FKHLATGHYLAAEIDDD...
Q6CPY0_KLULA/347-524W-------VIELYDQP.............EVIPETFEG..--------...LKDGTKIR-LRHRLTDRRLHSHDHK....
Q6CAY4_YARLI/355-531W-------RVETPRDREA..........YNANTSEIEL..--------...LKHGDVIR-FIHLNTGRNLHSHQIP....
Q6C5U6_YARLI/339-516F-------LVENYTVTE............GDFQGDQIF..--------...LKDGDVIR-LKHIATGRRIHSHDFR....
RY44_DROME/211-392W-------RLEL.ARTKW...........TGGFINW....--------......YHPMR-IRHITTGRYLGVNDSN....
RYR1_PIG/212-391W-------RLEP.LRISW...........SGSHLRW....--------......GQPLR-IRHVTTGRYLALIEDQ....
PMT5_YEAST/339-517W-------IIELAEHP.............NENVTSFQN..--------...LTDGTIIK-LRQLKNGCRLHSHDHK....
PMT1_CANAL/359-534W-------LIEPYNG..............TIHNETFVP..--------...LINGMKIR-LKHINTGRRLHSHDEK....
PMT1_YEAST/343-520W-------LLELYNAP.............GESLTTFQN..--------...LTDGTKVR-LFHTVTRCRLHSHDHK....
ITPR3_RAT/233-432W-------EVEVVHHDPC...........RGGAGHW....--------......NGLYR-FKHLATGNYLAAEENPSYKG

PF06268

FASC_STRPU/393-496F-------TVTYKE-G..---------------------------------.GY--T..-IQ.DSCGKYWSC--D--DSS
Q6AXQ1_RAT/24-138W-------ELLVSN-EHE---------------------------------TQA--VVR-LK.SLQGLYLLC--E--ADG
SING_DROME/33-147W-------TLE..P-SNT---------------------------------GES--IIY-LR.SHLNKYLSV--D--QFG
FSCN2_HUMAN/389-492F-------HLSFSD-G..---------------------------------.AY--R..-IR.GRDGGFWYT--G--SHG
FSCN3_HUMAN/271-381F-------QFECDS-E..---------------------------------.SP--TVQ-LR.SANGYYLSQ--R--RHR
FSCN1_HUMAN/268-378F-------QLEIDR-D..---------------------------------.TK--KCA-FR.THTGKYWTL--T--ATG
Q6PBS5_DANRE/19-131W-------TLE..Q-DDQ---------------------------------DGQ--VVY-LR.SHLGRYLAS--D--KDG
FASC_XENLA/382-483F-------ELEFND-G..---------------------------------.AY--S..-LK.DATGKYWTV--G--SDM
FASC_STRPU/138-254L-------TLVYLG-K..---------------------------------GKY--G..-LE.AFNGKFVQ.--.--TDG
FSCN2_HUMAN/20-133W-------VLE..P-DPG---------------------------------QGT--AVL-LRSSHLGRYLSA--E--EDG
Q6AZJ6_XENLA/277-387F-------QLEINK-D..---------------------------------.TK--MCA-FR.THTGKYWTL--S--SNG
Q6EEB3_PRODO/230-340F-------QLEKNR-D..---------------------------------.TK--KCA-FR.TCNGKYWTL--S--ANG
FSCN2_HUMAN/141-254L-------TLIFRS-R..---------------------------------.RY--C..-LK.SCDSRYLR.--.--SDG
FSCN1_HUMAN/391-493F-------QLEFND-G..---------------------------------.AY--N..-IK.DSTGKYWTV--G--SDS
FSCN2_HUMAN/266-376F-------LMQIDQ-E..---------------------------------.TK--KCT-FY.SSTGGYWTL--V--THG
Q6EE45_SCYCA/96-208I-------TLVFQD-Q..---------------------------------.KY--S..-LQ.SSDNRFLR.--.--NDG
FSCN1_HUMAN/20-134W-------TLEQPP-DEA---------------------------------GSA--AVC-LR.SHLGRYLAA--D--KDG
Q6AZJ6_XENLA/152-265I-------TLVFQE-N..---------------------------------.RY--S..-IQ.TPDQRLLA.--.--SDG
FASC_STRPU/16-130W-------ILEQEE-S..---------------------------------.ST--ISY-LK.APSGNFLSA--D--KNG
Q6AZJ6_XENLA/32-144W-------SLE..P-AGE---------------------------------DSS--AVL-LR.SHLGRFLSA--D--KDG
FSCN1_HUMAN/142-256I-------TLAFQD-Q..---------------------------------.RY--S..-VQ.TADHRFLR.--.--HDG
SING_DROME/155-270F-------TLEFRA-EEG---------------------------------GRY--A..-LH.TCNNKYLN.--.--ANG
Q6PBS5_DANRE/139-252L-------TLVYMD-G..---------------------------------.KY--C..-LK.TSDSRFLS.--.--NDG

PF06229

Q7QC94_ANOGA/71-260F-------SAVLI.-N------------------------------------EQ--KVA-FK-SGYGKYLKV--E..KDG
A7RWZ5_NEMVE/69-257F-------TAVPV.-S------------------------------------EV--KLA-IK-SGYGKYMSV--N..TMG
Q15ER4_SCHMA/95-286F-------TAMQV.-S------------------------------------DT--KVA-FK-SGYGRYLGV--STKSDA
A1D4G2_NEOFI/89-280W-------VATRVA-G------------------------------------TE--SLS-FK-GHHGKYLSC--D..TYG
Q96MD3_HUMAN/4-156F-------SAVKL.-S------------------------------------DS--RIT-LK-SGYGKYLGI--N..SDE
Q2UKA8_ASPOR/84-274W-------VATRVA-G------------------------------------TE--GIS-FK-GQHGKYLGC--D..NYG
FRG1_DROME/72-260F-------TAFPI.-N------------------------------------DR--KVA-FK-SGYGKYLKI--E..KDG
Q6DDA8_XENTR/66-254F-------TAIKL.-S------------------------------------DS--RIA-LK-SGYGKYLGI--N..SDG
FRG1_CAEEL/78-273F-------ALVKTP-D------------------------------------DS--KIS-LK-TGFGRYVGV--D..SEY
Q0UA03_PHANO/83-265F-------VANRVA-G------------------------------------TE--GLS-LK-GHHGRYLSC--N..KYG
A2Q890_ASPNC/96-312W-------IASKIA-G------------------------------------IE--GWS-LK-GSNGRYLTS--D..KHG
Q566W5_DANRE/65-253F-------TAIKL.-S------------------------------------DS--RIA-LK-SGYGKYLGI--N..SEG
A6SI98_BOTFB/86-272W-------VANKVA-G------------------------------------TE--TYS-FK-GHHGKYLSC--D..KFG

PF04601

Q9LJJ2_ARATH/1-141W-------TVEVVEK.-----------------------------------.AD--VIR-LK-SCFGKYLTA--S--NIP
Q9LQ43_ARATH/1-142W-------TVEIIP.G-----------------------------------STN--LIR-LK-SAYGKYLTA--S--NKP
Q9CAS3_ARATH/251-396W-------RVEMVP.G-----------------------------------SEK--AIR-LK-SCHGGYLTA--S--NER
O04559_ARATH/227-368W-------TVEPVR.D-----------------------------------SFH--VIR-LK-SCYGKYLTA--S--NER
O04559_ARATH/1-144W-------TVEPVV.D-----------------------------------KPN--LIR-LK-SSHGTYLTA--S--NKP
Q9CAS2_ARATH/1-139W-------IVEPVR.G-----------------------------------SFE--VIR-LR-SCYGNYLTA--S--NER
Q9CAS3_ARATH/1-144W-------TVEMVP.R-----------------------------------KPK--FIR-LK-SCYGKYLTA--S--ESS

PF00167

Q28XC7_DROPS/16-141F-------TMDSVGDALS---------------------------------VDF..KIT-IYAKDVDYYLCF--H--Q.G
Q4S3V1_TETNG/61-182L-------QLQAT....S---------------------------------V.G..EVV-IKGVCANRYLAM--N--RDG
P91672_DROME/249-377L-------QRSTV....D---------------------------------V.G..RIK-LQSVATCLYLCM--D--ACG
Q8R5L5_RAT/84-205L-------EISTV....E---------------------------------R.G..VVS-LFGVKSALFIAM--N--SKG
B1AK17_HUMAN/79-205F-------NLIPV....G---------------------------------L.R..VVA-IQGVQTKLYLAM--N--SEG
FGF1_CHICK/25-148L-------QLSAE....D---------------------------------V.G..EVY-IKSTASGQYLAM--D--TNG
Q8I6J6_CIOIN/91-218F-------EVFSM....K---------------------------------H.G..VVG-IRSERHRRYVCM--N--KRG
Q9YH31_NOTVI/72-193L-------EISPV....E---------------------------------R.G..VVC-MFGVQSGLFLAM--N--SKG
FGF16_MOUSE/61-187L-------EFISL....A---------------------------------V.G..LIS-IRGVDSGLYLGM--N--ERG
Q5TLD5_DANRE/43-168L-------EIRTV....S---------------------------------EGG..VLA-IKGLKSQFYISM--N--RSG
A1YJ27_NPVSF/70-196F-------HRIAQ.....---------------------------------..PNRKIL-LRSSAHCSFLCI--N--ECG
Q90XQ4_AMBME/55-181L-------IVETD....T---------------------------------FGS..RVR-IKGAETGYYICM--N--KKG
Q86GG2_CIOSA/55-180M-------AILST....S---------------------------------FGG..RIM-IQGVETGRVLCM--N--RKG
Q8I6J7_CIOIN/133-264I-------EVQSV....A---------------------------------AGG..VIR-FYSPSTGRYLAM--N--RHS
FG17_DANRE/53-178L-------YVETD....T---------------------------------FGS..RVR-IKGAESGRYLCM--N--RRG
Q9E225_9ABAC/33-160F-------YRVPH....Y---------------------------------M....NHL-LKAAQTCRYICV--N--QCG
Q8I6J5_CIOIN/56-181L-------IIHSK....G---------------------------------LWG..RIM-IQGVQTERFLCM--N--KRG
Q4SAA6_TETNG/81-202L-------EISAV....D---------------------------------R.G..VIS-LFGVRSAMFVAM--N--SRG
Q2NP32_NPVHC/29-154L-------QRVSY....H---------------------------------Y.G..RIL-LRNAISCMHVCL--D--RCG
Q4RWE4_TETNG/71-205F-------NLIPV....G---------------------------------L.R..VVA-IQSVKTGLYIAM--N--GEG
FGF1_NOTVI/2-125L-------QFYAE....S---------------------------------V.G..EVY-IKSLETGQYLAM--D--SDG
Q544I6_MOUSE/65-189M-------EIRTV....A---------------------------------V.G..IVA-IKGVESEYYLAM--N--KEG
Q8VI79_RAT/32-156V-------EIRSV....R---------------------------------V.G..TVV-IKAVYSGFYVAM--N--RRG
A3EXK2_NEMVE/57-180L-------IIESD....G---------------------------------F.G..RVR-IRGAETKFYLCM--D--KRR
Q4RSP6_TETNG/17-145L-------EITSV....D---------------------------------V.G..VVA-IKGLNSNYYLAI--S--KKG
FGFH_NPVOP/29-156L-------QRIAI....A---------------------------------H.G..RIL-LRNAVSCMYVCL--D--RCG
Q5M7N7_XENTR/65-189L-------EIRTV....A---------------------------------V.G..IVA-IKCIESEYFLAM--N--KSG
FGF1_XENLA/25-148L-------KLSAL....S---------------------------------Q.G..EVH-IKTTETGCYLAM--D--SSG
O92401_NPVBM/28-154F-------KRLAV....D---------------------------------R.N..RIV-IQNAITCVYLCI--D--RCG
A6Y7S4_DIDAL/29-153L-------QLQAE....E---------------------------------R.G..VVS-IKGVCANRYLAM--K--EDG
Q66IF7_XENTR/61-197L-------EITAV....D---------------------------------V.G..IVA-IKGLFSGRYLAM--N--QRG
Q4T869_TETNG/30-155L-------FVETD....S---------------------------------FGS..RVR-IRGAESGRYLCM--N--RKG
Q91BB2_NPVST/26-158F-------HRISV....S---------------------------------H.N..LML-LVNSVSCRYVCI--N--ACG
Q9N1B9_SHEEP/84-207L-------EITSV....E---------------------------------I.G..VVA-VKAINSNYYLAM--N--KKG
A7RZP2_NEMVE/41-163L-------ILESD....T---------------------------------FGG..RVK-IKGDKTKHYLCI--K--KDG
LE756_CAEEL/72-207V-------EFVSV....A---------------------------------M.S..LVS-IRGVETKNFICM--D--PSG
Q8R5L6_RAT/78-192.-------..EGQ....Q---------------------------------R.G..VVS-IFGVASRFFVAM--S--SRG
Q8T8A3_CIOSA/159-283L-------EFIST....G---------------------------------V.G..SLT-IRGVASGLYLAM--N--SKG
A7YT71_DANRE/25-149L-------KVKAV....K---------------------------------A.G..VVA-IRGHETGLYLAM--D--KCG
Q4SCS5_TETNG/71-197F-------NLIPV....G---------------------------------L.R..IVA-IQGAKTGLYLAM--N--SEG
A7SH09_NEMVE/102-230F-------ELESY....G---------------------------------R.S..LIR-VKSVPHDMYIAI--S--NTG
FGF1_DANRE/17-138L-------RIKAT....S---------------------------------P.G..VVV-IEGSETGLYLSM--N--EHG
Q287N3_NPVAS/32-156W-------HRIAL....E---------------------------------E....GIL-LRSSAHCNYLCI--N--ECG
Q80LI4_NPVAH/49-164W-------QIHNL...NA---------------------------------EAN..TIL-MYSAAFCNFLCI--N--ACG
Q5TKR7_DANRE/53-179L-------VVEAD....T---------------------------------FGS..QVR-IRGKETNYYLCM--N--RKG
Q8QLI3_9ABAC/34-158W-------HRISQ....S---------------------------------D....GIL-LRSSLYCNYACI--N--ECG
Q2LGG1_DANRE/81-202I-------EISAV....E---------------------------------R.G..VVS-LYGVKSGLFVAM--S--SRG
FGF18_MOUSE/53-178L-------LVETD....T---------------------------------FGS..QVR-IKGKETEFYLCM--N--RKG
Q9J897_9ABAC/33-159W-------HRIAR....P---------------------------------D.G..MML-LRSSIYCTYLCV--N--ECG
Q0PV85_HALRO/186-312L-------EFVSV....N---------------------------------V.G..VVT-IRGVETGLYLAM--D--SKG
Q1LXT4_DANRE/17-141M-------EIRSV....S---------------------------------V.G..VVA-IKSVSTGLYLAM--S--KKG
Q1HGX9_NPVAP/32-158L-------QRVRG....N---------------------------------TRG..HIL-LRNAVTCMHVCL--D--RCG
Q4SFA3_TETNG/9-140L-------EISSV....D---------------------------------R.G..VVT-LRGLISGLFIAM--N--DKG
Q9DFC9_DANRE/67-188L-------EISPV....E---------------------------------R.G..VVT-LFGVRSGLFVAM--N--SKG
A5PM81_DANRE/55-181F-------NLIPV....G---------------------------------L.R..VVA-IQGVKAGFYIGM--N--GEG
A7SRV3_NEMVE/407-534F-------ELQSY.....---------------------------------..GPSIVR-IRHVKTGFFIAM--D--RRG
Q8NF90_HUMAN/87-216L-------EIFAV....S---------------------------------Q.G..IVG-IRGVFSNKFLAM--S--KKG
FGF11_HUMAN/71-197F-------NLIPV....G---------------------------------L.R..VVT-IQSAKLGHYMAM--N--AEG
Q0KJ02_ORYLA/70-196L-------EFISL....A---------------------------------V.G..LVS-IRGVDSGLYLAM--N--NKG
FGF4B_XENLA/68-189L-------EISPV....E---------------------------------V.G..VVS-LYGIKSAMFVAM--N--AKG
A7RFG7_NEMVE/73-195M-------KIETA....G---------------------------------LNG..LFR-AKAIATNLYLSM--D--SRG
Q4VBV7_DANRE/72-196L-------EIKSV....D---------------------------------V.G..IVA-IKGIQSNYYLAI--N--KKG
FGF3_DANRE/62-204L-------EITAV....D---------------------------------V.G..VVA-IKGLFSGRYLAM--N--EKG
Q4SJV9_TETNG/17-140L-------KLKAV....E---------------------------------R.G..VVV-IRGTEAGRYLAM--D--DQG
Q6VTW1_NPVCD/28-157L-------QRVSHFEHPA---------------------------------R.R..TIL-LRNAISCMHVCL--D--RCG
Q8QG59_AMBME/67-191M-------EITSV....D---------------------------------V.G..IVA-VKGVYSNYYLAM--N--EKG
Q3YAG3_STRPU/203-330L-------YIQSQ....R---------------------------------R.S..IVS-IKGLRSQLYVCV--D--DSG
FGF17_RAT/53-178L-------IVETD....T---------------------------------FGS..RVR-IKGAESEKYICM--N--KRG
A7SHR3_NEMVE/45-169M-------VQESL....S---------------------------------INGTIRVR-LRSLVENTYICV--T--KDG
Q5TLE2_DANRE/41-170L-------ELFAV....S---------------------------------Q.G..VIG-IRGVFSNRFLAM--N--KRG
Q6E7C8_OIKDI/1583-1704L-------QLEPS....G---------------------------------NSH..RIL-LRALASGKYLTI--T--RRG
Q9PVY1_XENLA/62-188L-------EFISV....A---------------------------------I.G..LVS-IRGVDTGLYLGM--N--DKG
Q8JMA6_9ABAC/35-159W-------HRVAH....S---------------------------------D....GVL-LRSSLYCNYVCI--N--ECG
Q1XG75_DANRE/59-183L-------EITSV....D---------------------------------V.G..VVA-IRGLGSNLYLAI--S--KKG
Q0IIQ7_DANRE/50-175L-------VVETE....T---------------------------------FGS..HVR-IKGQESGYYICM--N--KNG
A7T359_NEMVE/53-177L-------IIEST....A---------------------------------FGG..QVR-VRSFHDNKYLCI--T--RHG
Q5GAD8_9VIRU/23-148L-------TLKSV....R---------------------------------A.G..QIV-IKGSIGG.YVCM--D--RNG

PF00340

IL1B_BOVIN/144-261.-------YLSCV----K---------------------------------KGDTPTLQ-LEEVD.PKVYPK--R--NME
IL1RA_MOUSE/61-174.-------CLSCA----K---------------------------------SGDDIKLQ-LEEVNITDLSKN--K--EED
IL1RA_HUMAN/60-173.-------CLSCV----K---------------------------------SGDETRLQ-LEAVNITDLSEN--R--KQD
IL1B_FELCA/146-263.-------YLSCV----M---------------------------------KDGKPTLQ-LEMLD.PKVYPK--K--KME
Q9GL09_SHEEP/72-185S-------TLSCE----N---------------------------------K....IIS-FKEMNPPDNIDN--E--GSD
IL1A_MOUSE/158-269.-------FVSAQ----G---------------------------------E.DQPVLL-KELPETPKLITG--S--ETD
Q96KJ8_HUMAN/72-185S-------TLSCE----N---------------------------------K....IIS-FKEVNPPDNIKD--T--KSD
IL1B_CERAT/147-264.-------YLSCV----L---------------------------------KDDKPTLQ-LESVD.PKNYPK--K--KME
Q9I8D2_CHICK/66-187.-------YMCCE----K---------------------------------EHGKMVVR-FREGEVPKDIP.--G--ESN
IL1B_PIG/145-262.-------YLSCV----M---------------------------------KDNTPTLQ-LEDID.PKRYPK--R--DME
IL1B_MOUSE/148-264.-------YLSCV----M---------------------------------KDGTPTLQ-LESVD.PKQYPK--K--KME
IL1A_RABIT/156-266.-------FVSAQ----N---------------------------------E.DEPVLL-KEMPETPRIITD--S--ESD
IL1A_BOVIN/156-265.-------FVSAQ----N---------------------------------E.DEPVLL-KEMPETPKIIKD--.--ETN
Q91Z66_SIGHI/73-186R-------TLSCK----N---------------------------------Q....IIS-FEEMDPPLEIDG--T--KSD
IL1A_CERAT/155-266.-------YVSAQ----D---------------------------------E.DQPVLL-KEMPEIPKTTTG--G--ETN
IL1RA_RABIT/60-173.-------CLSCV----K---------------------------------SGDKMKLH-LEAVNITDLGKN--K--EQD

PF05270

OTOG_MOUSE/1241-1384F-------LLTAALYKAK---------------------------------AHDPDVVS-LEAADRPNFFL.--HTTANG
ABFB_ASPOR/358-502W-------TVRTGLANSA---------------------------------.....CLS-FESVDTPGSYIR--H..YNF
Q82P18_STRAW/329-465F-------TVVAGLADAG---------------------------------.....GYS-F..RDAAGNYLR--H..YDY
Q829S7_STRAW/176-312F-------KLVKGLADAS---------------------------------.....CYS-FATAD..GTYLR--H..SRF
Q55841_SYNY3/35-174F-------RVTTGLANPN---------------------------------.....CIS-LESRNFPNYFLR--H..RNY
Q9HEY2_COCCA/355-499W-------IVRAGFTNSE---------------------------------.....CFA-FESKDTAGSFLR--H..ANF
Q86ZN9_FUSOX/351-495W-------TVRTGLANSG---------------------------------.....CVS-FESNDTPGSYIR--H..SGF
Q82P90_STRAW/346-481F-------RVVTGLAGSG---------------------------------.....TIS-LESANYPGYYLR--H..KNY
ABFB_EMENI/357-506W-------TVRTGLASTA---------------------------------AA.NGCVS-FESVDTPGSYIR--H..SNF
ABF1_HYPJE/352-496W-------TVRAGLANNA---------------------------------.....CFS-FESRDTSGSYIR--H..SNF
ABFB_ASPKW/350-494W-------TVVTGLANSQ---------------------------------.....CFS-FESVDTPGSYIR--H..YNF

PF00197

IT2_PSOTE/2-176LDENS...NGEPIRIASR---------------------------------L-..RSTF-IPEY...SLVNL--GFADPP
IAAS_ORYSJ/26-193TDERR...KGFPVRFTPW---------------------------------G-GAAAPE-DRTIRVSTDVRI--RFNAAT
MIRA_RICDU/35-216RKEVD...HDRPLAFFP.---------------------------------.-..ENPK-EDVVRVSTDLNI--NFSAFM
ALB1_PSOTE/4-171TRNIM.....YATSISSE---------------------------------D-..KTPP-QPRN.ILENMRL--KINFAT
ASP_THECC/30-208RSDLD...NGTPVIFSN.---------------------------------.-..ADSK-DDVVRVSTDVNI--EFVPIR
IAAS_HORVU/27-199PNGQH...DGFPVRITPY---------------------------------G-..VAPS-DKIIRLSTDVRI--SFRAYT
API8_SOLTU/39-219NSDVGP..SGTPVRFIP.---------------------------------.-.....L-SGGIFEDQLLNI--QFNIPT
ICW3_PSOTE/27-198PNEVS...KGEPIRISSQ---------------------------------F-..LSLF-IPRG...SLVAL--GFANPP
IDE3_ERYCA/1-168PNELS...DGKPIRIESR---------------------------------L-..RSAF-IPDD...DKVRI--GFAYAP
IECI_ERYVA/2-173PFEVS...NGEPIRIASQ---------------------------------F-..LSTF-IPDG...SPYAI--GFANPP
IT1A_PSOTE/2-168PNEVS...VGEPLRISSQ---------------------------------L-..RSGF-IPDY...SVVRI--GFANPP
ITRA_SOYBN/26-199RNELD...KGIGTIISSP---------------------------------Y-..RIRF-IAEGHPLSLKFD--SFAVIM
ITRY_ACACO/2-171QSETK...RGLPAVIWTP---------------------------------P-..KIAI-LTPG...FYLNF--EFQPRD
KTI1_SOYBN/27-197PNELD...KGIGLVFTSP---------------------------------L-..HALF-IAERYPLSIKFG--SFAVIT
CPI1_SOLTU/47-221MSIPQFLGEGTPVVFVRK---------------------------------S-..ESDY-GDVVRVMTVVYI--KFFVKT
SPOR1_IPOBA/42-216PNDLD...NGDPITITPA---------------------------------T-..ADPE-STVVMASTYQTF--RFNIAT
GWIN3_POPSP/32-195TGIEG.....LPVTFSP.---------------------------------V-..INST-DGVIREGTLITV--SFDAST

PF07951

BXB_CLOBO/1075-1291YRDLY---IGEKFIIRRK---------------------------------S.NSQSIN-DDIVRKEDYIYL--DF.FNL
BXE_CLOBU/1063-1250NR.LY---SGIKVKIQRV---------------------------------N..NSSTN-DNLVRKNDQVYI--NF.VAS
TETX_CLOTE/1105-1314YRRLY---NGLKFIIKRY---------------------------------T..PNNEI-DSFVKSGDFIKL--YV.SYN
BXA1_CLOBO/1088-1293SS.LY---RGTKFIIKKY---------------------------------A...SGNK-DNIVRNNDRVYI--NV.VVK
BXG_CLOBO/1083-1297YQNLY---LGLRFIIKKA---------------------------------SNSRNINN-DNIVREGDYIYL--NIDNIS
BXC1_CLOBO/1089-1291NNDFN---EGYKIIIKRI---------------------------------R...GNTN-DTRVRGGDILYF--DM.TIN
Q45851_9CLOT/1072-1268AR.LY---TGVEVIIRKV---------------------------------GSTDTSNT-DNFVRKNDTVYI--NV.VDG
Q45967_CLOBO/1085-1285NNDFN---EGYKIIIKRI---------------------------------R...GNTN-DTRVRGENVLYF--NT.TID
BXF_CLOBO/1083-1274YK.LY---EGVEVIIRKN---------------------------------GPIDISNT-DNFVRKNDLAYI--NV.VDR
BXD_CLOBO/1076-1276RSKLY---TGNPITIKSV---------------------------------S...DKNP-YSRILNGDNIIL--HM.LYN

PF14200

C6I1A8_9BACE/97-198W---R---ITA.----------------------------------------------------------LP..N.---.
A8NAT6_COPC7/44-145W---F---IFS.----------------------------------------------------------SQ..N.---.
A8P1Y0_COPC7/90-188W---H---IWH.----------------------------------------------------------DEVYP.---.
A8PCJ2_COPC7/37-137W---A---IWP.----------------------------------------------------------DE.ND.---.
A1Z5I4_BEABA/43-129F---Q---YDP.----------------------------------------------------------NM....---.
A6EHX4_9SPHI/63-161F---L---ISP.----------------------------------------------------------AA..D.---.
A6ERL3_9BACT/65-184W---I---VNQ.----------------------------------------------------------SA..D.---.
A6G9W3_9DELT/412-502W---Q---LDD.----------------------------------------------------------FG..D.---.
A6G9W3_9DELT/550-640W---E---LND.----------------------------------------------------------FA..S.---.
A7EWX9_SCLS1/45-151W---T---IKP.----------------------------------------------------------AT..T.---.
A7WK54_LYSSH/385-485W---I---LET.----------------------------------------------------------HQ..R.---.
A8NDJ7_COPC7/40-145W---E---VRQ.----------------------------------------------------------VN..A.---.
A8NDJ7_COPC7/189-287W---Y---IAP.----------------------------------------------------------DSMIT.---.
A9E912_9FLAO/86-187F---K---LSR.----------------------------------------------------------AT..S.---.
B0DSD3_LACBS/40-138W---N---IWP.----------------------------------------------------------DE..D.---.
B0MJQ2_9FIRM/249-352W---F---LYR.----------------------------------------------------------SG..D.---.
B1VUB2_STRGG/50-155W---L---IEQ.----------------------------------------------------------HP..EA---P
B2WIQ5_PYRTR/45-143W---K---LAH.----------------------------------------------------------VG..N.---.
B2ZRS9_CLINE/46-144V---S---IES.----------------------------------------------------------AG..N.---.
B3C971_9BACE/378-483W---R---IDQ.----------------------------------------------------------LT..D.---.
B3PKR2_CELJU/520-621W---R---LLP.----------------------------------------------------------QA..D.---.
B4V2C9_9ACTO/39-139W---I---VEE.----------------------------------------------------------HL..D.---.
B4V8E2_9ACTO/575-676W---M---LSA.----------------------------------------------------------SG..D.---.
B5GTM6_STRCL/44-154W---H---IVP.----------------------------------------------------------VE..G.---.
B6SS31_MAIZE/56-169W---T---ESKD----------------------------------------------------------VG..K.---.
B8P008_POSPM/56-152F---T---FID.----------------------------------------------------------NG....---.
B8P2U3_POSPM/41-134F---T---FID.----------------------------------------------------------S...D.---.
B8PDH6_POSPM/53-148F---K---VSE.----------------------------------------------------------SG....---.
C0PSY5_PICSI/62-180F---T---QSA.----------------------------------------------------------DV..G.---.
C3I9T1_BACTU/507-614W---K---VKR.----------------------------------------------------------TS..K.---.
C4LYE8_ENTHI/157-265W---E---LEP.----------------------------------------------------------VG..N.---.
C4M3J3_ENTHI/137-243W---F---IES.----------------------------------------------------------FG..K.---.
D9STT7_CLOC7/601-707F---K---LKD.----------------------------------------------------------NG..D.---.
C6D9K8_PECCP/404-505W---L---ILD.----------------------------------------------------------AG..D.---.
C6L2F6_APOCT/307-416W---R---IEH.----------------------------------------------------------VN..D.---.
C6L2F6_APOCT/611-715W---R---IEL.----------------------------------------------------------TN..D.---.
C7PHL4_CHIPD/338-435W---A---IIP.----------------------------------------------------------VG..N.---.
C9YYM1_STRSW/484-581W---N---VVQ.----------------------------------------------------------SA..D.---.
D1BKB8_SANKS/626-731W---W---ALS.----------------------------------------------------------TT..D.---.
D1Q0S6_9BACT/375-479W---R---IDQ.----------------------------------------------------------LT..D.---.
D2QTB1_SPILD/373-478W---R---IDQ.----------------------------------------------------------LT..D.---.
D2S061_HALTV/623-726F---E---ANP.----------------------------------------------------------IA..P.---.
D2VXQ3_NAEGR/45-151W---I---VKK.----------------------------------------------------------CD..H.---.
D3Q6V6_STANL/130-238F---E---LSD.----------------------------------------------------------KG..D.---.
D4J5M3_9FIRM/492-590W---Q---VLP.----------------------------------------------------------DG..A.---.
D4J5M3_9FIRM/739-837W---Q---VLP.----------------------------------------------------------DG..T.---.
Q8A5P7_BACTN/65-167W---K---ITA.----------------------------------------------------------LP..N.---.
Q8X123_9AGAR/44-154W---T---IKK.----------------------------------------------------------SS..D.---.
Q9L153_STRCO/584-686W---L---ASS.----------------------------------------------------------TG..D.---.

PF00652

GALT3_MOUSE/505-627F...E---YSAQ......---------------------------------REIRHNIQ-KEL.......CL--HA---T
CRBG3_HUMAN/888-1017W....---YYCR......---------------------------------GLFKSKAS-DT........CL--DV---I
GLT10_CAEEL/536-662L...R---LTRW......---------------------------------HDIRPKGR-KI........CF--DC---S
CUPF_DICDI/32-142W...L---LSDD......---------------------------------GHIFTSSG-NF........VL--DV---S
Q7QIK5_ANOGA/491-617F...S---LTKR......---------------------------------NVLRNERS-..........CA--TV---Q
Q7PZM5_ANOGA/438-564F...T---LSYH......---------------------------------RDIRVRSN-DK........CL--DA---A
Q7Q0E9_ANOGA/461-587F...Q---LSWH......---------------------------------RDLRIKFG-EL........CW--DV---S
Q7QDR0_ANOGA/437-565F...V---HSWH......---------------------------------RDIQHKYG-EG........CF--DV---P
ML1_VISAL/440-560W...A---LYGD......---------------------------------GSIRPKQN-QDQ.......CL--TC---G
O96048_LUMTE/132-255W...Y---TDQQ......---------------------------------GVIRSKLN-DF........AI--DA---S
GALT7_CAEEL/478-592I...R---LNVQ......---------------------------------GQMAQGEW-..........CL--TA---N
GLTL2_HUMAN/505-628L...Q---HTSR......---------------------------------KEIHFGSP-QHL.......CF--AV---R
GLT13_DROME/435-548W..SM---LRQS......---------------------------------GQLSTHRE-L.........CL--AV---G
Q7NQK0_CHRVO/5-133LALFN---IDFE......---------------------------------NGLFGLAT-SGNN.....LVI--DI---S
GALT4_CAEEL/461-580W...V---FDQL......---------------------------------TKTFKNAI-SQL.......CL--DF---S
Q8W2E8_IRIHO/447-569W...Y---LYGD......---------------------------------GSIRPLID-PTY.......CV--TS---Q
Q9SLV9_CUCSA/35-159W...T---IVGD......---------------------------------GTIRPMND-KF........CL--AA---E
AGALA_ASPNG/424-536W...Q---VTPS......---------------------------------GVIRPVSQ-TTQ.......CL--AA---D
GALT1_MOUSE/430-548F...S---YTAN......---------------------------------KEIRTDDL-..........CL--DV---S
GALT3_DROME/512-658F...V---ITPK......---------------------------------GQIMTNDN-V.........CL--TY---R
Q7Y0V1_9FABA/7-131W...T---LKRD......---------------------------------KTIRSKGK-..........CL--TT---H
GLT12_MOUSE/440-569F...E---YTTR......---------------------------------KEIRYNTR-QPE......ACI--TV---E
Q9ADL1_SORCE/171-307FRFEA---VDGG......---------------------------------YYRIRNVQ-SDK.......CL--DV---R
Q8C2S1_MOUSE/660-788W....---IYQE......---------------------------------GCIKCRIA-EDC.......CL--TI---V
Q9X583_9ACTO/367-502WRAGR---NSDG......---------------------------------SYTLTNIA-SGR.......VL--DE---P
GALT9_MACFA/467-595V...R---YSAD......---------------------------------GLLQLGPL-GSTAFLPDSKCL--VD---D
Q8KKH3_BACCI/270-405FRVES---TGDG......---------------------------------YYKLTAVH-SGK.......VL--DV---P
GALT5_HUMAN/810-932F...N---YTWL......---------------------------------RLIKCGEW-..........CI--AP---I
Q7SBD7_NEUCR/100-230F...A---FDGS......---------------------------------PGPLFFQP-QNAK....DTCF--TV---S
O04071_SAMNI/439-558W...A---LYGD......---------------------------------GTIRVNSD-RSL.......CV--SH---S
Q9HFA9_9TREE/43-172F...T---LVRG......---------------------------------DQQIKVSG-TNF.......CL--DA---G
Q9EWL6_STRCO/70-209W...V---TYNQ......---------------------------------GGVARRFM-AYHS....AKCL--AL---R
Q824Z7_STRAW/111-218W...Q---ASPE......---------------------------------DYSFRNVA-TLT.......CL--DG---S
Q9HFB1_9ASCO/416-528W...Q---VRQD......---------------------------------GHISSLLR-PDK.......CI--VD---D
Y1454_MYCBO/33-153W...N---LTDD......---------------------------------RQVESVAF-PGE.......CV--NI---G
Q6TBQ9_CRYPV/535-659F...M---MSNH.....T---------------------------------QQIRIVSK-ESY.......CI--..---.
Q825I1_STRAW/713-838W...E---YETD......---------------------------------GLLRSLAA-PEL.......CL--DS---H
Q7TLZ3_9ZZZZ/377-504W...T---HTSA......---------------------------------NQLTVYSG-SSQ......MCL--DA---Y
Q7X2C9_STRTE/266-386W...A---VTDS......---------------------------------GEIRVYGN-K.........CL--DA---A
GALT9_DROME/521-640W...M---LSKA......---------------------------------GEIRRDDS-..........CL--DY---A
GLT10_DROME/483-615W...S---LTQD......---------------------------------HEIQLTNS-KDD.......CL--EA---Q
Q825L5_STRAW/296-417W...T---VASD......---------------------------------GTLRALGK-..........CL--DV---T
Q6BE06_BACTU/699-826W...R---FVYN......---------------------------------GDQNAFQI-KSTPN..EDLVL--SG---S
ENVE_SALTY/53-170F...S---FHRD......---------------------------------RITQGEK.-..........CL--DA---A
Q6YBY0_TOXGO/500-612F..MF---FRKV......---------------------------------GHVMPVND-DEA.......CL--QP---S
O86669_STRCO/329-444W...D---VDQD......---------------------------------GTIRPRND-RDY.......CL--TA---L
FLVS_FLAME/296-437F...I---FRKS......---------------------------------EHGYFTIK-SILDS...TKVL--TV---R
Q8RTY5_9GAMM/861-988W...Y---FDPI......---------------------------------KGSIKLAG-DAG......LCL--HI---P
Q7VN40_HAEDU/61-177F...T---FYRD......---------------------------------SIRVNGQ.-..........CL--DV---G
GLTL3_HUMAN/465-591A...R---YTKE......---------------------------------GFLHLGAL-GTTTLLPDTRCL--VD---N
Q82LA2_STRAW/332-460FWFKS---VAGG......---------------------------------YYELMGRG-SSL.......CL--..---.
GALT3_CAEEL/484-604W...S---LTGK......---------------------------------GEIRSDDL-..........CL--SS---G
GLTL1_HUMAN/431-552W...L---FSDH......---------------------------------.LIQQQGK-..........CL--AA---T
Q825H7_STRAW/402-529W...T---YEKD......---------------------------------GLLRSVAD-PEL.......CL--DS---G
GALT7_DROME/467-582V...R---LNAA......---------------------------------GQLGVGER-..........CV--EA---D
Q8VUT1_9PSED/305-438FTFVP---VDSG......---------------------------------WYELRTKH-NK........CV--GV---G
Q70US9_ADEVO/400-521W...T---LYAD......---------------------------------GTIRSQST-LSK.......CL--AC---S
GALT8_DROME/446-570W...S---LTNH......---------------------------------RELRSGFY-..........CL--EV---R
Q9K438_STRCO/427-551W...S---VAPD......---------------------------------GTVRAFGK-..........CL--DI---D
Q7SIF1_TRIKI/2-122W...T---LKRE......---------------------------------ATIRSNGG-..........CL--TT---A
GALT4_MOUSE/444-574F...E---YTSN......---------------------------------KEIRFNSV-TEL.......CA--EV---P
GALT4_DROME/511-641W...E---LSIF......---------------------------------RDLRMKGF-DSV.......CL--DV---H
GALT6_CAEEL/475-606W...L---YTGD......---------------------------------RRIRTDEH-L.........CL--SV---V
GLT11_CAEEL/482-602W...K---YSST......---------------------------------NELRPMGS-SRM.......CL--DS---L
Q8GB62_9GAMM/313-450FQFTA---LGNN......---------------------------------EYSISAKV-SQL.......CM--EL---A
Q6BE03_BACTU/674-805W...R---FVYN......---------------------------------SSQGAYQI-RNLAD..ENLVL--TR---E
O68641_CELCE/306-433W...T---RGSD......---------------------------------GTVRALGK-..........CL--DV---R
Q8RTY5_9GAMM/724-853W...S---FDAD......---------------------------------KRMFSNKA-NPS......LCL--DN---R
Q9RDQ1_STRCO/383-509W...R---VDGD......---------------------------------SLVNVNSG-K.........CL--DV---N
Q9SLV9_CUCSA/165-289W...A---LYAD......---------------------------------GTIRQHVN-KNY.......CL--TS---D
GLT11_DROME/425-535W...T---LTSR......---------------------------------CQLKHGNM-..........CL--DV---D
Q9L0N4_STRCO/326-472WNLEV---KYEN......---------------------------------GGPNGAKL-FQIRNVTDQLCM--DL---G
GALT7_MOUSE/533-649F...R---INEA......---------------------------------NQLMQYDQ-..........CL--TK---G
GALT2_DROME/507-627W...A---FTKR......---------------------------------GEIKHDDL-..........CL--TL---V
GLT10_HUMAN/459-587F...T---FTWR......---------------------------------EDIRPGDP-QHTK....KFCF--DA---I
Q9K473_STRCO/837-959W...T---LADD......---------------------------------GSFTALNK-..........CL--DV---S
GLT12_DROME/433-546W...T---LTYV......---------------------------------KDLRVAGN-I.........CA--EV---R
GALT1_DROME/473-597F...S---FTNT......---------------------------------NVLRNELS-..........CA--TV---Q
AHV_ACTSK/47-157W...T---GPGD......---------------------------------GTVRNAQT-GR........CL--DS---N
Q8LKQ3_VISAL/8-135W...T---IRRD......---------------------------------GTIRSNGR-..........CL--TT---Y
Q82HL7_STRAW/418-544W...R---VDTA......---------------------------------RGVLQSSE-DPD......FCL--DS---R
GALT9_CAEEL/450-571M...S---LSKE......---------------------------------GNLRRENT-..........CA--SE---E
O62004_BRAFL/490-604W...S---FSRD......---------------------------------RIINEANN-L.........AL--EV---K
Q7NYA5_CHRVO/248-356W...V---HAQD......---------------------------------GSLQLKDN-Y.........CL--EE---H
O96048_LUMTE/2-124W...Y---EDAS......---------------------------------TGTIRNQA-NQL.......AL--HV---G
Q86S91_9CILI/376-511WICTQ---MSDG......---------------------------------NYKFTNVN-ANK.......CL--EV---Y
Q97TI2_CLOAB/443-579W...Y---LTNT......---------------------------------GDGYVTLK-SALG....NYML--DV---S
O04071_SAMNI/311-434W...T---FRTD......---------------------------------GTIRSLGK-..........CL--TN---S
Q9ZBF7_STRCO/336-461W...D---FRPD......---------------------------------GTIRSLGL-..........CM--DA---T
Q868M7_CUCEC/115-242F...Y---IRSRGPELFY---------------------------------GRLRNEKS-DL........CL--DV---E
GALT6_MOUSE/497-619F...E---YTSQ......---------------------------------RDLRHNIG-KQL.......CL--HA---S
Q9EWL5_STRCO/41-182WRMVM---TGGD......---------------------------------GALASVVL-QNIGS...GRCL--TV---H
Q82P89_STRAW/370-505WRIED---QGTD......---------------------------------TSRLVNVA-TGK.......VM--DT---A
Q7Y0V1_9FABA/137-258W...A---LYPD......---------------------------------GSIRPVQN-TNN.......CL--TS---T
GLT11_HUMAN/479-604W...I---YNEE......---------------------------------HELVLNSL-L.........CL--DM---S
GALT2_HUMAN/446-563W...A---LTKE......---------------------------------KSVKHMDL-..........CL--TV---V
GLT14_MOUSE/420-545W...A---FTYT......---------------------------------QQIIQEEL-..........CL--SV---V

PF03498

Q46102_CAMJU/29-187.KLAD---ELPF---------------------------------------GYVQFTNP-KESDL-----CL--AI...L
Q6UPC3_ECOLX/79-232WQIMP---GTRP---------------------------------------NTIQFRNV-DVGT.-----CM--TSFPGF
Q7DK11_AGGAC/39-178.....---..GG---------------------------------------TLVQFKVV-GAAK.-----CF--AF...P
Q9RFY4_HELHT/29-183..PFD---KFNL---------------------------------------GAMQFVNA-DDPKS-----CL--GI...D
O32587_ECOLX/37-179.....---..QS---------------------------------------GWIMIRTP-NTDQ.-----CL--GT....
CDTA_HELHP/86-226WRIIS---FSN.---------------------------------------GQVIIKNM-QEGT.-----CL--QA...Y
CDTA_HAEDU/77-221WKMEP---GKHR---------------------------------------EYFRFVNQ-SLGT.-----CV--EA...Y
Q6EZE1_ECOLX/49-197WKVVD---GKDA---------------------------------------GTVKFVNV-AQGT.-----CM--EA...F
CDTA_CAMJJ/115-260WQLLL---YPN.---------------------------------------DFAMIKNA-KTNT.-----CL--NA...Y
Q47090_ECOLX/44-187.....---..PG---------------------------------------GHVQIKNP-DGNE.-----CF--AI....

PF05588

O06016_CLOBO/1-147WKLQY---VEEKNAYKIS---------------------------------NIAQPDKY-LTYNSSQFIVLK--NIGDST
Q9LBT0_CLOBO/1-146WKLEY---ISSSNGFRFS---------------------------------NVAESNKY-LAYNDYGFIYL.--...SSS
Q45841_CLOBO/1-146WNVEY---MAENRCFKIS---------------------------------NVAEPNKY-LSYDNFGFISL.--...DSL

PF07468

Q38719_AMAHP/2-154L---V---RWSPNH-------------------------------------YWITASAN-EPDENKSNWACTLFKPLYVE
Q38719_AMAHP/159-299W---R---LSTDN.-------------------------------------.WILVDGN-DPRE..TNEAAALFRS...D

PF08709

ITPR1_MOUSE/4-229---------------------------------PALLEKNAMRVTLDEAG----------------------------N.
A7SEK1_NEMVE/3-227---------------------------------PALREKNAMRVTLDPNG----------------------------N.
A8HAL5_DANRE/4-229---------------------------------PALLEKNAMRVSLDPSG----------------------------N.
O13054_MAKNI/9-216---------------------------------RSLTDKLAFDVGLQEDS----------------------------TG
O77089_PANAR/5-231---------------------------------PALLEKNAMRVYLDANG----------------------------N.
P91905_CAEEL/13-215---------------------------------.SSNDKLAFDVGVQETN----------------------------EG
ITPR3_HUMAN/3-230---------------------------------PALLEKNAMRVTLDATG----------------------------N.
RY44_DROME/11-206---------------------------------.SSNDKLSFDVGLQEHS----------------------------QG
Q27J07_APLCA/1-225---------------------------------PALLEKNAMRVILDSSG----------------------------N.
Q4DBL7_TRYCC/3-204---------------------------------PSKSDPNCVRLVLVKAG----------------------------EV
Q4QEZ2_LEIMA/11-201---------------------------------YAAGMKGNHHVLLETRR----------------------------RD
Q4RLR0_TETNG/15-213---------------------------------RSQTDKLSFDVGLQEDS----------------------------TG
Q4RY06_TETNG/4-165---------------------------------.................----------------------------..
Q57XB2_TRYB2/3-212---------------------------------PSERDPDCARLVLAPPG----------------------------EI
Q5TQX0_ANOGA/7-234---------------------------------PALLEKNAMRVYLDANG----------------------------N.
Q66S77_OIKDI/1-221---------------------------------PALLERNSMRVLLDSDG----------------------------N.
Q8TA74_HEMPU/8-204---------------------------------.SSKDKLAFDVGLQEST----------------------------QG
ITPR_ASTPE/4-229---------------------------------PALLEKNAMRVTLDSSA----------------------------T.
Q9Y0A1_CAEEL/78-317---------------------------------PAKRERNAMKVYLDRAG----------------------------N.

PF02815

RYR2_RABIT/226-406.........................NLLLMDKEKADVKSTAFTFRSS...............................KE
Q6J9T9_ASPFM/358-545..........................PPVTDV.DWQFEVSAYGYEGFPGD...........................AND
RYR3_HUMAN/216-398.........................GLILQDRAKSDTKSTAFSFRASKEL............................KE
Q759J8_ASHGO/342-519..........................PPVSVSSDWQKEVSGYGFPEFEGD...........................AND
ITPR_ASTPE/231-419.......................NTKDHTREKLRGPHGGTVYQMVPIIHG............................ND
Q6FL03_CANGA/354-530..........................PPVSESADWQKEVSGYGYLGFTGD...........................IND
Q9GS15_CAEBR/327-562PAMN.............GRPPLLSTLSQKSKILERTQSPLASMYSDGPNGGNDTSDASDGPT...VSFLSPKKSDFPEDD
PMT1_SCHPO/329-505..........................PIVSNN.DWQLEASAYGGFGFEGD...........................AND
Q91313_LITCT/214-394.........................GLVLVDAEKANTKATAFCFRIS...............................KE
Q7SH94_NEUCR/369-558..........................PPVTEA.DWQNEVSAYGYEGFDGD...........................AND
O13054_MAKNI/219-399.........................GLLLVDPEKAVSKMSAFCFRIS...............................KE
ITPR_DROME/239-453GAMSATSASGHDLHLGDCSKDSGLSCSTMNSTINDKPKGKQYRLVSVPYS............................AD
Q6W3E4_RAT/232-432AQN..............EGKTVRDGELPTSKKKRQAGEKIMYTLVSVPHG............................ND
ITPR1_HUMAN/232-433ECLE.............FQPSVDPDQDASRSRLRNAQEKMVYSLVSVPEG............................ND
Q6BFC5_PARTE/240-444.................................KETEDKSRFLLTSV...............................SD
Q8TA74_HEMPU/220-400.........................TVCIVPRKSCNLDDTIFCFQQS...............................RE
Q6FK90_CANGA/355-531..........................SPLYPT...NEEITTVHKDDALGA...........................RAN
Q8MXI9_CAEEL/274-503.....................PAMNGRRASLIYSKTNNPMA.MYSDGPNGVTNESTDTTQQNIPSVWVLGPTKSEFPEED
Q96WN5_EMEND/353-528..........................APITKN...HHEVSCYGNLTI.GD...........................DKD
P91905_CAEEL/220-400..........................VQLYHKEKADFDLTAFVMCQN...............................KD
O77089_PANAR/234-422.......................PTPDPTRTKLRDPNGGPVYQLVSVPLS............................ND
Q6CPY0_KLULA/347-524..........................PPVSESSDWQKEVSAYGADNFTGD...........................AND
Q6CAY4_YARLI/355-531..........................APLTKG...DHEVSCYGNLTI.GD...........................NKD
Q6C5U6_YARLI/339-516..........................PPVSEA.DYQNEVSAYGYPGFDGD...........................AND
RY44_DROME/211-392.........................ELILVKKEEASIATTTFCLRQE...............................KD
RYR1_PIG/212-391.........................GLVVVDASKAHTKATSFCFRIS...............................KE
PMT5_YEAST/339-517..........................PPVSQNADWQKEVSCYGYEGFEGD...........................IND
PMT1_CANAL/359-534..........................PPVSER.DWQKECSCYGYDGFAGD...........................AND
PMT1_YEAST/343-520..........................PPVSESSDWQKEVSCYGYSGFDGD...........................AND
ITPR3_RAT/233-432DVS...............DPKAAGPGAQSRTGRRNAGEKIKYRLVAVPHG............................ND

PF06268

FASC_STRPU/393-496RIV-------L---G----------EA....-AGTF--------------------------------------------
Q6AXQ1_RAT/24-138TVC-------Y---G----------KP..RT-SHHG--------------------------------------------
SING_DROME/33-147NVL-------C---E----------SD..ER-DAGS--------------------------------------------
FSCN2_HUMAN/389-492SVC-------S---D----------GE..R.-AEDF--------------------------------------------
FSCN3_HUMAN/271-381AVM-------A---D----------GH..PL-ESDT--------------------------------------------
FSCN1_HUMAN/268-378GVQ-------S---T----------AS..SK-NASC--------------------------------------------
Q6PBS5_DANRE/19-131KVS-------C---E----------AE..TK-ENDC--------------------------------------------
FASC_XENLA/382-483SVT-------S---R----------CH....-.PGW--------------------------------------------
FASC_STRPU/138-254QLA-------G---T----------AN....-.EQT--------------------------------------------
FSCN2_HUMAN/20-133RVA-------C---E----------AE..QP-GRDC--------------------------------------------
Q6AZJ6_XENLA/277-387GIQ-------A---S----------AS..TL-NSSC--------------------------------------------
Q6EEB3_PRODO/230-340GIQ-------S---S----------AS..TL-NASC--------------------------------------------
FSCN2_HUMAN/141-254RLV-------W---E----------PE....-.PRA--------------------------------------------
FSCN1_HUMAN/391-493AVT-------S---S----------GD..T.-PVDF--------------------------------------------
FSCN2_HUMAN/266-376GIH-------A---T----------AT..QV-SANT--------------------------------------------
Q6EE45_SCYCA/96-208LLV-------E---K----------PE....-.RGT--------------------------------------------
FSCN1_HUMAN/20-134NVT-------C---E----------RE..VP-GPDC--------------------------------------------
Q6AZJ6_XENLA/152-265SLR-------D---Q----------SG....-.PDT--------------------------------------------
FASC_STRPU/16-130NVY-------C---S----------VEDRTE-DADT--------------------------------------------
Q6AZJ6_XENLA/32-144KVF-------G---E----------ID..TP-GPEC--------------------------------------------
FSCN1_HUMAN/142-256RLV-------A---R----------PE....-.PAT--------------------------------------------
SING_DROME/155-270KLQ-------V---V----------CN....-.EDC--------------------------------------------
Q6PBS5_DANRE/139-252KLS-------S---E----------NG....-.RGT--------------------------------------------

PF06229

Q7QC94_ANOGA/71-260MIT-------G---R----------SD--AV-SALE--------------------------------------------
A7RWZ5_NEMVE/69-257DIT-------G---R----------AE--AI-GPQE--------------------------------------------
Q15ER4_SCHMA/95-286ILG-------A---T----------AD--AV-GVFE--------------------------------------------
A1D4G2_NEOFI/89-280ILS-------A---S----------AS--AI-SHYE--------------------------------------------
Q96MD3_HUMAN/4-156LVV-------G---R----------SD--AI-GPRE--------------------------------------------
Q2UKA8_ASPOR/84-274ILS-------A---A----------SS--AI-SHQE--------------------------------------------
FRG1_DROME/72-260MVT-------G---R----------SE--AV-GGME--------------------------------------------
Q6DDA8_XENTR/66-254LVI-------G---R----------SD--AI-GARE--------------------------------------------
FRG1_CAEEL/78-273QLV-------A---M----------AE--AI-GSRE--------------------------------------------
Q0UA03_PHANO/83-265ILS-------A---N----------AT--AM-SPEE--------------------------------------------
A2Q890_ASPNC/96-312ILS-------A---N----------AS--AI-SQHE--------------------------------------------
Q566W5_DANRE/65-253VVV-------G---R----------SD--AI-GSRE--------------------------------------------
A6SI98_BOTFB/86-272ILS-------A---N----------TE--AV-SPLE--------------------------------------------

PF04601

Q9LJJ2_ARATH/1-141MFL-------G---M----------TGKRVT-QTLPRR..LDSST-----------------------------------
Q9LQ43_ARATH/1-142FLL-------G---A----------TGKKVL-QTKPSR..LDSSL-----------------------------------
Q9CAS3_ARATH/251-396FLL-------G---A----------TGHKVV-QSRKIR..ADEPA-----------------------------------
O04559_ARATH/227-368FLL-------G---A----------TGKKVI-QLKLSR..VDSSV-----------------------------------
O04559_ARATH/1-144LLL-------G---M----------TGEKVT-QTASFNKLMDWQT-----------------------------------
Q9CAS2_ARATH/1-139FLL-------G---A----------TGRKVV-LSKPAR..LDSSV-----------------------------------
Q9CAS3_ARATH/1-144FLL-------G---M----------TGAKVI-QTPPFR.QAEHES-----------------------------------

PF00167

Q28XC7_DROPS/16-141RLV.......G...K..........RN--AT.N.DC--------------------------------------------
Q4S3V1_TETNG/61-182RLF.......G...T..........KR--AT.D.EC--------------------------------------------
P91672_DROME/249-377VPY.......G...S..........KD--FT.D.DC--------------------------------------------
Q8R5L5_RAT/84-205RLY.......T...T..........PS--FQ.D.EC--------------------------------------------
B1AK17_HUMAN/79-205YLY.......T...S..........EL--FT.P.EC--------------------------------------------
FGF1_CHICK/25-148LLY.......G...S..........QL--PG.E.EC--------------------------------------------
Q8I6J6_CIOIN/91-218RVF.......T...R..........RS--FR.H.DC--------------------------------------------
Q9YH31_NOTVI/72-193RLF.......G...S..........KY--FS.D.EC--------------------------------------------
FGF16_MOUSE/61-187ELY.......G...S..........KK--LT.R.EC--------------------------------------------
Q5TLD5_DANRE/43-168MLQ.......G...K..........KD--YN.D.SC--------------------------------------------
A1YJ27_NPVSF/70-196YVF.......S...S..........KT--PT.F.EC--------------------------------------------
Q90XQ4_AMBME/55-181KLI.......G...K..........SN--GR.GKDC--------------------------------------------
Q86GG2_CIOSA/55-180RLV.......GKVLR..........RA--KH.DLKC--------------------------------------------
Q8I6J7_CIOIN/133-264KLY.......A...S..........RN--YR.KIDC--------------------------------------------
FG17_DANRE/53-178KLV.......G...K..........PN--GR.GRDC--------------------------------------------
Q9E225_9ABAC/33-160YVY...........T..........AI--VP.NSEC--------------------------------------------
Q8I6J5_CIOIN/56-181RLV.......GKNYR..........KA--IN.DPKC--------------------------------------------
Q4SAA6_TETNG/81-202RLY.......G...T..........SV--FV.D.EC--------------------------------------------
Q2NP32_NPVHC/29-154AMY.......A...S..........AA--LS.S.DC--------------------------------------------
Q4RWE4_TETNG/71-205HLY.......T...SASGA..PSPMEL--FT.A.EC--------------------------------------------
FGF1_NOTVI/2-125QLY.......A...S..........QS--PS.E.EC--------------------------------------------
Q544I6_MOUSE/65-189KLY.......A...K..........KE--CN.E.DC--------------------------------------------
Q8VI79_RAT/32-156RLY.......G...S..........RV--YS.V.DC--------------------------------------------
A3EXK2_NEMVE/57-180RLR.......A...R..........KR--ARNKKNC--------------------------------------------
Q4RSP6_TETNG/17-145EVY.......G...AVS......IRRE--FG.V.DC--------------------------------------------
FGFH_NPVOP/29-156AMY.......A...S..........AA--LS.S.DC--------------------------------------------
Q5M7N7_XENTR/65-189RLY.......G...K..........KS--CN.E.DC--------------------------------------------
FGF1_XENLA/25-148QLY.......G...T..........LT--PN.E.EC--------------------------------------------
O92401_NPVBM/28-154QLY.......G...S..........KT--LS.D.DC--------------------------------------------
A6Y7S4_DIDAL/29-153RLL.......A...L..........KY--VT.E.EC--------------------------------------------
Q66IF7_XENTR/61-197RLY.......A...S..........ET--YN.P.EC--------------------------------------------
Q4T869_TETNG/30-155KLV.......A...K..........PN--GE.SREC--------------------------------------------
Q91BB2_NPVST/26-158YVYTLAANGGA...G..........GV--LS.Q.DC--------------------------------------------
Q9N1B9_SHEEP/84-207KLY.......G...S..........KE--FN.N.DC--------------------------------------------
A7RZP2_NEMVE/41-163RLT.......S...R..........KI--PK.SPKC--------------------------------------------
LE756_CAEEL/72-207KLY.......A...T..........PS--SNYSTEC--------------------------------------------
Q8R5L6_RAT/78-192KLF.......G...V..........PF--FT.D.EC--------------------------------------------
Q8T8A3_CIOSA/159-283RLY.......G...S..........ET--FT.H.ES--------------------------------------------
A7YT71_DANRE/25-149RLY.......G...T..........AV--LN.E.EC--------------------------------------------
Q4SCS5_TETNG/71-197YLY.......T...S..........EN--FT.P.EC--------------------------------------------
A7SH09_NEMVE/102-230QVY.......A...T..........AN--TS.V.ET--------------------------------------------
FGF1_DANRE/17-138KLY.......A...S..........SL--VT.D.ES--------------------------------------------
Q287N3_NPVAS/32-156YGY.......S...A..........VL--PN.S.EC--------------------------------------------
Q80LI4_NPVAH/49-164YYY.......I...A..........KN--PN.Y.DC--------------------------------------------
Q5TKR7_DANRE/53-179KLI.......G...K..........KD--SSVNGGC--------------------------------------------
Q8QLI3_9ABAC/34-158YGY.......S...A..........LI--PN.N.EC--------------------------------------------
Q2LGG1_DANRE/81-202RLY.......G...T..........RA--FR.D.EC--------------------------------------------
FGF18_MOUSE/53-178KLV.......G...K..........PD--GT.SKEC--------------------------------------------
Q9J897_9ABAC/33-159YGY.......S...A..........LL--PN.G.EC--------------------------------------------
Q0PV85_HALRO/186-312RLY.......G...S..........EK--LS.R.NC--------------------------------------------
Q1LXT4_DANRE/17-141TLF.......G...S..........AR--YN.P.SC--------------------------------------------
Q1HGX9_NPVAP/32-158TMY.......A...S..........AT--VS.S.DC--------------------------------------------
Q4SFA3_TETNG/9-140KLY.......G...SVSIDAGPRLDGH--YS.N.DC--------------------------------------------
Q9DFC9_DANRE/67-188KLY.......G...S..........EQ--FT.N.EC--------------------------------------------
A5PM81_DANRE/55-181FLY.......S...S..........EM--FT.P.EC--------------------------------------------
A7SRV3_NEMVE/407-534RLR.......AKRVS..........ES--RR.W.DT--------------------------------------------
Q8NF90_HUMAN/87-216KLH.......A...S..........AK--FT.D.DC--------------------------------------------
FGF11_HUMAN/71-197LLY.......S...S..........PH--FT.A.EC--------------------------------------------
Q0KJ02_ORYLA/70-196ELY.......G...S..........AK--LS.A.ES--------------------------------------------
FGF4B_XENLA/68-189KLY.......G...S..........RY--FN.E.EC--------------------------------------------
A7RFG7_NEMVE/73-195RLY.......T...T..........RN--RT.EENV--------------------------------------------
Q4VBV7_DANRE/72-196VVY.......G...A..........RD--FG.I.DC--------------------------------------------
FGF3_DANRE/62-204RLY.......A...S..........EV--FN.R.EC--------------------------------------------
Q4SJV9_TETNG/17-140QLY.......G...S..........PT--VT.D.EC--------------------------------------------
Q6VTW1_NPVCD/28-157VMY.......A...S..........AV--LS.S.DC--------------------------------------------
Q8QG59_AMBME/67-191RVY.......G...S..........RE--FT.T.DC--------------------------------------------
Q3YAG3_STRPU/203-330SLY.......G...D..........TR--VS.R.NC--------------------------------------------
FGF17_RAT/53-178KLI.......G...K..........PS--GK.SKDC--------------------------------------------
A7SHR3_NEMVE/45-169KLT.......L...E..........DN--GA.SQNC--------------------------------------------
Q5TLE2_DANRE/41-170RLH.......A...T..........ES--FT.D.DC--------------------------------------------
Q6E7C8_OIKDI/1583-1704RVK.......G...T..........TK--KG.KATE--------------------------------------------
Q9PVY1_XENLA/62-188ELF.......G...S..........EK--LT.S.EC--------------------------------------------
Q8JMA6_9ABAC/35-159YGY.......S...A..........LI--PN.N.EC--------------------------------------------
Q1XG75_DANRE/59-183ELF.......G...V..........RN--YG.T.NC--------------------------------------------
Q0IIQ7_DANRE/50-175KII.......G...K..........PN--GN.SQEC--------------------------------------------
A7T359_NEMVE/53-177DIS.......IEESV..........LG--RS.LDRC--------------------------------------------
Q5GAD8_9VIRU/23-148VVS.......A...K..........TT--YV.QSDC--------------------------------------------

PF00340

IL1B_BOVIN/144-261KRF-----------------------------------------------------------------------------
IL1RA_MOUSE/61-174KRF-----------------------------------------------------------------------------
IL1RA_HUMAN/60-173KRF-----------------------------------------------------------------------------
IL1B_FELCA/146-263KRF-----------------------------------------------------------------------------
Q9GL09_SHEEP/72-185IIF-----------------------------------------------------------------------------
IL1A_MOUSE/158-269LIF-----------------------------------------------------------------------------
Q96KJ8_HUMAN/72-185IIF-----------------------------------------------------------------------------
IL1B_CERAT/147-264KRF-----------------------------------------------------------------------------
Q9I8D2_CHICK/66-187IIF-----------------------------------------------------------------------------
IL1B_PIG/145-262KRF-----------------------------------------------------------------------------
IL1B_MOUSE/148-264KRF-----------------------------------------------------------------------------
IL1A_RABIT/156-266ILF-----------------------------------------------------------------------------
IL1A_BOVIN/156-265LLF-----------------------------------------------------------------------------
Q91Z66_SIGHI/73-186LIF-----------------------------------------------------------------------------
IL1A_CERAT/155-266SLS-----------------------------------------------------------------------------
IL1RA_RABIT/60-173KRF-----------------------------------------------------------------------------

PF05270

OTOG_MOUSE/1241-1384SIG-------LAKWQ----------RD--EAFHQHA--------------------------------------------
ABFB_ASPOR/358-502ALL-------LNAND----------GT--KQFYEDA--------------------------------------------
Q82P18_STRAW/329-465RAR-------FDADD----------GT--PTFAKDA--------------------------------------------
Q829S7_STRAW/176-312RLR-------ADRND----------GT--ALFKKDA--------------------------------------------
Q55841_SYNY3/35-174RII-------LSANE----------NN--DLFRQDA--------------------------------------------
Q9HEY2_COCCA/355-499VLQ-------VNAND----------GS--KGFKEDA--------------------------------------------
Q86ZN9_FUSOX/351-495TLY-------VNKGD----------GS--KSFNEDA--------------------------------------------
Q82P90_STRAW/346-481EVW-------VEKND----------GS--SAFKNDA--------------------------------------------
ABFB_EMENI/357-506ALL-------LNAND----------GT--KLFSEDA--------------------------------------------
ABF1_HYPJE/352-496GLV-------LNAND----------GS--KLFAEDA--------------------------------------------
ABFB_ASPKW/350-494ELL-------LNAND----------GT--KQFHEDA--------------------------------------------

PF00197

IT2_PSOTE/2-176KCA-----------PSP.....FWTVVKDQSERLP.SIKLGEYKD...SE------------------------------
IAAS_ORYSJ/26-193..I-----------CVQ...STEWHVGDEPLTGAR.RVVTGPLIGPSPSG------------------------------
MIRA_RICDU/35-216...-----------PCRWTSSTVWRLDKYDESTGQYFVTIGGVKGNPGPE------------------------------
ALB1_PSOTE/4-171DPH-----------KGD.....VWSVVDFQPDGQQ..LKLAGRYP....N------------------------------
ASP_THECC/30-208DRL-----------CST...STVWRLDNYDNSAGKWWVTTDGVKGEPGPN------------------------------
IAAS_HORVU/27-199..T-----------CLQST...EWHIDSELAAGRR.HVITGPVKDPSPSG------------------------------
API8_SOLTU/39-219VKL-----------CVS...YTIWKVGNLNAYFRTMLLETGGTIG....Q------------------------------
ICW3_PSOTE/27-198SCA-----------ASP.....WWTVVDSPQG..P.AVKLSQQKL...PE------------------------------
IDE3_ERYCA/1-168KCA-----------PSP.....WWTVVEDEQE.GL.SVKLSEDES...TQ------------------------------
IECI_ERYVA/2-173SCA-----------ASP.....WWTVVETSEG..L.AVKLLEHKT...PE------------------------------
IT1A_PSOTE/2-168KCA-----------PSP.....WWTVVEDQPQ.QP.SVKLSELKS...TK------------------------------
ITRA_SOYBN/26-199LCV-----------GIPT....EWSVVEDLPE.GP.AVKIGENKD...AM------------------------------
ITRY_ACACO/2-171LPA-----------CLQKYSTLPWKVEGESQE.....VKIAPKEK...EQ------------------------------
KTI1_SOYBN/27-197LCA-----------GMPT....EWAIVERE...GL.QAVKLAARD...TV------------------------------
CPI1_SOLTU/47-221TKL-----------CVDQT...VWKVNDE.....Q.LVVTG.....GKVG------------------------------
SPOR1_IPOBA/42-216NKL-----------CVN...NVNWGIQ.HDSASGQYFLKAGEFVSD...N------------------------------
GWIN3_POPSP/32-195CGM-----------AGVTP...MWKIGFNSTAKGY.IVTTGGVDR.....------------------------------

PF07951

BXB_CLOBO/1075-1291NQE-----------WR.V.....YTYKYFKKE.EEKLF.LAPISDSDEFY------------------------------
BXE_CLOBU/1063-1250KTH-----------LLPLYADT......ATTN.KEKTI...KISSSGNRF------------------------------
TETX_CLOTE/1105-1314NNE-----------HI.V......GYPKDGNA.FNNLDRILRVGYNAPGI------------------------------
BXA1_CLOBO/1088-1293NKE-----------YR.LATNA......SQAG.VEKILSALEIPD.VGNL------------------------------
BXG_CLOBO/1083-1297DES-----------YR.VYVLV.....NSKEI.QTQLF....LAPINDDP------------------------------
BXC1_CLOBO/1089-1291NKA-----------YN.LFMKNETMYADNHST...EDIYAIGLREQTKDI------------------------------
Q45851_9CLOT/1072-1268NSE-----------YQ.LYADV......STSA.VEKTIKLRRISNSNYNS------------------------------
Q45967_CLOBO/1085-1285NKQ-----------YS.L.....GMYKPSRNL.GTDLVPLGALDQPMDEI------------------------------
BXF_CLOBO/1083-1274GVE-----------YR.LYAD.......TKSE.KEKII...RTSNLNDSL------------------------------
BXD_CLOBO/1076-1276SRK-----------YM.IIRDTDTIYATQGGECSQNCVYALKLQSNLGNY------------------------------

PF14200

C6I1A8_9BACE/97-198G..-----------------------------------------------------------------------------
A8NAT6_COPC7/44-145G..-----------------------------------------------------------------------------
A8P1Y0_COPC7/90-188G..-----------------------------------------------------------------------------
A8PCJ2_COPC7/37-137D..-----------------------------------------------------------------------------
A1Z5I4_BEABA/43-129G..-----------------------------------------------------------------------------
A6EHX4_9SPHI/63-161G..-----------------------------------------------------------------------------
A6ERL3_9BACT/65-184G..-----------------------------------------------------------------------------
A6G9W3_9DELT/412-502E..-----------------------------------------------------------------------------
A6G9W3_9DELT/550-640D..-----------------------------------------------------------------------------
A7EWX9_SCLS1/45-151HQY-----------------------------------------------------------------------------
A7WK54_LYSSH/385-485G..-----------------------------------------------------------------------------
A8NDJ7_COPC7/40-145EGR-----------------------------------------------------------------------------
A8NDJ7_COPC7/189-287G..-----------------------------------------------------------------------------
A9E912_9FLAO/86-187D..-----------------------------------------------------------------------------
B0DSD3_LACBS/40-138N.V-----------------------------------------------------------------------------
B0MJQ2_9FIRM/249-352G..-----------------------------------------------------------------------------
B1VUB2_STRGG/50-155G..-----------------------------------------------------------------------------
B2WIQ5_PYRTR/45-143G..-----------------------------------------------------------------------------
B2ZRS9_CLINE/46-144S..-----------------------------------------------------------------------------
B3C971_9BACE/378-483G..-----------------------------------------------------------------------------
B3PKR2_CELJU/520-621G..-----------------------------------------------------------------------------
B4V2C9_9ACTO/39-139A.P-----------------------------------------------------------------------------
B4V8E2_9ACTO/575-676G..-----------------------------------------------------------------------------
B5GTM6_STRCL/44-154E.A-----------------------------------------------------------------------------
B6SS31_MAIZE/56-169G..-----------------------------------------------------------------------------
B8P008_POSPM/56-152G..-----------------------------------------------------------------------------
B8P2U3_POSPM/41-134G..-----------------------------------------------------------------------------
B8PDH6_POSPM/53-148G..-----------------------------------------------------------------------------
C0PSY5_PICSI/62-180K..-----------------------------------------------------------------------------
C3I9T1_BACTU/507-614G..-----------------------------------------------------------------------------
C4LYE8_ENTHI/157-265G..-----------------------------------------------------------------------------
C4M3J3_ENTHI/137-243G..-----------------------------------------------------------------------------
D9STT7_CLOC7/601-707G..-----------------------------------------------------------------------------
C6D9K8_PECCP/404-505G..-----------------------------------------------------------------------------
C6L2F6_APOCT/307-416E..-----------------------------------------------------------------------------
C6L2F6_APOCT/611-715G..-----------------------------------------------------------------------------
C7PHL4_CHIPD/338-435D..-----------------------------------------------------------------------------
C9YYM1_STRSW/484-581G..-----------------------------------------------------------------------------
D1BKB8_SANKS/626-731G..-----------------------------------------------------------------------------
D1Q0S6_9BACT/375-479G..-----------------------------------------------------------------------------
D2QTB1_SPILD/373-478G..-----------------------------------------------------------------------------
D2S061_HALTV/623-726D..-----------------------------------------------------------------------------
D2VXQ3_NAEGR/45-151N..-----------------------------------------------------------------------------
D3Q6V6_STANL/130-238K..-----------------------------------------------------------------------------
D4J5M3_9FIRM/492-590G..-----------------------------------------------------------------------------
D4J5M3_9FIRM/739-837G..-----------------------------------------------------------------------------
Q8A5P7_BACTN/65-167G..-----------------------------------------------------------------------------
Q8X123_9AGAR/44-154G..-----------------------------------------------------------------------------
Q9L153_STRCO/584-686G..-----------------------------------------------------------------------------

PF00652

GALT3_MOUSE/505-627QGV-----------................VQLKACVY.----KGHRTIA------------------------------
CRBG3_HUMAN/888-1017GGR-----------D..........TPGAKVALWTEH..----GQFR...------------------------------
GLT10_CAEEL/536-662TSV-----------............DKAPVILFDCHS.----MKGN...------------------------------
CUPF_DICDI/32-142SGG-----------..............YFVELVQLNS.----NSKT...------------------------------
Q7QIK5_ANOGA/491-617ASK-----------...........SESKFVVMIPCIDD----EDID...------------------------------
Q7PZM5_ANOGA/438-564KLN-----------..............DEIVLFSCHE.----SQGN...------------------------------
Q7Q0E9_ANOGA/461-587ESV-----------............PNAKILLYHCHG.----GQGN...------------------------------
Q7QDR0_ANOGA/437-565QSK-----------............PGSPVTIFTCHM.----HQGN...------------------------------
ML1_VISAL/440-560RDS-----------............VSTVINIVSCSA.----GSSG...------------------------------
O96048_LUMTE/132-255HEQ-----------................IETQPFDP.----NNPK...------------------------------
GALT7_CAEEL/478-592GIR-----------................IQANHCVK.----GTVN...------------------------------
GLTL2_HUMAN/505-628QEQ-----------................VILQNCTE.----EGLAI..------------------------------
GLT13_DROME/435-548FGM-----------...............RIALEPCGR.----NETVR..------------------------------
Q7NQK0_CHRVO/5-133DLS-----------............SGKPLVLKPYNPG----AVS....------------------------------
GALT4_CAEEL/461-580SNT-----------............ENKTVTMVKCEN.----LRPDTMV------------------------------
Q8W2E8_IRIHO/447-569THD-----------............QGSQIILLSCNF.----GGAS...------------------------------
Q9SLV9_CUCSA/35-159VFY-----------...........GVINKAVVSECGKV----SDPN...------------------------------
AGALA_ASPNG/424-536GNL-----------................VKLQACDST----DSDG...------------------------------
GALT1_MOUSE/430-548KLN-----------..............GPVTMLKCHH.----LKGN...------------------------------
GALT3_DROME/512-658QQK-----------LGVIKMLKNRNATTSNVMLAQCAS.----DSS....------------------------------
Q7Y0V1_9FABA/7-131GYA-----------............PGDYVMIYNCTSP----VPEA...------------------------------
GLT12_MOUSE/440-569DGK-----------..............DTLVMDLCRET----VPEN...------------------------------
Q9ADL1_SORCE/171-307SAS-----------T..........ADGAAIVQYTCH..----DNAN...------------------------------
Q8C2S1_MOUSE/660-788GSL-----------V..........TSGSKLGLALDQN.----VDS....------------------------------
Q9X583_9ACTO/367-502ANR-----------T..........ANGTTMTVWDAN..----GGAH...------------------------------
GALT9_MACFA/467-595GRG-----------..............RTPTLRKCED.----VARPT..------------------------------
Q8KKH3_BACCI/270-405SSS-----------T..........STGVQLQQWDDNG.----SNA....------------------------------
GALT5_HUMAN/810-932PDK-----------..............GAVRLHPCDN.----RNKG...------------------------------
Q7SBD7_NEUCR/100-230GDT-----------................IDVAPCNP.----GDSS...------------------------------
O04071_SAMNI/439-558SSD-----------...............LIIILKCQ..----GSSN...------------------------------
Q9HFA9_9TREE/43-172TNP-----------...........GDGSKVHLWQCYA.----GLAQ...------------------------------
Q9EWL6_STRCO/70-209GGS-----------T..........AKGTPAVQRTCDG.----SKD....------------------------------
Q824Z7_STRAW/111-218SRG-----------................LRLVKCNG.----SRY....------------------------------
Q9HFB1_9ASCO/416-528QGN-----------..................ILSSSSG----DST....------------------------------
Y1454_MYCBO/33-153NAL-----------...............WARLQPCVN.----WIS....------------------------------
Q6TBQ9_CRYPV/535-659...-----------.............GSNLKYAACSN.----SEMT...------------------------------
Q825I1_STRAW/713-838LGY-----------...............SVQLAACAG.----ESQPGT.------------------------------
Q7TLZ3_9ZZZZ/377-504NNQ-----------T..........TPGTKVDIWTCN..----GGAN...------------------------------
Q7X2C9_STRTE/266-386GTG-----------............NGASVQIYSCW..----GGDN...------------------------------
GALT9_DROME/521-640GKD-----------................VTLFGCHG.----GKGN...------------------------------
GLT10_DROME/483-615GLR-----------.............SKSVWLFRCHK.----NGGN...------------------------------
Q825L5_STRAW/296-417ENG-----------T..........ADGSTVQLWDCG..----GSAN...------------------------------
Q6BE06_BACTU/699-826NSG-----------................TSVTAETNQ----NRPN...------------------------------
ENVE_SALTY/53-170GQG-----------T..........KEGTPIILYSCTG.----NDN....------------------------------
Q6YBY0_TOXGO/500-612G..-----------.................RLDWCRG.----TAQ....------------------------------
O86669_STRCO/329-444ARK-----------................AGLTRCEP.----GRPN...------------------------------
FLVS_FLAME/296-437NNG-----------T..........ANGTAVELRTNAD.----TDA....------------------------------
Q8RTY5_9GAMM/861-988GGN-----------T..........QDHSQLALAPCDA.----SNPA...------------------------------
Q7VN40_HAEDU/61-177SEN-----------K..........FDGARIIAYRCHG.----GKN....------------------------------
GLTL3_HUMAN/465-591SKS-----------..............RLPQLLDCDK.----VKSSL..------------------------------
Q82LA2_STRAW/332-460...-----------T..........ENVTAVTQENCT..----AATS...------------------------------
GALT3_CAEEL/484-604HVY-----------...........QIGSELKLERCSV.----SKINV..------------------------------
GLTL1_HUMAN/431-552STL-----------M.........SSPGSPVILQMCNP.----REGK...------------------------------
Q825H7_STRAW/402-529AVD-----------..............GVAELGRCVA.----ESSAHG.------------------------------
GALT7_DROME/467-582RQG-----------................IKLAVCRL.----GTVD...------------------------------
Q8VUT1_9PSED/305-438GSS-----------S..........ANGAVVIQWDCFN.----G......------------------------------
Q70US9_ADEVO/400-521GSC-----------...........VKLAKIVNTDCA..----GSAN...------------------------------
GALT8_DROME/446-570NHG-----------..............VNVHIYQCHG.----QSGN...------------------------------
Q9K438_STRCO/427-551GNG-----------T..........ANFTKVQVWDCAP.----GVGG...------------------------------
Q7SIF1_TRIKI/2-122AAE-----------.............QAKAGIYDCTQA----TAEL...------------------------------
GALT4_MOUSE/444-574QQK-----------..............DYVGMQNCPK.----..DGLPV------------------------------
GALT4_DROME/511-641EGP-----------............PNATVWMWSCHS.----QGGN...------------------------------
GALT6_CAEEL/475-606QLL-----------H.........TTSDWKIQLKECAG.----FDT....------------------------------
GLT11_CAEEL/482-602RG.-----------................ISVILCHNQ----GAH....------------------------------
Q8GB62_9GAMM/313-450SGS-----------S..........ADGAKVQQWVCNH.----ANTS...------------------------------
Q6BE03_BACTU/674-805GAN-----------................VKVVSYQN.----NNTA...------------------------------
O68641_CELCE/306-433DGS-----------T..........TRGAAVQVWTCN..----GTGA...------------------------------
Q8RTY5_9GAMM/724-853GQA-----------...........YNEGEIVVWECVD.----SDN....------------------------------
Q9RDQ1_STRCO/383-509RDG-----------T..........ADGTRIQQWTCKQ.----NGA....------------------------------
Q9SLV9_CUCSA/165-289QDF-----------.............GRFVVVSKCED.----KPQ....------------------------------
GLT11_DROME/425-535YKN-----------...............NVRATKCTK.----KLSK...------------------------------
Q9L0N4_STRCO/326-472EYG-----------A.........RPEGTGVAEFHCNGT----KADN...------------------------------
GALT7_MOUSE/533-649PDG-----------..............SKVMITHCNL.----NEF....------------------------------
GALT2_DROME/507-627TFA-----------............RGSQVVLKACDD.----SEN....------------------------------
GLT10_HUMAN/459-587SHT-----------..............SPVTLYDCHS.----MKGN...------------------------------
Q9K473_STRCO/837-959GGG-----------T..........ADGTRIQLWTCN..----GSGA...------------------------------
GLT12_DROME/433-546PNL-----------...............RLGYSFCHS.----LGGR...------------------------------
GALT1_DROME/473-597HSE-----------...........SPPYRVVMVPCMEN----DEFN...------------------------------
AHV_ACTSK/47-157YDG-----------...............AVYTLPCNG.----GSY....------------------------------
Q8LKQ3_VISAL/8-135GYT-----------............AGSYIMIYDCNRG----GWDL...------------------------------
Q82HL7_STRAW/418-544GST-----------.............DRGVGIWECGA.----VYGRNG.------------------------------
GALT9_CAEEL/450-571NGN-----------................IRMKTCSKK----AQFN...------------------------------
O62004_BRAFL/490-604GDK-----------................VVVADQAAK----GNKN...------------------------------
Q7NYA5_CHRVO/248-356AGG-----------................ADVRTCSG.----A......------------------------------
O96048_LUMTE/2-124GDN-----------...............ILYLTPAEH.----GQDA...------------------------------
Q86S91_9CILI/376-511NLS-----------K..........ENGGNIAIWPDTG.----ATN....------------------------------
Q97TI2_CLOAB/443-579YGE-----------N..........KDGSNIQIFNAYS.----GDA....------------------------------
O04071_SAMNI/311-434GDS-----------............SGNYAMIYNCDTA----IRDA...------------------------------
Q9ZBF7_STRCO/336-461WGG-----------T..........ANGTVVQVAVCS..----GNPA...------------------------------
Q868M7_CUCEC/115-242GSE-----------............GKGNVLMYSCED.----NLD....------------------------------
GALT6_MOUSE/497-619GST-----------................LGLRSCQF.----VGKNSRV------------------------------
Q9EWL5_STRCO/41-182GAS-----------G..........ANGANIDQYTCVG.----ATN....------------------------------
Q82P89_STRAW/370-505DCS-----------T..........ADGADLRQWSWLN.----NNC....------------------------------
Q7Y0V1_9FABA/137-258DFK-----------............EGATIVTMGCSN.----ASAS...------------------------------
GLT11_HUMAN/479-604ETR-----------............SSDPPRLMKCHG.----SGGS...------------------------------
GALT2_HUMAN/446-563DRA-----------............PGSLIKLQGCRE.----NDSR...------------------------------
GLT14_MOUSE/420-545TLF-----------............PGAPVVLALCKN.----GDER...------------------------------

PF03498

Q46102_CAMJU/29-187EDG-------------------------TFGAKS.CQDDLKDGKLE----------------------------------
Q6UPC3_ECOLX/79-232KGG-------------------------VQLSTAPCQFG....PDR----------------------------------
Q7DK11_AGGAC/39-178GEG-------------------------TTD....CKDI....D.H----------------------------------
Q9RFY4_HELHT/29-183ESG-------------------------FFALKN.CEEDLKSKNFE----------------------------------
O32587_ECOLX/37-179PDG-------------------------KNLLKMTCNPT....DKK----------------------------------
CDTA_HELHP/86-226GNG-------------------------VIHDI..CDSK....NQA----------------------------------
CDTA_HAEDU/77-221GNG-------------------------LIHDI..CSLD....KLA----------------------------------
Q6EZE1_ECOLX/49-197KNG-------------------------VIHNT..CDDN....SLS----------------------------------
CDTA_CAMJJ/115-260GNG-------------------------IVHYP..CDAS....NHA----------------------------------
Q47090_ECOLX/44-187LNG-------------------------QLAVAKQCSES....DRN----------------------------------

PF05588

O06016_CLOBO/1-147ALE-----------------------------------------------------------------------------
Q9LBT0_CLOBO/1-146SNN-----------------------------------------------------------------------------
Q45841_CLOBO/1-146SNR-----------------------------------------------------------------------------

PF07468

Q38719_AMAHP/2-154EGN------------------------MKKVRLLHVQ-------------------------------------------
Q38719_AMAHP/159-299VHD------------------------FNVISLLNMQ-------------------------------------------

PF08709

ITPR1_MOUSE/4-229EG..SWFY-----------IQPFYKLRSIGDSVVIGDK-------------------------V-VLNPVNAG.......
A7SEK1_NEMVE/3-227EG..SWFY-----------IVPFYKLRAAGDNVVVGDM-------------------------V-ILNPVNAG.......
A8HAL5_DANRE/4-229EG..SWFY-----------IQPFWKLRSEGDNVVVGDK-------------------------V-VLMPVNAG.......
O13054_MAKNI/9-216EA..CWWT-----------IHPASKQRSEGEKVRVGDD-------------------------L-ILVSVSSE.......
O77089_PANAR/5-231EG..SWFY-----------INPYYKLRNPGDNVVVGDK-------------------------V-ILSPVNAG.......
P91905_CAEEL/13-215EA..CWWT-----------IHPASKQRSEGEKVRVGDD-------------------------V-ILVSVATE.......
ITPR3_HUMAN/3-230EG..SWLF-----------IQPFWKLRSNGDNVVVGDK-------------------------V-ILNPVNAG.......
RY44_DROME/11-206EA..CWWT-----------VHPASKQRSEGEKVRVGDD-------------------------L-ILVSVATE.......
Q27J07_APLCA/1-225EG..SWFY-----------IQPFYKHSSPGDKVVVGDK-------------------------V-VLNPVNAG.......
Q4DBL7_TRYCC/3-204ESDFCEFV-----------VTPRYKIHDDGDPVCRGDE-------------------------V-LLRLAAFP.......
Q4QEZ2_LEIMA/11-201ANVRERWR-----------IMPRYRLRVEGEPVAAGDA-------------------------I-ILQAVETE.......
Q4RLR0_TETNG/15-213EA..CWWT-----------IHPASKQRSEGEKVRIGDD-------------------------L-ILVSLSSE.......
Q4RY06_TETNG/4-165ES..SGAH-----------VH...........VVIGDK-------------------------V-VLNPVNAG.......
Q57XB2_TRYB2/3-212EQTFCQFI-----------FTPRYTTHGEGDVVCRGDE-------------------------V-LVQLSSIP.......
Q5TQX0_ANOGA/7-234EG..SWFY-----------IMPFYKLRSAGDNVVVSDK-------------------------V-ILKPVNAN.......
Q66S77_OIKDI/1-221EG..SWFQ-----------IHPFYKLRSLGDNVLVGDR-------------------------V-VVKPYSAD.......
Q8TA74_HEMPU/8-204EA..CWWT-----------IHPVSKQRSEGEKVRVGDD-------------------------L-ILVNVATE.......
ITPR_ASTPE/4-229EG..SWFY-----------IVPFYKLRSAGDNVVVGDK-------------------------V-VLNPVNAG.......
Q9Y0A1_CAEEL/78-317EG..SWFI-----------IEPAYKHYAIGDNVSAGNK-------------------------I-SLIPNSVSTTQAGHV

PF02815

RYR2_RABIT/226-406K....LDG-----------GVRKEVDGMGTSEIKYGDS-------------------------I-CYIQHVDTGLWLTYQ
Q6J9T9_ASPFM/358-545L..FRVEI-----------VKSKSDGEEAKKRLRTIES-------------------------K-FRLVHVMTGCVLFSH
RYR3_HUMAN/216-398K....LDS-----------SHKRDIEGMGVPEIKYGDS-------------------------V-CFVQHIASGLWVTYK
Q759J8_ASHGO/342-519D..WIVEI-----------DQEKSTPGEARERVRAIET-------------------------K-FRLRHAMTGCMLFSH
ITPR_ASTPE/231-419I....ASI-----------FELDPTTLQGGDSMVPRSS-------------------------Y-VRLRHLCTNTWVHST
Q6FL03_CANGA/354-530H..WTIEI-----------DQSSSKPGIAQHEVRAIDT-------------------------K-FKLRHA.TGCYLFSH
Q9GS15_CAEBR/327-562I....KLL-----------FELDPSTFMKSNKEVPRRS-------------------------Y-VRLLHHKTASWVHAT
PMT1_SCHPO/329-505L..FRIQI-----------LEKKSKHATSNGTVETLNT-------------------------K-FRLIHVFANCELMSS
Q91313_LITCT/214-394K....LDV-----------APKRDIEGMGPADIKYGES-------------------------M-CFVQHVNSGLWLTYA
Q7SH94_NEUCR/369-558F..FRVEI-----------VKKKSKSGVAQERLRTIDT-------------------------K-FKLVHIMTGCVLFSH
O13054_MAKNI/219-399K....IEV-----------TQKRDVEGMGTPEIKYGES-------------------------M-CFVQHASSGLWLTYA
ITPR_DROME/239-453I....ASV-----------FVLDATTMARPDSLVPQSS-------------------------Y-VRLQHICSNTWVHAT
Q6W3E4_RAT/232-432I....ASL-----------FELDATTLQRADCLVPRNS-------------------------Y-VRLRHLCTNTWVTST
ITPR1_HUMAN/232-433I....SSI-----------FELDPTTLRGGDSLVPRNS-------------------------Y-VRLRHLCTNTWVHST
Q6BFC5_PARTE/240-444YQKASLFH-----------FELIFSTLTTYNREKAQLY-------------------------L-QKDSYFRASTYVGQD
Q8TA74_HEMPU/220-400D....LAN-----------YDSKQDHGMGSADIKYGDS-------------------------T-VLIQHMKTGHWLSYL
Q6FK90_CANGA/355-531STIFRFQP-----------INKKDE....GHIIKSKNA-------------------------V-LRIIHKETVVALWSH
Q8MXI9_CAEEL/274-503A....NLL-----------FQLDPSTFMKSNKEVPRRS-------------------------Y-VRLLHQSSDKWVHAT
Q96WN5_EMEND/353-528H..WKVEV-----------VDDVASRD..RSRIRTLTT-------------------------A-FRLRHAVLGCYLRAG
P91905_CAEEL/220-400P...KKQM-----------LDEKEEEGMGNATIRYGET-------------------------N-AFIQHVKTQLWLSYQ
O77089_PANAR/234-422I....ASI-----------FELEPTTLIRGDSMVPQSS-------------------------Y-VRLRHLCTSTWVHST
Q6CPY0_KLULA/347-524D..WVIEI-----------DHEASAPGEAQEYVKALDT-------------------------K-FRLRHAMTGCRLFSH
Q6CAY4_YARLI/355-531H..WIVEI-----------YDNFGPGD..NKVVHPLTT-------------------------T-VRFKHEVLGCYLSGK
Q6C5U6_YARLI/339-516N..FRVEI-----------VKSKSQKGVSRDRVRTIDT-------------------------K-FRLIHTITGCALFSH
RY44_DROME/211-392D...EKKV-----------LEDKDLEVIGSPIIKYGDT-------------------------T-VIVQHCETSLWLSYK
RYR1_PIG/212-391K....LDT-----------APKRDVEGMGPPEIKYGES-------------------------L-CFVQHVASGLWLTYA
PMT5_YEAST/339-517D..WIIEI-----------DKKRSEPGPAQEHIRAIET-------------------------K-FRLKHYLTGCYLFSH
PMT1_CANAL/359-534D..WVVEI-----------VNYRSQKGEAQTFVKAINT-------------------------I-FRLRHAMTGHYLFSS
PMT1_YEAST/343-520D..WVVEI-----------DKKNSAPGVAQERVIALDT-------------------------K-FRLRHAMTGCYLFSH
ITPR3_RAT/233-432I....ASL-----------FELDPTTLQKTDSFVPRNS-------------------------Y-VRLRHLCTNTWIQST

PF06268

FASC_STRPU/393-496----FFEF-----------HEL...--.SK--FAIRAE---------------------SNG-M-LIK-.GE--------
Q6AXQ1_RAT/24-138----CFLL-----------RFHRN.--.GK--WTLQCI---------------------ISG-R-YLE-..S--------
SING_DROME/33-147----RFQI-----------SISEDG--SGR--WALKNE---------------------SRG-Y-FLG-..G--------
FSCN2_HUMAN/389-492----VFEF-----------RER...--.GR--LAIRA.---------------------RSG-K-YLR-.GG--------
FSCN3_HUMAN/271-381----FFRM-----------HWN...--.CG--RIILQS---------------------CRG-R-FLG-.IA--------
FSCN1_HUMAN/268-378----YFDI-----------EWR...--.DR--RITLRA---------------------SNG-K-FVT-.SK--------
Q6PBS5_DANRE/19-131----RFLI-----------VAQSD.--.GR--WALQSE---------------------TYL-R-FFG-..G--------
FASC_XENLA/382-483----SLEF-----------CDY...--.NK--VAIQK.---------------------VNG-L-YLK-.GD--------
FASC_STRPU/138-254----QFTL-----------IFT...--.SG--HLVLRD---------------------NNG-R-HLG-VDS--------
FSCN2_HUMAN/20-133----RFLV-----------LPQPD.--.GR--WVLRSE---------------------PHG-R-FFG-..G--------
Q6AZJ6_XENLA/277-387----YFEI-----------DWC...--.DR--RITLKG---------------------VNG-K-YVT-.AK--------
Q6EEB3_PRODO/230-340----YFDI-----------EWL...--.GK--RITLKA---------------------ANG-K-YVT-.AK--------
FSCN2_HUMAN/141-254----CYTL-----------EFK...--.AG--KLAFKD---------------------CDG-H-YLA-PVG--------
FSCN1_HUMAN/391-493----FFEF-----------CDY...--.NK--VAIK..---------------------VGG-R-YLK-.GD--------
FSCN2_HUMAN/266-376----MFEM-----------EWR...--.GR--RVALKA---------------------SNG-R-YVC-.MK--------
Q6EE45_SCYCA/96-208----GYTL-----------EFR...--.SG--KVAFRD---------------------CEG-K-YLA-PSG--------
FSCN1_HUMAN/20-134----RFLI-----------VAHDD.--.GR--WSLQSE---------------------AHR-R-YFG-..G--------
Q6AZJ6_XENLA/152-265----AYTL-----------DIS...--.AG--KVAFRA---------------------SDG-R-YLT-SSG--------
FASC_STRPU/16-130----GFEI-----------ELQPD.--.GK--WALKNV---------------------SHQ-R-YLA-.CN--------
Q6AZJ6_XENLA/32-144----RFLV-----------SAQGD.--.GR--WALQSE---------------------LYG-R-YFG-..G--------
FSCN1_HUMAN/142-256----GYTL-----------EFR...--.SG--KVAFRD---------------------CEG-R-YLA-PSG--------
SING_DROME/155-270----LFSA-----------EYH...--.GG--HLALRD---------------------RQG-Q-YLS-PIG--------
Q6PBS5_DANRE/139-252----GYTL-----------ELK...--.SG--KLAFKD---------------------CEG-K-YLT-PMG--------

PF06229

Q7QC94_ANOGA/71-260----QFEP...........VFE------QG--KTALLA-------..............ANG-C-FVS-VDP--------
A7RWZ5_NEMVE/69-257----QLEL...........LFD------GD--KVALQA-------..............YNG-C-FLS-VSD--------
Q15ER4_SCHMA/95-286----QFEP...........IFQ------DG--RSASLG-------..............ANN-C-FLS-ADP--------
A1D4G2_NEOFI/89-280----SFLA...........LPS------TD--IPGTFA-------LQTGGG........DKE-A-FVC-VRE--------
Q96MD3_HUMAN/4-156----QWEP...........VFK------IG--KMALST-------..............SNS-C-FIR-YSE--------
Q2UKA8_ASPOR/84-274----SFVV...........IPS------.E--MPGSFC-------LQTGGG........DKE-T-FVS-VTE--------
FRG1_DROME/72-260----QWEP...........VFE------EQ--RMALLS-------..............ETG-H-FMS-IDP--------
Q6DDA8_XENTR/66-254----QWEP...........VFE------NG--KMALLA-------..............SNS-C-FVG-CNE--------
FRG1_CAEEL/78-273----QFVL...........VFQ------EG--KTAFQA-------V.............SSP-L-FLS-TVP--------
Q0UA03_PHANO/83-265----SFIV...........IPV------PD--NPSAFS-------LQT...........ARD-K-FLS-IDE--------
A2Q890_ASPNC/96-312----IYTISESGAGGGGFFVFG------TG--TGASSA-------SQGGDGVDDKEKKEKKQ-T-YLV-ART--------
Q566W5_DANRE/65-253----QWEP...........VFQ------NG--KMALLA-------..............ANS-C-FIS-YSE--------
A6SI98_BOTFB/86-272----SFIS...........IPT------AD--TPGTFQ-------IQT...........LRD-T-FLT-IKP--------

PF04601

Q9LJJ2_ARATH/1-141---.EWEP-----------VRE------GV--QVRLKT---------------------RYG.Q-YLR-ANG--------
Q9LQ43_ARATH/1-142---.AWEP-----------IRD------SA--LVKLKT---------------------RYG.N-FLR-GNG--------
Q9CAS3_ARATH/251-396---GEWEP-----------VKE------GS--RVKLRS---------------------RNGGN-YLR-ANG--------
O04559_ARATH/227-368---.EWEP-----------LRE------GS--KIKLRT---------------------RSG.N-YLR-GNG--------
O04559_ARATH/1-144---.QWEP-----------ERD------GF--QVKLKS---------------------WCG.K-WMR-ANG--------
Q9CAS2_ARATH/1-139---.EWEP-----------VRE------GS--KMKLKT---------------------RYG.N-LLR-ANG--------
Q9CAS3_ARATH/1-144---.DWEP-----------IKE------ES--TVKLMS---------------------WNE.K-YLR-GNG--------

PF00167

Q28XC7_DROPS/16-141----HFRE-----------SLDHGY--YQF--THAY.......................NPV-L-HVG-IKR--------
Q4S3V1_TETNG/61-182----HFLE-----------RLESNN--YNT--YRSRKY......................PT-M-FVG-LTR--------
P91672_DROME/249-377----VFNE-----------NMGLQN--YNT--YSSTYHS..................QARRV-F-YLA-LNG--------
Q8R5L5_RAT/84-205----KFRE-----------TLLPNN--YNA--YESDLY......................RG-T-YIA-LSK--------
B1AK17_HUMAN/79-205----KFKE-----------SVFENY--YVT--YSSMIYRQ................QQSGRG-W-YLG-LNK--------
FGF1_CHICK/25-148----LFLE-----------RLEENH--YNT--YISKKH....................ADKN-W-FVG-LKK--------
Q8I6J6_CIOIN/91-218----EFRE-----------ELEANG--YVT--FASQLYSD................HQWRLG-Y-FLA-MSK--------
Q9YH31_NOTVI/72-193----KFKE-----------MLLPNN--YNA--YESWRY......................PG-M-YIA-LSK--------
FGF16_MOUSE/61-187----VFRE-----------QFEENW--YNT--YASTLYKH................SDSERQ-Y-YVA-LNK--------
Q5TLD5_DANRE/43-168----DFKE-----------VFLENY--YTA--YSSVKWT..................KNGRE-M-FIS-LSQ--------
A1YJ27_NPVSF/70-196----LWNE-----------YYDSFR--NRF--LIKQFE....................NNRT-A-YLA-IDA--------
Q90XQ4_AMBME/55-181----VFSE-----------TVLENN--YTA--LQNAKY......................EG-W-YMA-FTR--------
Q86GG2_CIOSA/55-180----QFND-----------LMMPNL--FDY--FTNVAH......................PK-W-YVA-FNS--------
Q8I6J7_CIOIN/133-264----DFVE-----------RW.QDF--YAT--YRSLHQPGNR...........RRRRSKARE-W-YIG-IDK--------
FG17_DANRE/53-178----IFTE-----------IVLENN--YTA--LENARH......................EG-W-FVA-FTR--------
Q9E225_9ABAC/33-160----LWST-----------EIKETA--YVM--YKQFDS.....................NTR-A-YLA-LNR--------
Q8I6J5_CIOIN/56-181----LFFE-----------EMLENY--FDA--FSNSKF......................RD-W-HIG-FHS--------
Q4SAA6_TETNG/81-202----KFRE-----------TLLPNN--YNA--YESFVY......................KG-F-YVA-LSK--------
Q2NP32_NPVHC/29-154----ILNE-----------IVLDNN--YDV--MFKIYD.....................NKK-T-YVA-LDD--------
Q4RWE4_TETNG/71-205----KFKE-----------SVFENY--YVI--YSSMLYRQ................QESGRA-W-FLG-LNK--------
FGF1_NOTVI/2-125----LFLE-----------RLEENN--YNT--YKSKVH....................ADKD-W-FVG-IKK--------
Q544I6_MOUSE/65-189----NFKE-----------LILENH--YNT--YASAKWT..................HSGGE-M-FVA-LNQ--------
Q8VI79_RAT/32-156----RFRE-----------RIEENG--YNT--YASRRWR..................HHGRP-M-FLA-LDS--------
A3EXK2_NEMVE/57-180----IFKD-----------HFADNA--FNE--FESVKY......................EG-H-YIA-FNR--------
Q4RSP6_TETNG/17-145----SLKE-----------RIEENG--YNT--YASAMWK..................NKKRQ-M-FVG-LNV--------
FGFH_NPVOP/29-156----ILNE-----------VMLENN--YDV--MFKIYN.....................GKK-T-YVA-LDN--------
Q5M7N7_XENTR/65-189----NFRE-----------LIQENK--YNT--YASAKWT..................NNGKE-M-FVA-LNS--------
FGF1_XENLA/25-148----LFLE-----------TLEENH--YNT--YKSKKY....................ADMN-W-FVG-IKK--------
O92401_NPVBM/28-154----FMRE-----------IMEKNN--YNT--YYKMYD.....................RKL-T-YVA-LKN--------
A6Y7S4_DIDAL/29-153----FFFE-----------RLESNN--YNT--YRSRKY......................SN-W-YVA-LKR--------
Q66IF7_XENTR/61-197----EFVE-----------RIHELG--YNT--YASRLYRTVPSGA......GTKRKASAERL-W-YVS-ING--------
Q4T869_TETNG/30-155----IFSE-----------IVLENN--YTA--FQNAKY......................EG-W-YVA-FSR--------
Q91BB2_NPVST/26-158----VLHE-----------HMTESY--YNW--YYRD..D..................N.QTR-S-FLA-LNK--------
Q9N1B9_SHEEP/84-207----KLKE-----------RIEENG--YNT--YASFNWQ..................HNGRQ-M-YVA-LNG--------
A7RZP2_NEMVE/41-163----VFKE-----------AYTDDF--FTQ--FISAYN......................PK-W-MIT-VSK--------
LE756_CAEEL/72-207----VFLE-----------EMMENY--YNL--YASCAYG..................DRFNP-W-YIE-LRR--------
Q8R5L6_RAT/78-192----KFKE-----------ILLPNN--YNA--YESYAY......................PG-M-FMA-LSK--------
Q8T8A3_CIOSA/159-283----IFYE-----------SVLENK--QNT--FESFAHR..................SGSRR-C-YIA-LGR--------
A7YT71_DANRE/25-149----FFIE-----------KMEENH--YNT--YRSQRY...................QDNGD-W-FVG-IRK--------
Q4SCS5_TETNG/71-197----KFKE-----------SVFENY--YVT--YSSMLYRQ................TQSGRC-W-YIG-INR--------
A7SH09_NEMVE/102-230----LLRE-----------TRAENY--FHT--FSSYQYNG................EDRHKQ-W-YLA-IKQ--------
FGF1_DANRE/17-138----YFLE-----------KMEENH--YNT--YQSQKY.....................GEN-W-YVG-IKK--------
Q287N3_NPVAS/32-156----LWSE-----------IYDEHN--YRF--FFKQFG.....................NRT-A-YLS-LNL--------
Q80LI4_NPVAH/49-164----VLTE-----------HNAATY--AVI--YKKL......................NDTN-A-LVA-INK--------
Q5TKR7_DANRE/53-179----VFIE-----------IMLENN--YTA--WMSAHY......................VG-W-YVG-FTK--------
Q8QLI3_9ABAC/34-158----LWTE-----------QYDEHN--YRF--INKKFG.....................NRT-A-YLS-INL--------
Q2LGG1_DANRE/81-202----KFKE-----------TLLPNN--YNA--YESSIY......................KG-F-YMA-LSK--------
FGF18_MOUSE/53-178----VFIE-----------KVLENN--YTA--LMSAKY......................SG-W-YVG-FTK--------
Q9J897_9ABAC/33-159----LWSE-----------IYDDFN--NRF--IVKRFE....................NNRT-A-YLA-LNA--------
Q0PV85_HALRO/186-312----LFKE-----------TFEENK--YNT--YSSLRHRN................HSDTRS-C-FVA-ISQ--------
Q1LXT4_DANRE/17-141----KFKE-----------RIEENG--YNT--YASLRWK..................HRGRQ-M-FVS-LNG--------
Q1HGX9_NPVAP/32-158----FLNE-----------MFTETN--HNV--LHKVYD.....................RKV-T-YVA-LDN--------
Q4SFA3_TETNG/9-140----RFKE-----------SLLANH--YNA--YESAAY......................PG-M-YIG-LSR--------
Q9DFC9_DANRE/67-188----KFRE-----------KLLANN--YNA--YESLAH......................PG-M-YIG-LSK--------
A5PM81_DANRE/55-181----KFKE-----------SVFENY--YVI--YSSTMYRQ................QESGRA-W-FLG-LTK--------
A7SRV3_NEMVE/407-534----FFYQ-----------QLEHNL--FQS--FSSTKYY.................KENPYD-M-FIG-LKR--------
Q8NF90_HUMAN/87-216----KFRE-----------RFQENS--YNT--YASAIHRT................EKTGRE-W-YVA-LNK--------
FGF11_HUMAN/71-197----RFKE-----------CVFENY--YVL--YASALYRQ................RRSGRA-W-YLG-LDK--------
Q0KJ02_ORYLA/70-196----VFRE-----------QFEENW--YNT--YSSNIYRH................REKGSF-Y-FVA-LNK--------
FGF4B_XENLA/68-189----KFKE-----------TLLPNN--YNA--YESRKY......................PG-M-YIA-LGK--------
A7RFG7_NEMVE/73-195----FRKK-----------DSPSHG--WFT--YESYKY......................CD-M-YIG-FKR--------
Q4VBV7_DANRE/72-196----KLIE-----------RIEENR--YNT--YASAEWM..................NKKKH-M-FVG-LSA--------
FGF3_DANRE/62-204----EFLE-----------RIHELG--YNT--YASRHHATTQPPPTGSGIGGSKRRASSKRQ-W-YVS-ING--------
Q4SJV9_TETNG/17-140----YFLE-----------QLEENH--YNT--YLSRSH....................RDRG-W-FVG-LKK--------
Q6VTW1_NPVCD/28-157----FLQE-----------TVVKNN--YDV--MFKIYN.....................RKL-T-YVA-LDN--------
Q8QG59_AMBME/67-191----KLKE-----------RMEENK--YNT--YASYKWR..................HKQRQ-M-FVA-LNG--------
Q3YAG3_STRPU/203-330----YFQE-----------KLEPNF--FNT--YAYKMPDST.............SKRRRHRT-L-FLS-INK--------
FGF17_RAT/53-178----VFTE-----------IVLENN--YTA--FQNARH......................EG-W-FMA-FTR--------
A7SHR3_NEMVE/45-169----QFLE-----------GY.RKG--FTQ--FRSMYR......................NN-W-YLG-FKK--------
Q5TLE2_DANRE/41-170----KFRE-----------RFQENS--YNT--YASVIHKN................HRTGRE-W-FVA-LNK--------
Q6E7C8_OIKDI/1583-1704----FVEE-----------RIKANN--FIS--FGLP.......................NTN-C-KLM-ISQ--------
Q9PVY1_XENLA/62-188----IFRE-----------QFEENW--YNT--YSSNLYKH................GDSGRR-Y-FVA-LNK--------
Q8JMA6_9ABAC/35-159----LWTE-----------HYDDHH--YRF--IYKKFG.....................NRT-A-YLA-VNL--------
Q1XG75_DANRE/59-183----RLKE-----------RIEENG--YNT--YASAKWK..................NNKRQ-I-FVS-LSA--------
Q0IIQ7_DANRE/50-175----VFVE-----------EYLENN--YTA--LMSAKY......................RG-R-YLG-FNR--------
A7T359_NEMVE/53-177----AFIQ-----------K.QQKG--FTV--FISKIH......................KT-W-ALG-VRN--------
Q5GAD8_9VIRU/23-148----VFNE-----------TLLPNN--YNS--YSAAEHLN................PETRAN-M-HLA-IDK--------

PF00340

IL1B_BOVIN/144-261----VFYK-----------TEIKNT--VE...FESVLY----------------------PN-W-YIS-TSQ--------
IL1RA_MOUSE/61-174----TFIR-----------SEKGPT--TS...FESAAC----------------------PG-W-FLC-TTL--------
IL1RA_HUMAN/60-173----AFIR-----------SDSGPT--TS...FESAAC----------------------PG-W-FLC-TAM--------
IL1B_FELCA/146-263----VFNK-----------TEIKGN--VE...FESSQF----------------------PN-W-YIS-TSQ--------
Q9GL09_SHEEP/72-185----.FQR-----------SVPGHD--DKI.QFESSLY----------------------KG-Y-FLA-CKK--------
IL1A_MOUSE/158-269----FWKS-----------INSKNY--.....FTSAAY----------------------PE-L-FIA-TKE--------
Q96KJ8_HUMAN/72-185----.FQR-----------SVPGHD--NKM.QFESSSY----------------------EG-Y-FLT-CEK--------
IL1B_CERAT/147-264----VFNK-----------IEINNK--LE...CESAQF----------------------PN-W-YIS-TSQ--------
Q9I8D2_CHICK/66-187----.FKK-----------TFTSCS--SKAFKFEYSLE----------------------QG-M-FLA-FEE--------
IL1B_PIG/145-262----VFYK-----------TEIKNR--VE...FESALY----------------------PN-W-YIS-TSQ--------
IL1B_MOUSE/148-264----VFNK-----------IEVKSK--VE...FESAEF----------------------PN-W-YIS-TSQ--------
IL1A_RABIT/156-266----FWET-----------QGNKNY--.....FKSAAN----------------------PQ-L-FIA-TKP--------
IL1A_BOVIN/156-265----FWEK-----------HGSMDY--.....FKSVAH----------------------PK-L-FIA-TKQ--------
Q91Z66_SIGHI/73-186----.FQR-----------AVPGH.--NKM.KFESSLH----------------------EG-H-FLA-CER--------
IL1A_CERAT/155-266----SWET-----------RGTKNY--.....FISVAH----------------------PN-L-FIA-TKH--------
IL1RA_RABIT/60-173----TFIR-----------SNSGPT--TT...FESASC----------------------PG-W-FLC-TAL--------

PF05270

OTOG_MOUSE/1241-1384----SFSL-----------HRG.TW.QAGLVALESLAK----------------------PG-S-FLH-SSG--------
ABFB_ASPOR/358-502----TFCP-----------QAGLNG..QGN.SIRSWSY----------------------PT-R-YFR-HYE--------
Q82P18_STRAW/329-465----TYVA-----------RTG.TA..AGSVRFESYNY----------------------PG-Y-YLR-HYN--------
Q829S7_STRAW/176-312----TFCP-----------RTS.SY..SGAVMLESVNY----------------------PG-R-YLR-HKD--------
Q55841_SYNY3/35-174----TFCP-----------RNGLNS..QGGVSFESNNY----------------------PG-H-YIR-HRN--------
Q9HEY2_COCCA/355-499----TFCP-----------QAGLTG..KGS.SIRTWAY----------------------PT-R-WIR-HFN--------
Q86ZN9_FUSOX/351-495----TFCP-----------QKGLSG..SGS.SIRSWNY----------------------PT-R-YIR-HYN--------
Q82P90_STRAW/346-481----SFSR-----------RAGLADSADGI.AFESYNY----------------------PG-R-YLR-HYE--------
ABFB_EMENI/357-506----TFCP-----------QDSFND..DGTNSIRSWNY----------------------PT-R-YWR-HYE--------
ABF1_HYPJE/352-496----TFCT-----------QAGING..QGS.SIRSWSY----------------------PT-R-YFR-HYN--------
ABFB_ASPKW/350-494----TFCP-----------QAALNG..EGT.SLRSWSY----------------------PT-R-YFR-HYE--------

PF00197

IT2_PSOTE/2-176.LDYPFKF-----------ER--------VYAAS...K---------------------MYAYK-LLY-CGSEDEE....
IAAS_ORYSJ/26-193REN.AFRV-----------EK--------YGG.G....---------------------...YK-LVS-CR.........
MIRA_RICDU/35-216TISSWFKI-----------EE--------FCGSG....---------------------..FYK-LVF-CPTVCGS....
ALB1_PSOTE/4-171QVKGAFTI-----------QK--------GSN.....T---------------------PRTYK-LLF-CPVG.......
ASP_THECC/30-208TLCSWFKI-----------EK--------AGVLG....---------------------...YK-FRF-CPSVCDS....
IAAS_HORVU/27-199REN.AFRI-----------EK--------YSGAE....---------------------VHEYK-LMS-CGD........
API8_SOLTU/39-219ADSSYFKI-----------VK--------LSNFG....---------------------...YN-LLY-CPITPPFLCPF
ICW3_PSOTE/27-198KDILVFKF-----------EK--------VSH....SN---------------------IHVYK-LLY-CQHDEE.....
IDE3_ERYCA/1-168.FDYPFKF-----------EQ--------VS.....DQ---------------------LHSYK-LLY-CEG........
IECI_ERYVA/2-173EDDTKFKF-----------QK--------VSS....PN---------------------RYVYN-LSY-CQREDD.....
IT1A_PSOTE/2-168.FDYLFKF-----------EK--------VT.....SK---------------------FSSYK-LKY-CA.........
ITRA_SOYBN/26-199..DGWFRL-----------ER--------VSD....DE---------------------FNNYK-LVF-CPQQAE.....
ITRY_ACACO/2-171FLVGSFKI-----------KP--------YR.....DD---------------------YK...-LVY-CEGNSDD....
KTI1_SOYBN/27-197..DGWFNI-----------ER--------VSR....EY---------------------ND.YK-LVF-CPQQAE.....
CPI1_SOLTU/47-221NENDIFKI-----------MK--------TDLVTPGGS---------------------KYVYK-LLH-CPSH.......
SPOR1_IPOBA/42-216SNQFKIEL-----------VD--------ANLNS....---------------------...YK-LTY-CQFG.......
GWIN3_POPSP/32-195..LNLFKI-----------TK--------FES.....D---------------------SSFYQ-LSY-CPNSEP.....

PF07951

BXB_CLOBO/1075-1291N...TIQI-----------KE--------YDEQP-------------------------TYSCQ-LLF-KKDE-------
BXE_CLOBU/1063-1250NQVVVM..-----------..--------.NSVG-------------------------.N.CT-MNF-KNNN-------
TETX_CLOTE/1105-1314PLYKKMEA-----------VK--------LRDLK-------------------------TY.SV-QLK-LYDD-------
BXA1_CLOBO/1088-1293SQVVVMKS-----------KN--------DQGIT-------------------------NK.CK-MNL-QDNN-------
BXG_CLOBO/1083-1297TFYDVLQI-----------KK--------YYEKT-------------------------TY.NC-QIL-CEKD-------
BXC1_CLOBO/1089-1291NDNIIFQI-----------QP--------MNNTY-------------------------YY.AS-QIF-KSNF-------
Q45851_9CLOT/1072-1268NQMIIM..-----------..--------.DSIG-------------------------DN.CT-MNF-KTNN-------
Q45967_CLOBO/1085-1285RKYGSFII-----------QP--------CNTFD-------------------------YY.AS-QLF-LSSN-------
BXF_CLOBO/1083-1274GQIIVM..-----------..--------.DSIG-------------------------NN.CT-MNF-QNNN-------
BXD_CLOBO/1076-1276G.IGIFSI-----------KN--------IVSKN-------------------------KY.CS-QIF-SSFR-------

PF14200

C6I1A8_9BACE/97-198---N.YLF-----------.T--------SV...AS.G---------------------....Y.NLG.FPD.A.G.LV.
A8NAT6_COPC7/44-145---..YTI-----------SD--------NA...NR.T---------------------....S.VWN.IAG.G.A.IV.
A8P1Y0_COPC7/90-188---V.YRI-----------.F--------VP...YT.T---------------------....Q.NLD.LYNYG.D.FA.
A8PCJ2_COPC7/37-137---SVWRI-----------.G--------VP...DS.P---------------------....F.HLD.LTNHG.D.SA.
A1Z5I4_BEABA/43-129---T.ISL-----------.V--------NH...N..D---------------------....R.VVG.AWD.Q.D....
A6EHX4_9SPHI/63-161---T.FYI-----------.T--------NR...RK.D---------------------....K.AFD.YRN.D.G.KL.
A6ERL3_9BACT/65-184---Y.YNF-----------.T--------SA...HE.K---------------------GKGAY.ALE.LSG.D.DIDK.
A6G9W3_9DELT/412-502---.VFTL-----------.Y--------NG...SH.S---------------------....G.YLD.AN......S..
A6G9W3_9DELT/550-640---.VFSL-----------.R--------NL...SA.N---------------------....R.WLD.A.....D.TD.
A7EWX9_SCLS1/45-151---EVFTI-----------.N--------NK...VS.E---------------------....LGQLT.VKD.Y.S.TH.
A7WK54_LYSSH/385-485---..YVF-----------.R--------NF..RNR.D---------------------....L.VLH.ISG.G.N.TG.
A8NDJ7_COPC7/40-145---QCLHL-----------.L--------VP...NT.I---------------------....Y.ALE.GSY.P.Q.RAE
A8NDJ7_COPC7/189-287---A.FRM-----------.F--------VP...YT.K---------------------....M.NVD.LHM.G.N.SS.
A9E912_9FLAO/86-187---ELYYI-----------.T--------AK...HS.N---------------------....K.SIA..AG.P.G.FK.
B0DSD3_LACBS/40-138---NVLRI-----------.C--------VP...NT.R---------------------....H.NVD.LSDHG.N.PN.
B0MJQ2_9FIRM/249-352---..YLL-----------.R--------PK...CA.D---------------------....N.VLD.AHN.G.G.TT.
B1VUB2_STRGG/50-155---T.VTL-----------.V--------SF...VS.G---------------------....L.VME.VAD.R.S.TA.
B2WIQ5_PYRTR/45-143---A....-----------.F--------CV...NG.K---------------------....K.QLN.VRG.A.G.KE.
B2ZRS9_CLINE/46-144---GQFRI-----------.K--------IP...NL.G---------------------....L.ALT.LP....S.DA.
B3C971_9BACE/378-483---T.YRI-----------.M--------PKKVPGT.D---------------------....K.ELVLVSV.G.D.ST.
B3PKR2_CELJU/520-621---T.LRF-----------.T--------AR...HS.G---------------------....L.SLD.IMN.C.S.IA.
B4V2C9_9ACTO/39-139---GVVSL-----------.I--------AA...IS.G---------------------....L.PLE.ADE.E.G.RA.
B4V8E2_9ACTO/575-676---H.YTL-----------.I--------NS...AD.G---------------------....T.LLD.VTG.A.S.TA.
B5GTM6_STRCL/44-154---GLYCI-----------.E--------GA...GD.R---------------------....A.VLD.LAD.P.G.PD.
B6SS31_MAIZE/56-169---.FRCI-----------.R--------MV..NNT.R---------------------....L.NFD.AFH.G.D.KDH
B8P008_POSPM/56-152---.WYQI-----------.K--------LA...DE.A---------------------....L.VLY.LAN.G.D.DA.
B8P2U3_POSPM/41-134---S.YQI-----------.K--------LA...DE.S---------------------....L.VLY...L.G.S.SA.
B8PDH6_POSPM/53-148---K.VQI-----------.T--------VI...NE.V---------------------....Y.AFS.LAN.A.A.NH.
C0PSY5_PICSI/62-180---GYQCI-----------.R--------PV..NNT.H---------------------....L.NLD.AST.G.D.DKH
C3I9T1_BACTU/507-614---Y.ATL-----------.V--------NLK.KRN.G---------------------K..EV.VLD.VEG.G.G.TS.
C4LYE8_ENTHI/157-265---S.FYI-----------.N--------CA...HC.N---------------------....L.RMD.VSR.K.N.TK.
C4M3J3_ENTHI/137-243---.VYII-----------.I--------CS...HA.N---------------------....L.ALD.IKG.G.S.DK.
D9STT7_CLOC7/601-707---T.FGI-----------.L--------TM...IS.G---------------------G..TQ.GLD.VNA.K.S.TA.
C6D9K8_PECCP/404-505---Y.YKI-----------.M--------NR...NS.G---------------------....K.LLD.ISS.R.S.TE.
C6L2F6_APOCT/307-416---.CYRL-----------.R--------NL...ENLN---------------------....M.IVT.VQN.NFN.LL.
C6L2F6_APOCT/611-715---S.YKL-----------.R--------NL..LNL.E---------------------....K.IIA.VVN.K.N.SP.
C7PHL4_CHIPD/338-435---H.YKI-----------.L--------SK...RN.G---------------------....K.CVE.LL.......K.
C9YYM1_STRSW/484-581---H.VKL-----------.Q--------SA...R..N---------------------....K.SLY.LTG.A.S.PD.
D1BKB8_SANKS/626-731---STWSF-----------.A--------SG...SR.S---------------------....L.SLE.VGG.Q.S.TA.
D1Q0S6_9BACT/375-479---T.YRI-----------.M--------PKKVPGT.N---------------------....E.PLV.LV....S.LG.
D2QTB1_SPILD/373-478---T.YRI-----------.M--------PKIVPNS.G---------------------....K.KLA.LVS.S.G.DS.
D2S061_HALTV/623-726---R.YSL-----------.E--------PT...HA.D---------------------...DL.AVD.VWE.V.D.PE.
D2VXQ3_NAEGR/45-151---S.VSL-----------.I--------NL...NS.Q---------------------....L.YLG.VKS.D.E.KS.
D3Q6V6_STANL/130-238---Q.YGI-----------.A--------VA...KT.G---------------------....M.CLG.PLE.E.K.AK.
D4J5M3_9FIRM/492-590---GYYIV-----------.P--------NC...SY.T---------------------....S.CLD.LYT.G.I.PD.
D4J5M3_9FIRM/739-837---SYYLV-----------.P--------KC...SS.T---------------------....S.CLD.MYS.G.I.PA.
Q8A5P7_BACTN/65-167---N.YVL-----------.T--------NV...GT.G---------------------....Y.NLG.FPD.A.G.LV.
Q8X123_9AGAR/44-154---TSYKI-----------.Q--------NY...GS.K---------------------....T.FVD.LVN.G.D.SS.
Q9L153_STRCO/584-686---T.WTL-----------.V--------NS...GT.G---------------------....R.LLE.VGG.Q.A.TH.

PF00652

GALT3_MOUSE/505-627PGEQIWEI-----------RK........DQLLYNPL.---------------------FK..M-CLS-S.........-
CRBG3_HUMAN/888-1017...QKWRL-----------NK........NGTISSYLS---------------------DQ..L-VLD-VKGGNY...C-
GLT10_CAEEL/536-662...QLFKY-----------RV.......AQKQIYHPI.---------------------SG..Q-CLT-ADE.N.....-
CUPF_DICDI/32-142...QIWTI-----------DT.......TNNKIQNQG.---------------------NG..K-YLD-I.........-
Q7QIK5_ANOGA/491-617...DTWEF-----------TE........HRQLRHKQ.---------------------SG..L-CLD-SSDLS.....-
Q7PZM5_ANOGA/438-564...QMWRY-----------DY.......ESKMIIHGKD---------------------HH.GR-CME-ADL.......-
Q7Q0E9_ANOGA/461-587...QLWRY-----------EP.......ETQMLKQGK.---------------------NN..R-CLD-MNP.......-
Q7QDR0_ANOGA/437-565...QFFQY-----------DH.......DTRQIYAGKD---------------------KS..F-CFD-ADG.......-
ML1_VISAL/440-560...QRWVF-----------TN........EGAILNLK.---------------------NG..L-AMD-VAQAN....P-
O96048_LUMTE/132-255...RAWIV-----------SG.........NTIAQLSD---------------------RD..I-VLD-IIK.......-
GALT7_CAEEL/478-592...GFWSY-----------DR.......KTKQIIHSQ.---------------------KR..Q-CIT-VSE.......-
GLTL2_HUMAN/505-628.HQQHWDF-----------QE........NGMIVHIL.---------------------SG..K-CME-AVVQE.....-
GLT13_DROME/435-548.RSQRWVR-----------LG.........THLLHAE.---------------------SH..L-CLD-NP........-
Q7NQK0_CHRVO/5-133...QRWDL-----------YS.......RPGFIANRQN---------------------TN..L-VID-NQSRG....G-
GALT4_CAEEL/461-580VEKNGWLT-----------QG.................---------------------.G..K-CLT-VNQGS.....-
Q8W2E8_IRIHO/447-569...QRWMF-----------TS........QGTIHNLH.---------------------SG..Y-VMD-VKQSD....P-
Q9SLV9_CUCSA/35-159...KKWTQ-----------KN........DGTIALVD.---------------------SR..M-VLT-G.........-
AGALA_ASPNG/424-536...QKWTY-----------PV........TGNLKNAK.---------------------TD..G-CL.-..........-
GALT1_MOUSE/430-548...QLWEY-----------DP.......VKLTLQHVN.---------------------SN..Q-CLD-KATEE.....-
GALT3_DROME/512-658...QLWTY-----------DM.......DTQQISHRD.---------------------TK..L-CLT-LKAATNSRLQ-
Q7Y0V1_9FABA/7-131...TYWEI-----------WD........NGTIINPK.---------------------SS..L-ALS-AESST.....-
GLT12_MOUSE/440-569...QEFIL-----------QE........DGTLVHKH.---------------------SR..K-CVE-ATEKVL...D-
Q9ADL1_SORCE/171-307...QQWSV-----------TEAG....DGAVRITSRL.---------------------SG..R-VID-AYGSPP...A-
Q8C2S1_MOUSE/660-788...QFWCM-----------KS........DGRIYSKMK---------------------PN..L-VLD-VKGGAQ...Y-
Q9X583_9ACTO/367-502...QHWKA-----------RQNS....DGTYTLTNVA.---------------------SG..R-ALE-LPGGRT...A-
GALT9_MACFA/467-595..QRLWDF-----------TQ........SGPIVSRA.---------------------TG..R-CLE-VEMSKD..AN-
Q8KKH3_BACCI/270-405...QRWKI-----------VDVG....GGYYKLVSKV.---------------------SG..L-AVD-VASAST...A-
GALT5_HUMAN/810-932...LKWLH-----------KSTSVFHPELVNHIVFEN.---------------------NQQLL-CLE-GNF.......-
Q7SBD7_NEUCR/100-230...QSFAF-----------GD.........GAGSGNNN---------------------GG..G-NAD-TGGDT....N-
O04071_SAMNI/439-558...QRWVF-----------NT........NGTISNPN.---------------------AK..L-VME-VRQSD....V-
Q9HFA9_9TREE/43-172...QQWYY-----------TD........DNRIAVTG.---------------------KG..L-CLD-LTDGRA...S-
Q9EWL6_STRCO/70-209...QIWFS-----------LAPYAEGSMNPDAGRNTGD---------------------....R-CLD-VQGASK...A-
Q824Z7_STRAW/111-218...QAWVW-----------RG.........DELHNAV.---------------------LG..T-CLD-G.........-
Q9HFB1_9ASCO/416-528...DVWSY-----------GV........SGNLINGN.---------------------SA..N-CLT-E.........-
Y1454_MYCBO/33-153...QHWTV-----------QP.........DGLVKSD.---------------------LD..A-CLT-VLGGP....D-
Q6TBQ9_CRYPV/535-659...NVWRL-----------EN.........EMIKANVE---------------------PNKYV-CLS-LTEDND..SS-
Q825I1_STRAW/713-838.KNVRYDF-----------TL........QGSLVPRWN---------------------QD..L-ALT-SASGG.....-
Q7TLZ3_9ZZZZ/377-504...QQWHV-----------NS........NGTITSAQ.---------------------SG..L-CLD-VTGAST...A-
Q7X2C9_STRTE/266-386...QKWRL-----------NS........DGSIVGVQ.---------------------SG..R-CLD-AAGSG.....-
GALT9_DROME/521-640...QFWTY-----------RE.......NTKQLHHGT.---------------------SG..K-CLA-ISE.......-
GLT10_DROME/483-615...QYWYY-----------NH.......RHRWIQQGQI---------------------WV..W-CLE-AQLASG...H-
Q825L5_STRAW/296-417...QKWVV-----------TA........AGDIVNPQ.---------------------AN..K-CLD-VTGNNS...A-
Q6BE06_BACTU/699-826...QHWLI-----------EEAG....NGYVYLRSKGN---------------------PN..L-VLD-VAGTST...A-
ENVE_SALTY/53-170...QRWLT-----------DD.........NKIKGKQ.---------------------SR..K-CLG-TNSIIV...R-
Q6YBY0_TOXGO/500-612...FWWDF-----------TS........SGQLMFRE.---------------------TK..Q-CLS-A.........-
O86669_STRCO/329-444...QQWHR-----------NPWQGTAWPRNAWQISGS.---------------------VN..R-CL.-..........-
FLVS_FLAME/296-437...QKWLL-----------FNLG....NEGFGFAPKNA---------------------PS..L-RLE-VKDGLT...T-
Q8RTY5_9GAMM/861-988...QAFDK-----------DG.........SVFSSRMA---------------------PN..Q-VLD-ASGEQ.....-
Q7VN40_HAEDU/61-177...QRWFR-----------QG.........HQIRSEM.---------------------NG..K-CLE-VGR.......-
GLTL3_HUMAN/465-591..YKRWNF-----------IQ........NGAIMNKG.---------------------TG..R-CLE-VENRG....L-
Q82LA2_STRAW/332-460...QQWSL-----------TTS.....GGYVSLKSRA.---------------------SG..E-CLD-VSGAST...A-
GALT3_CAEEL/484-604..KHVFVF-----------DD.......QAGTLLHKK.---------------------TG..K-CVT-G.........-
GLTL1_HUMAN/431-552...QKWRR-----------KG.........SFIQHSV.---------------------SG..L-CLE-T.........-
Q825H7_STRAW/402-529.GDVRYDL-----------TV........QGEVLSRRK---------------------GS..L-AVT-PGNTD.....-
GALT7_DROME/467-582...GPWQY-----------NE.......HTKHLMHRV.---------------------HK..K-CMA-LHP.......-
Q8VUT1_9PSED/305-438...QNLHV-----------KPVDL..GNGYVELRARH.---------------------SN..K-CLD-VADAST...A-
Q70US9_ADEVO/400-521...SRWYF-----------DN........YGGIVNLR.---------------------TG..M-VMD-VKESN....P-
GALT8_DROME/446-570...QFWSF-----------DS.......KTHQVISGQQ---------------------QNFRH-CLE-AQP.......-
Q9K438_STRCO/427-551...QQWRH-----------RA........DGSLFNPQ.---------------------SG..R-CLD-IPSGGT...A-
Q7SIF1_TRIKI/2-122...SAWEI-----------AD........NGTIINPA.---------------------SS..L-VLS-SGAAN.....-
GALT4_MOUSE/444-574PVNIIWHF-----------KE........DGTIFHPH.---------------------TR..L-CLS-AYRTA....E-
GALT4_DROME/511-641...QFWYY-----------DR.......QTQRLVHGEN---------------------NK..R-CLE-GFVEN.....-
GALT6_CAEEL/475-606...EYWDF-----------KP.......KIGRFQNRK.---------------------TG..L-CLA-SPDIFDPTKD-
GLT11_CAEEL/482-602...QMWQV-----------SN........AGKLYSRS.---------------------VN..K-CAT-GSN.......-
Q8GB62_9GAMM/313-450...QVWSL-----------VDKG....SNTFEIRNKQ.---------------------SG..K-CLE-IANNSG...A-
Q6BE03_BACTU/674-805...QYWII-----------EDAG....NEYVYLKSKAD---------------------PS..R-VLD-VTGSST...Q-
O68641_CELCE/306-433...QKWAY-----------DA.......GSKALRNPQ.---------------------SG..L-CLD-ATGGAP..LR-
Q8RTY5_9GAMM/724-853...LRWDY-----------DG.........RFIRSAHD---------------------AN..I-VAD-AYGRG.....-
Q9RDQ1_STRCO/383-509...QGWEF-----------TPN......RTTQLRNTG.---------------------SG..K-CLD-LHTYA.....-
Q9SLV9_CUCSA/165-289...QRWSL-----------DA.......KDYTIDHPN.---------------------TD..M-VLD-VFSVPD...S-
GLT11_DROME/425-535...NPWHY-----------NYQ......HSSFVSNGN.---------------------....K-CLQ-IDV.......-
Q9L0N4_STRCO/326-472...QLWWI-----------DKQA....SGDYWIRNFAS---------------------AH..K-CLN-VKGQNG...G-
GALT7_MOUSE/533-649...KEWQY-----------FK.......SLHRFTHIT.---------------------SG..K-CLD-RSE.......-
GALT2_DROME/507-627...QRWIM-----------RE........GGLVRHYK.---------------------IN..V-CLD-SRDQ......-
GLT10_HUMAN/459-587...QLWKY-----------RK........DKTLYHPV.---------------------SG..S-CMD-CSE.......-
Q9K473_STRCO/837-959...QKWNP-----------QS........DGTVRNPQ.---------------------SG..K-CLD-ASGGTW...N-
GLT12_DROME/433-546...QSWHY-----------DS.......VSNQLMSNT.---------------------....K-CLE-FT........-
GALT1_DROME/473-597...EQWRY-----------EH.........QHIIHSN.---------------------TG..M-CLD-HQGLK.....-
AHV_ACTSK/47-157...QKWLF-----------YS........NGYIQNVE.---------------------TG..R-VLD-SNY.......-
Q8LKQ3_VISAL/8-135...TTWQI-----------RG........NGIILNPR.---------------------SM..M-VIG-TPSGSR..GT-
Q82HL7_STRAW/418-544.RNLRFTV-----------DA........QGVIRPAVA---------------------PD..H-AVT-P.........-
GALT9_CAEEL/450-571...ERWAY-----------EN.........KMIRNLK.---------------------SG..K-CMS-TANLK.....-
O62004_BRAFL/490-604...QEWDI-----------KG........DGFIGSKS.---------------------GN..K-VLD-VK........-
Q7NYA5_CHRVO/248-356...SAWTR-----------SG.........DAIRSAK.---------------------SG..L-CLS-ANR.......-
O96048_LUMTE/2-124...QQWKV-----------GK.........DVVHHRND---------------------KE..K-VFD-LCR.......-
Q86S91_9CILI/376-511...QRWEI-----------QDAG....NGYVFLKNVY.---------------------SG..L-YLD-VEKKSK...E-
Q97TI2_CLOAB/443-579...QKFSV-----------KASS....KDGQYFVSTKS---------------------SNGTK-VLD-DYNFGT...A-
O04071_SAMNI/311-434...TKWVL-----------SI........DGTITHRL.---------------------SG..L-VLT-APQAA.....-
Q9ZBF7_STRCO/336-461...QQFIL-----------AG........PRDLVNVQ.---------------------AN..K-CVD-VVDEKT...G-
Q868M7_CUCEC/115-242...QWFRY-----------YE........NGEIVNAK.---------------------QG..M-CLD-VEGSD.....-
GALT6_MOUSE/497-619PKDEEWEL-----------TQ........DQLIRNSG.---------------------SG..T-CLT-S.........-
Q9EWL5_STRCO/41-182...QSFAF-----------IPGRLSRTPLYTKPLTRK.---------------------....K-CVD-VQGANK...T-
Q82P89_STRAW/370-505...QRFRL-----------VHTG....SDYVRITNAN.---------------------SG..K-VAD-VADCGT...G-
Q7Y0V1_9FABA/137-258...QRWVF-----------KN........DGTIYSLY.---------------------YD..M-VMD-VRRSD....P-
GLT11_HUMAN/479-604...QQWTF-----------GK........NNRLYQVS.---------------------VG..Q-CLR-AVDPL....G-
GALT2_HUMAN/446-563...QKWEQ-----------IE.......GNSKLRHVG.---------------------SN..L-CLD-SRTA......-
GLT14_MOUSE/420-545...QLWTK-----------TG.........ARIEHIA.---------------------SH..L-CLD-TDMFGDS.TE-

PF03498

Q46102_CAMJU/29-187---TVFSI-----------MP-----TTTSAVQIRSLV---------------------LESDE-CIVTFFNPNI...P-
Q6UPC3_ECOLX/79-232---FDFQP-----------MV-----TRNGNYQLKS..---------------------LSTGL-CIRANFLERTPSSP-
Q7DK11_AGGAC/39-178---TVFNL-----------IP-----TNTGAFLIKD..---------------------ALLGF-CMTSHDFD......-
Q9RFY4_HELHT/29-183---TVFTI-----------IP-----TTSSAVQIRSFV---------------------LDKTE-CISVFFNPRL...P-
O32587_ECOLX/37-179---TLFSL-----------IP-----STTGAVQFKS..---------------------VLSGL-CFLDSKNSGL....-
CDTA_HELHP/86-226---QLWNL-----------NF-----FDNQAIQIQS..---------------------VSAKT-CLQTPTVRTT....-
CDTA_HAEDU/77-221---QEFEL-----------LP-----TDSGAVVIKS..---------------------VSQGR-CVTYNPVSTT....-
Q6EZE1_ECOLX/49-197---QEFQL-----------LP-----STNGNVLIRS..---------------------SALQT-CIRADYLSRTILSP-
CDTA_CAMJJ/115-260---QMWKL-----------IP-----MSNTAVQIKN..---------------------LGNGK-CIQAPITNLYGDFH-
Q47090_ECOLX/44-187---ALFTF-----------IT-----SDTGAVQIKS..---------------------IGSGQ-CLGNGESIT.....-

PF05588

O06016_CLOBO/1-147---NYWIP-----------YK----IASNTYIITNLKE---------------------Y...DKAWD-IYDLNGDI---
Q9LBT0_CLOBO/1-146---SLWNP-----------IK----IAINSYIICTLSI---------------------VNVTDYAWT-IYDNNNNI---
Q45841_CLOBO/1-146---CYWFP-----------IK----IAVNTYIMLSLNK---------------------VNELDYAWD-IYDTNENI---

PF07468

Q38719_AMAHP/2-154---LGHYT-----------EN------------YTVGG---------------------S.FVS-YLF-AESSQID----
Q38719_AMAHP/159-299---KTWFI-----------KR------------FTSGK---------------------PEFIN-CMN-AATQIVD----

PF08709

ITPR1_MOUSE/4-229QP.LH.ASSHQL--------------------------VDNPGC.NEVNSVN---CNTSWKIVLFMKWS-DN--------
A7SEK1_NEMVE/3-227QP.LH.ASNQEL--------------------------IDNPGC.KEVNCVN---CQTSWKISLFLSYD-EN--------
A8HAL5_DANRE/4-229QP.LH.ASNIEL--------------------------LDNRGC.KEVNALN---CNTSWKVTLFMKFS-EY--------
O13054_MAKNI/9-216RY.LHLS.....--------------------------YASGD..LMVDASF---MQTLWTMTPVMSGC-EL--------
O77089_PANAR/5-231QQ.LHVSSTHDL--------------------------RDHPGC.KEVNVLN---SNTCWKISLFLEHK-EN--------
P91905_CAEEL/13-215RY.LHMA.....--------------------------YSKG...YMVIASF---HQTLWNIQSVSSGS-MR--------
ITPR3_HUMAN/3-230QP.LH.ASNYEL--------------------------SDNAGC.KEVNSVN---CNTSWKINLFMQFR-DH--------
RY44_DROME/11-206RY.LHTT.....--------------------------KENEQ..SIVNASF---HVTHWSVQPYGTGI-SR--------
Q27J07_APLCA/1-225QP.LH.ASNCDL--------------------------VDNPGC.KEVNSVS---SNTCWKVMLFMDFK-EN--------
Q4DBL7_TRYCC/3-204IF.VHVTGR...--------------------------...........KHP---GLNTWGMPSEEDGC-DS--------
Q4QEZ2_LEIMA/11-201RY.LNVAPNVDE--------------------------EAADNWFLEVSVGE---SIQGFLIHLYDGDC-AA--------
Q4RLR0_TETNG/15-213RY.LHLS.....--------------------------ISNGN..IQVDASF---MQTLWNVHPICSGS-NI--------
Q4RY06_TETNG/4-165QP.LH.ASTHQL--------------------------VDNPGCNEGLSATD---R......HLCSKRG-QG--------
Q57XB2_TRYB2/3-212IF.LQTTVVSPT--------------------------RPVKH......ETF---GSASFPYEPTDGCG-RG--------
Q5TQX0_ANOGA/7-234RQNLHVAVTYEL--------------------------PDNPGS.KEVNVLN---SSTSWKITLFMEQR-EN--------
Q66S77_OIKDI/1-221QV.LH.ASPEAL--------------------------RDFPEC.MEVNASN---EPTNWKLTLFMKHN-EN--------
Q8TA74_HEMPU/8-204RY.LHLS.....--------------------------VERDDQPMIVVASF---QQTLWTVAPVSSGI-VK--------
ITPR_ASTPE/4-229QP.LH.PSNYEL--------------------------IDNPGC.KEVNSVN---CNTCWKVSLFMEHK-EN--------
Q9Y0A1_CAEEL/78-317KSQLH.LSSFNL--------------------------LDHQSA.AEVNCLN---EPTEWQVFMFLLFD-EN--------

PF02815

RYR2_RABIT/226-406SVDVKSVRMGSI--------------------------Q.RKAIMHH.....---EGHM.....DDGLN.LS--------
Q6J9T9_ASPFM/358-545KVKL..PEWGFD--------------------------QQEVTCARGG..TL---PNSLWYIESNHHPM.LP--------
RYR3_HUMAN/216-398AQDAKTSRLGPL--------------------------K.RKVILHQ.....---EGHM.....DDGLT.LQ--------
Q759J8_ASHGO/342-519QVKL..PKWGFE--------------------------QQEVTCATQG..RP---DLTLWYIEENTNPL.LS--------
ITPR_ASTPE/231-419SIPL......DK--------------------------GEDKPVMLK.....---VGTAQIREDREAFA.II--------
Q6FL03_CANGA/354-530EVKL..PKWGFD--------------------------QQEVTCATQG..KP---ELLLWYIEGSENPQ.LP--------
Q9GS15_CAEBR/327-562NANEKQNLHFSN--------------------------KNEKGWVK......---VICETHRVDKETFA.LL--------
PMT1_SCHPO/329-505HRRF..PDWGDY--------------------------QREVTCCRNC..VE---RSTTWFIESNYHDG.LP--------
Q91313_LITCT/214-394AADSKVARLGPL--------------------------K.RKAILHQ.....---EGHM.....DDALS.LS--------
Q7SH94_NEUCR/369-558KVKL..PTWASE--------------------------QQEVTCAKGG..SL---PNSLWYIEFNDHPQ.LG--------
O13054_MAKNI/219-399AVDAKSARLGPL--------------------------K.RKAILHK.....---EGHM.....DDALT.VA--------
ITPR_DROME/239-453SIPI......DA--------------------------DDDKPVMSM.....---VCCSPIKEDKEAFA.LI--------
Q6W3E4_RAT/232-432SIPI......DT--------------------------EEERPVMLK.....---IGTCQTKEDKEAFA.IV--------
ITPR1_HUMAN/232-433NIPI......DK--------------------------EEEKPVMLK.....---IGTSPVKEDKEAFA.IV--------
Q6BFC5_PARTE/240-444QVWLRTESIQNE--------------------------EENKDISKEK..KK---SVPAFNKVKKEEYV.FK--------
Q8TA74_HEMPU/220-400VVESVVG..GRA--------------------------AERKVVMLP.....---EGHM.....DDGFS.VV--------
Q6FK90_CANGA/355-531NDEL.LPDWGFG--------------------------QQEVNGNKKM..TD---SGNAWTIDSIMNLD.EK--------
Q8MXI9_CAEEL/274-503NATEKQNLHYSS--------------------------KNEKGWVK......---VICEKNRVDKETFA.LL--------
Q96WN5_EMEND/353-528NTNL..PQWGFK--------------------------QIETTCVKENKPRD---VYTHWNIETHTNDR.LP--------
P91905_CAEEL/220-400TTEVTKKGLGKV--------------------------EEKKAVALK.....---DGHM.....DDCYT.FF--------
O77089_PANAR/234-422SIPI......DK--------------------------EEDKPVMSK.....---VGCAPIKEDKEAFS.LV--------
Q6CPY0_KLULA/347-524EVKL..PKWGFE--------------------------QQEVTCASSG..VP---SLTLWYVEHNSNPL.LP--------
Q6CAY4_YARLI/355-531GNHL..PPWGFK--------------------------QGEVTCSNKVGKKD---KSTHWNFEQHWNER.MP--------
Q6C5U6_YARLI/339-516SVKL..PKWAFE--------------------------QQEVTCAKSG..TL---PNSIWYIESNSHPT.LV--------
RY44_DROME/211-392SYETKKKGVGKV--------------------------EEKQAILHE.....---EGKM.....DDCLD.FS--------
RYR1_PIG/212-391APDPKALRLGVL--------------------------K.KKAILHQ.....---EGHM.....DDALS.LT--------
PMT5_YEAST/339-517PEKL..PEWGFG--------------------------QQEVTCAYFA..RE---DLTSWYIEENENEISLP--------
PMT1_CANAL/359-534EVKL..PEWGFG--------------------------QQEVTSASQG..KR---ALTHWYIETNENSI.LP--------
PMT1_YEAST/343-520EVKL..PAWGFE--------------------------QQEVTCASSG..RH---DLTLWYVENNSNPL.LP--------
ITPR3_RAT/233-432NAPI......DV--------------------------EEERPIRLM.....---LGTCPTKEDKEAFA.IV--------

PF06268

FASC_STRPU/393-496-----QSGLFTA--------------------------.NG-------SEVS---KDTLWE-----F-------------
Q6AXQ1_RAT/24-138-----DGQDVFC--------------------------.NS-------RVLS---AYHMWT-----P-------------
SING_DROME/33-147-----TPDKLVC--------------------------.TA-------KTPG---ASEFWT-----V-------------
FSCN2_HUMAN/389-492-----ASGLLRA--------------------------.DA-------DAPA---GTALWE-----Y-------------
FSCN3_HUMAN/271-381-----PNSLLMA--------------------------.NV-------ILPG---PNEEFG-----I-------------
FSCN1_HUMAN/268-378-----KNGQLAA--------------------------.SV-------ETAG---DSELFL-----M-------------
Q6PBS5_DANRE/19-131-----SEDYLSC--------------------------.FA-------QTIG---EAELWA-----M-------------
FASC_XENLA/382-483-----HAGVLKA--------------------------.NA-------ENID---STTLWE-----Y-------------
FASC_STRPU/138-254-----GTRVLKS--------------------------.SK-------PGLT---KANYFI-----L-------------
FSCN2_HUMAN/20-133-----TEDQLSC--------------------------.FA-------TAVS---PAELWT-----V-------------
Q6AZJ6_XENLA/277-387-----KNGQLSA--------------------------.SV-------DTPA---ETELFL-----M-------------
Q6EEB3_PRODO/230-340-----KNGQLAA--------------------------.AI-------ETPG---ETEQFL-----M-------------
FSCN2_HUMAN/141-254-----PAGTLKA--------------------------GRN-------TRPG---KDELFD-----L-------------
FSCN1_HUMAN/391-493-----HAGVLKA--------------------------.SA-------ETVD---PASLWE-----Y-------------
FSCN2_HUMAN/266-376-----KNGQLAA--------------------------.IS-------DFVG---KDEEFT-----L-------------
Q6EE45_SCYCA/96-208-----PTGTMKA--------------------------GKS-------TKVG---KDELFV-----L-------------
FSCN1_HUMAN/20-134-----TEDRLSC--------------------------.FA-------QTVS---PAEKWS-----V-------------
Q6AZJ6_XENLA/152-265-----PSGTMKA--------------------------GKN-------SKAG---RDELFV-----L-------------
FASC_STRPU/16-130-----GEELICS--------------------------.ES-------STSN---PSANWT-----V-------------
Q6AZJ6_XENLA/32-144-----SEDRISC--------------------------.FS-------PSVS---PAEKWG-----V-------------
FSCN1_HUMAN/142-256-----PSGTLKA--------------------------GKA-------TKVG---KDELFA-----L-------------
SING_DROME/155-270-----SKAVLKS--------------------------.RS-------SSVT---RDELFS-----L-------------
Q6PBS5_DANRE/139-252-----PTGTLRS--------------------------GRC-------SKPG---KDELLI-----L-------------

PF06229

Q7QC94_ANOGA/71-260-----EDDA.LV--------------------------AIK-------KKVG---SDEVCT-----IRS-CAGR......
A7RWZ5_NEMVE/69-257-----SGS..LS--------------------------ASK-------KKAG---EKEIFS-----IRA-DKPK......
Q15ER4_SCHMA/95-286-----ITDD.IV--------------------------FKS-------QQAK---TNEMVI-----FRS-NKPL......
A1D4G2_NEOFI/89-280-----.......--------------------------ASS-------SSKA---SGRVIE-----VRG-DASSL.....
Q96MD3_HUMAN/4-156-----AED..IE--------------------------AKS-------KTAG---EEEMIK-----SLS-HS........
Q2UKA8_ASPOR/84-274-----.......--------------------------GKS-------SKAA---SGRVVE-----VRG-DATSL.....
FRG1_DROME/72-260-----QDDA.CV--------------------------ALR-------KKVG---QHEICK-----VRS-NASR......
Q6DDA8_XENTR/66-254-----EGD..LI--------------------------AQS-------KTAG---EGEMIK-----IRS-CVER......
FRG1_CAEEL/78-273-----NKEGHIY--------------------------VAS-------RTAT---ENEMVN-----IRT-DAIQ......
Q0UA03_PHANO/83-265-----.......--------------------------SSA-------ST..---....AE-----VRG-DVETI.....
A2Q890_ASPNC/96-312-----.......--------------------------VAS-------KTTA---SGTKVE-----IRG-DETTLDDGEE
Q566W5_DANRE/65-253-----SGD..IV--------------------------AKN-------KTAG---EEEMIK-----IRS-CTER......
A6SI98_BOTFB/86-272-----.......--------------------------LAS-------AK..---ENALPE-----IRG-DADSI.....

PF04601

Q9LJJ2_ARATH/1-141-----GLPPWRN--------------------------SIT---HDI.PHRS---TTQDWV-----L-------------
Q9LQ43_ARATH/1-142-----GLPPWRN--------------------------SVT---HDI.PHRS---ATQEWV-----L-------------
Q9CAS3_ARATH/251-396-----GVPPWRN--------------------------SVT---HDL.PNRS---ATQSSV-----V-------------
O04559_ARATH/227-368-----GLPPWRN--------------------------SVT---HDV.PHLS---ATQDSI-----S-------------
O04559_ARATH/1-144-----GTPPWRN--------------------------SVT---HDE.PHTS---KTKNWL-----I-------------
Q9CAS2_ARATH/1-139-----GLPPWRN--------------------------SVT---HDT.SH..---.VLDSF-----L-------------
Q9CAS3_ARATH/1-144-----GAPPWRN--------------------------SVT---CDREPHIS---ATKKWI-----L-------------

PF00167

Q28XC7_DROPS/16-141-----NFRPIGP--------------------------RDL---ER...PNR---MRNACF.....L-------------
Q4S3V1_TETNG/61-182-----TGQYKSG--------------------------S..---KT...GPG---QKAILF.....L-------------
P91672_DROME/249-377-----SGQPRRT--------------------------QIP---AS...RSL---GKLSTYT..NAI-------------
Q8R5L5_RAT/84-205-----YGRVKRG--------------------------S..---KV...SPI---MTVTHF.....L-------------
B1AK17_HUMAN/79-205-----EGEIMKG--------------------------N..---HV...KKN---KPAAHF.....L-------------
FGF1_CHICK/25-148-----NGNSKLG--------------------------P..---RT...HYG---QKAILF.....L-------------
Q8I6J6_CIOIN/91-218-----RGKPRRG--------------------------K..---RV...TWK---MQSAHW.....L-------------
Q9YH31_NOTVI/72-193-----NGRAKKG--------------------------N..---KV...SPT---MTVTHF.....L-------------
FGF16_MOUSE/61-187-----DGSPREG--------------------------Y..---RT...KRH---QKFTHF.....L-------------
Q5TLD5_DANRE/43-168-----KGRPLKG--------------------------K..---KT...RKE---SVASHF.....I-------------
A1YJ27_NPVSF/70-196-----AGKTHRV--------------------------LLL---KK...EKL---LDDFESA..HMF-------------
Q90XQ4_AMBME/55-181-----KGRPRKG--------------------------S..---KT...RQH---QREVHFM..KRL-------------
Q86GG2_CIOSA/55-180-----HGRPKKG--------------------------P..---TT...KLG---QVETMF.....L-------------
Q8I6J7_CIOIN/133-264-----RGRSRKG--------------------------R..---NV...KPE---SSSAHF.....L-------------
FG17_DANRE/53-178-----KGRPIRA--------------------------S..---KT...RQN---QREVHFI..KRL-------------
Q9E225_9ABAC/33-160-----EGKPRNV--------------------------LVN---SSGVHRPL---EPSSVKL..TTL-------------
Q8I6J5_CIOIN/56-181-----NGRPKRG--------------------------P..---HT...KEI---GTDEMF.....I-------------
Q4SAA6_TETNG/81-202-----NGRAKRG--------------------------N..---RA...TTA---MTVTHF.....L-------------
Q2NP32_NPVHC/29-154-----RGQARRV--------------------------QLP---KR...RLL---RNMSAYT..LIL-------------
Q4RWE4_TETNG/71-205-----EGQAMKG--------------------------N..---RV...KKT---KPAAHF.....L-------------
FGF1_NOTVI/2-125-----NGKTKPG--------------------------S..---RT...HFG---QKAILF.....L-------------
Q544I6_MOUSE/65-189-----KGIPVKG--------------------------K..---KT...KKE---QKTAHF.....L-------------
Q8VI79_RAT/32-156-----QGIPRQG--------------------------R..---RT...RRH---QLSTHF.....L-------------
A3EXK2_NEMVE/57-180-----RGLQRAG--------------------------N..---KT...KSG---MKSVQF.....L-------------
Q4RSP6_TETNG/17-145-----HGKPLRG--------------------------K..---KT...RRK---NRATHF.....L-------------
FGFH_NPVOP/29-156-----TGNPRRV--------------------------QLP---RQ...RPL---RMMNVYTFIMRI-------------
Q5M7N7_XENTR/65-189-----KGSPMKG--------------------------K..---KS...KKE---HKGSHF.....L-------------
FGF1_XENLA/25-148-----NGASKKG--------------------------S..---RT...HYG---QKAILF.....L-------------
O92401_NPVBM/28-154-----DGTPRKL--------------------------QIS---KG...RKL---GKFSVYA..MTL-------------
A6Y7S4_DIDAL/29-153-----TGQYKLG--------------------------S..---KT...GPG---QKAILFS..PCL-------------
Q66IF7_XENTR/61-197-----KGRPRRG--------------------------F..---KT...RRT---QKSSLF.....L-------------
Q4T869_TETNG/30-155-----KGRPIKA--------------------------S..---RT...REN---QREVHFI..KRL-------------
Q91BB2_NPVST/26-158-----SGRTKRV--------------------------RIR---ND...DPL---HNHINSI..NII-------------
Q9N1B9_SHEEP/84-207-----KGAPRRG--------------------------Q..---KT...RRK---NTSAHF.....L-------------
A7RZP2_NEMVE/41-163-----KGHTRPG--------------------------F..---KG...RNG---SRSVQF.....I-------------
LE756_CAEEL/72-207-----SGKPRRG--------------------------P..---NS...KKR---RKASHF.....L-------------
Q8R5L6_RAT/78-192-----NGRTKKG--------------------------N..---RV...SPT---MKVTHF.....L-------------
Q8T8A3_CIOSA/159-283-----HGRPKQG--------------------------C..---RV...HPN---NRHSQF.....L-------------
A7YT71_DANRE/25-149-----NGRTKDG--------------------------S..---RT...HKG---QNAVYF.....L-------------
Q4SCS5_TETNG/71-197-----DGQIMKG--------------------------N..---RV...KKN---KGAAHF.....L-------------
A7SH09_NEMVE/102-230-----NGHVKNA--------------------------S..---TV...LKQ---HRSHQF.....Q-------------
FGF1_DANRE/17-138-----NGKMKRG--------------------------P..---RT...HIG---QKAIFF.....L-------------
Q287N3_NPVAS/32-156-----EGRLKRT--------------------------VLL---KK...ELL---GSAVEQS..HVL-------------
Q80LI4_NPVAH/49-164-----ENKMRKL--------------------------LIQ---NL...NQQ---IKQ........L-------------
Q5TKR7_DANRE/53-179-----KGRPRRG--------------------------P..---NT...LPN---QRDVHFM..KRF-------------
Q8QLI3_9ABAC/34-158-----EGKLKRT--------------------------VLL---RK...ETL---GNKFEQS..HVT-------------
Q2LGG1_DANRE/81-202-----HGRLKRG--------------------------Y..---KA...SPA---MTVTHF.....L-------------
FGF18_MOUSE/53-178-----KGRPRKG--------------------------P..---KT...REN---QQDVHFM..KRY-------------
Q9J897_9ABAC/33-159-----AGKLKRV--------------------------VLL---KK...EKL---MDAFEQT..HVF-------------
Q0PV85_HALRO/186-312-----QGRARSG--------------------------C..---RS...KES---QKFTHF.....L-------------
Q1LXT4_DANRE/17-141-----RGKPRRG--------------------------H..---KA...RRR---HPSTHF.....L-------------
Q1HGX9_NPVAP/32-158-----VGRARRV--------------------------QIS---KH...RSL---RNMSKYT..FIM-------------
Q4SFA3_TETNG/9-140-----TGKTKRG--------------------------N..---RI...SPT---MSMAHF.....L-------------
Q9DFC9_DANRE/67-188-----AGKTKKG--------------------------N..---RV...STS---MTMTHF.....L-------------
A5PM81_DANRE/55-181-----EGQVMKG--------------------------N..---RV...KKT---KPSSHF.....V-------------
A7SRV3_NEMVE/407-534-----SGLTKNG--------------------------L..---GT...LPG---QDSVQF.....L-------------
Q8NF90_HUMAN/87-216-----RGKAKRG--------------------------CSP---RV...KPQ---HISTHF.....L-------------
FGF11_HUMAN/71-197-----EGQVMKG--------------------------N..---RV...KKT---KAAAHF.....L-------------
Q0KJ02_ORYLA/70-196-----DGTSRDG--------------------------T..---RS...RRH---QRFTHF.....L-------------
FGF4B_XENLA/68-189-----NGRTKKG--------------------------N..---RV...SPT---MTLTHF.....L-------------
A7RFG7_NEMVE/73-195-----NHHPRLG--------------------------F..---KV...KPG---KHTAHF.....L-------------
Q4VBV7_DANRE/72-196-----NGRPMRA--------------------------K..---KT...RRK---NTATHF.....L-------------
FGF3_DANRE/62-204-----KGRPRRG--------------------------F..---KT...RST---DKASLF.....L-------------
Q4SJV9_TETNG/17-140-----SGQPKLG--------------------------P..---RT...HRG---QKAVFF.....L-------------
Q6VTW1_NPVCD/28-157-----FGKARRL--------------------------QLS---RR...RTL---GNLSTYA..LIL-------------
Q8QG59_AMBME/67-191-----KGTPKRG--------------------------Q..---KT...KRK---NTSAHF.....L-------------
Q3YAG3_STRPU/203-330-----YGESRIA--------------------------K..---.....VRT---QKKAQF.....I-------------
FGF17_RAT/53-178-----QGRPRQA--------------------------S..---RS...RQN---QREAHFI..KRL-------------
A7SHR3_NEMVE/45-169-----SGNIKLP--------------------------K..---NT...TKS---QTASLF.....L-------------
Q5TLE2_DANRE/41-170-----RGKAKMG--------------------------SSP---RV...KSQ---HVSTHF.....L-------------
Q6E7C8_OIKDI/1583-1704-----RGYEISC--------------------------N..---NT...RAF---RNKISF.....L-------------
Q9PVY1_XENLA/62-188-----DGTPRDG--------------------------T..---RA...KRH---QKFTHF.....L-------------
Q8JMA6_9ABAC/35-159-----EGKLKRT--------------------------VLL---RK...ETL---GDNLQQS..HVL-------------
Q1XG75_DANRE/59-183-----HGRPLRG--------------------------R..---KN...RRK---NTATHF.....L-------------
Q0IIQ7_DANRE/50-175-----KGRPKKG--------------------------S..---KT...TQT---QQEVHFM..KRQ-------------
A7T359_NEMVE/53-177-----DGRIKPA--------------------------R..---KT...TST---QRAAHF.....L-------------
Q5GAD8_9VIRU/23-148-----AGNVRSG--------------------------K..---RT...AKT---NNSAQW.....L-------------

PF00340

IL1B_BOVIN/144-261-----IEERPVF--------------------------LGH---FR--GGQD---.ITDFR-----M-------------
IL1RA_MOUSE/61-174-----EADRPVS--------------------------LTN---TP--EEPL---IVTKFY-----F-------------
IL1RA_HUMAN/60-173-----EADQPVS--------------------------LTN---MP--DEGV---MVTKFY-----F-------------
IL1B_FELCA/146-263-----AEEMPVF--------------------------LGN---TK--GGQD---.ITDFI-----M-------------
Q9GL09_SHEEP/72-185-----ENDLFKL--------------------------ILK---..--.RQD---DNRDKS-----I-------------
IL1A_MOUSE/158-269-----QS.....--------------------------RVH---LA--RGLP---SMTDFQ-----I-------------
Q96KJ8_HUMAN/72-185-----ERDLFKL--------------------------ILK---..--.KED---ELGDRS-----I-------------
IL1B_CERAT/147-264-----AENMPVF--------------------------LGG---TR--GGQD---.ITDFT-----M-------------
Q9I8D2_CHICK/66-187-----EDSLRKL--------------------------ILK---KL--PRED---EVDETT-----K-------------
IL1B_PIG/145-262-----AEQKPVF--------------------------LGN---SK--GRQD---.ITDFT-----M-------------
IL1B_MOUSE/148-264-----AEHKPVF--------------------------LGN---N.--SGQD---.IIDFT-----M-------------
IL1A_RABIT/156-266-----EH.....--------------------------LVH---MA--RGLP---SMTDFQ-----I-------------
IL1A_BOVIN/156-265-----EK.....--------------------------LVH---MA--SGPP---SITDFQ-----I-------------
Q91Z66_SIGHI/73-186-----DGDSFKL--------------------------ILK---..--.KKD---ENWDTS-----I-------------
IL1A_CERAT/155-266-----DN.....--------------------------WVC---LA--KGLP---SITDFQ-----I-------------
IL1RA_RABIT/60-173-----EADQPVS--------------------------LTN---TP--DDSI---VVTKFY-----F-------------

PF05270

OTOG_MOUSE/1241-1384-----LELALRA--------------------------......YEHTEVFR---GGALFRL----L-------------
ABFB_ASPOR/358-502-----NVLYVAS--------------------------NGGVQTFDATTSFN---DDVSWVV----S-------------
Q82P18_STRAW/329-465-----YQLRVDP--------------------------TDG......TDQFR---QDSSFNP----V-------------
Q829S7_STRAW/176-312-----FLLRLDP--------------------------......YENTGQYR---ADSAFQL----V-------------
Q55841_SYNY3/35-174-----FELWLDK--------------------------FSG...FTESTIFR---NDATFIQ----R-------------
Q9HEY2_COCCA/355-499-----NVGYISS--------------------------NGGVKDFDNVSSFN---DDITWLV----E-------------
Q86ZN9_FUSOX/351-495-----NLGYASS--------------------------NGGVHDWDAAKSFV---DDVTFVV----A-------------
Q82P90_STRAW/346-481-----NLLRIQP--------------------------VST.......ALDR---QDATFYA----E-------------
ABFB_EMENI/357-506-----NVLYVAS--------------------------NGGVNTFDAATAFT---DDVSWVV----A-------------
ABF1_HYPJE/352-496-----NTLYIAS--------------------------NGGVHVFDATAAFN---DDVSFVV----S-------------
ABFB_ASPKW/350-494-----NVLYAAS--------------------------NGGVQTFDSKTSFN---NDVSFEI----E-------------

PF00197

IT2_PSOTE/2-176..EEMMCKDIGV--------------------YRD.QEGYQRLVVSKH.------NPLVVGFKK----------------
IAAS_ORYSJ/26-193....DSCQDLGV--------------------SRD.GAR.AWLGASQ..------PPHVVVFKK----------------
MIRA_RICDU/35-216..CKVKCGDVGI--------------------YID.QKGRRRLALSD..------KPFAFEFNK----------------
ALB1_PSOTE/4-171....SPCKNIGI--------------------STD.PEGKKRLVVSYQS------DPLVVKFHR----------------
ASP_THECC/30-208..CTTLCSDIGR--------------------HSDDDGQI.RLALSD..------NEWAWMFKK----------------
IAAS_HORVU/27-199.....WCQDLG.--------------------VFRDLKGGAWFLGATE.------PYHVVVFKK----------------
API8_SOLTU/39-219CRDDNFCAKVGV--------------------VIQNGKR..RLALVNE.------NPLDVLFQE----------------
ICW3_PSOTE/27-198..DVKCDQYIGI--------------------HRD.RNGNRRLVVTEE.------NPLELVLLK----------------
IDE3_ERYCA/1-168..KHEKCASIGI--------------------NRD.QKGYRRLVVTED.------YPLTVVLKK----------------
IECI_ERYVA/2-173..DLKCDQYIGI--------------------RRD.AKGYRRLVVTND.------NPLELVLVK----------------
IT1A_PSOTE/2-168..KRDTCKDIGI--------------------YRD.QKGYERLVVTDE.------NPLVVIFKK----------------
ITRA_SOYBN/26-199...DDKCGDIGI--------------------SIDHDDGTRRLVVSKN.------KPLVVQFQK----------------
ITRY_ACACO/2-171....ESCKDLGI--------------------SID.DENNRRLVVKDG.------HPLAVRFEK----------------
KTI1_SOYBN/27-197...DNKCEDIGI--------------------QID.DDGIRRLVLSKN.------KPLVVQFQK----------------
CPI1_SOLTU/47-221....LGCKNIGG--------------------NFKNGYPRLVTVDDDK.------DFIPFVFIK----------------
SPOR1_IPOBA/42-216...SDKCYNVGR--------------------FHDHMLRTTRLALSN..------SPFVFVIKP----------------
GWIN3_POPSP/32-195.FCECPCVPVGA--------------------NSD.....KYLAPNVSY------ADFRFKPDA----------------

PF07951

BXB_CLOBO/1075-1291----ESTDEIGL..IGIHR..FYESGIVFEE.YKDYFCISKWYLKEVKRKPYNLKLGCNWQFIPKDEGW-TE--------
BXE_CLOBU/1063-1250----..GNNIGL..LGFKA...............DTVVASTWYYTHMRDNTNS..NGFFWNFISEEHGW-QE--------
TETX_CLOTE/1105-1314----.KNASLGL..VGTHNGQIGND.....P.NRDILIASNWYFNHLKD..KI..LGCDWYFVPTDEGW-TN--------
BXA1_CLOBO/1088-1293----..GNDIGF..IGFHQ..........FN.NIAKLVASNWYNRQIERSSRT..LGCSWEFIPVDDGW-GE--------
BXG_CLOBO/1083-1297----..TKTFGLFGIGKFV....KDYGYVWDTYDNYFCISQWYLRRISENINKLRLGCNWQFIPVDEGW-TE--------
BXC1_CLOBO/1089-1291----NGENISGICSIGTYRFRLGGDW.YRHN.YLVPTVKQGNYASLLES......TSTHWGFVPV....-SE--------
Q45851_9CLOT/1072-1268----..GNDIGL..LGFHL...............NNLVASSWYYKNIRNNTRN..NGCFWSFISKEHGW-QE--------
Q45967_CLOBO/1085-1285----ATTNRLGILSIGSYSFKLGDDYWFNHE.YLIPVIKIEHYASLLES......TSTHWVFVPA....-SE--------
BXF_CLOBO/1083-1274----..GSNIGL..LGFHS...............NNLVASSWYYNNIRRNTSS..NGCFWSSISKENGW-KE--------
BXD_CLOBO/1076-1276----..ENTMLL..ADIYK.....PWRFSFK.NAYTPVAVTNYETKLLS......TSSFWKFISRDPGW-VE--------

PF14200

C6I1A8_9BACE/97-198......AEPVYQ------------------------L-KP..DAQ.K----I...S-QQWKIV-----------------
A8NAT6_COPC7/44-145.....DHANIIL------------------------Y-DY..HEF.A----E...N-ELWNIV-----------------
A8P1Y0_COPC7/90-188.....PGTPVTL------------------------W-NR...WE.G----A...H-QLWDFD-----------------
A8PCJ2_COPC7/37-137.....DGTPIQV------------------------W-GA...WE.G----R...N-QCWIFE-----------------
A1Z5I4_BEABA/43-129.........VKI------------------------V-TP..DPG.D----P...A-RRWDIQ-----------------
A6EHX4_9SPHI/63-161...........I------------------------Y-TK.ADPE.R----V...Q-QQWRIV-----------------
A6ERL3_9BACT/65-184.....NGGRMQI------------------------W-WN...KG.Y----K...N-QKWNLI-----------------
A6G9W3_9DELT/412-502......NNRVYL------------------------Y-G....DQ.N----A...D-AQWRFI-----------------
A6G9W3_9DELT/550-640.......DYVRL------------------------W-N....DE.Q----D...D-AQWRLI-----------------
A7EWX9_SCLS1/45-151.....SGADVLS------------------------A-SA...KT.A----D...N-QKWYFD-----------------
A7WK54_LYSSH/385-485.....NRTNVVV------------------------Y-PF..F.N.S----N...Q-QIFRLE-----------------
A8NDJ7_COPC7/40-145A..AFPFNNVQV------------------------W-EY..W.K.G----P...N-QTWFLD-----------------
A8NDJ7_COPC7/189-287.....PGTVIHL------------------------Y-K.....R.A----A...K-KYWRFQ-----------------
A9E912_9FLAO/86-187.....IGSTVTQ------------------------K-Y...GDG.L----S...N-AMFKFI-----------------
B0DSD3_LACBS/40-138.....PGTPITI------------------------W-GR..W.K.G----T...N-QTWTFE-----------------
B0MJQ2_9FIRM/249-352.....AGTNIKT------------------------W-IL...NE.S----GAQVY-KIWKLN-----------------
B1VUB2_STRGG/50-155.....AGGTVQQ------------------------W-ED...TD.S----P...F-QWWRLE-----------------
B2WIQ5_PYRTR/45-143.....NGTEMIM------------------------Y-DM..SPK.S----E...N-AQFILK-----------------
B2ZRS9_CLINE/46-144.....NSTPIVL------------------------G-EV..DET.S----T...N-QLWAFE-----------------
B3C971_9BACE/378-483.......PSLGI------------------------F-DM....N.S----D...N-SKWNFR-----------------
B3PKR2_CELJU/520-621.....NGATLNQ------------------------Y-T..WL.N.N----L...C-QKFSLR-----------------
B4V2C9_9ACTO/39-139..........RQ------------------------.-.C.EDSD.A----P...S-QWWRLE-----------------
B4V8E2_9ACTO/575-676.....DGAPVGT------------------------Y-RP...NT.G----R...N-QSWTLR-----------------
B5GTM6_STRCL/44-154......DTRIVL------------------------R-EY..DDG.A----K...S-QRWRFT-----------------
B6SS31_MAIZE/56-169G.GVHDGTAVVL------------------------W-E..WCKG..----E...N-QSWKIL-----------------
B8P008_POSPM/56-152.....TQVTLQV------------------------A-D....GS.S----S...N-QFWYMH-----------------
B8P2U3_POSPM/41-134.....NGTQIVL------------------------Q-AA..DGG.D----N...N-QFWYLH-----------------
B8PDH6_POSPM/53-148.......EQVKL------------------------T-NP..DGS.K----N...N-QLWSFQ-----------------
C0PSY5_PICSI/62-180HVALSEGTEIVL------------------------.-.C.KWNK.K----E...S-QKWKIS-----------------
C3I9T1_BACTU/507-614.....DGTNIMV------------------------Y-ER..SEA.K----P...Q-QDFKLI-----------------
C4LYE8_ENTHI/157-265.....GLNKIIC------------------------W-LK.KTEN.T----E...N-QQFLFI-----------------
C4M3J3_ENTHI/137-243.....SETNVIC------------------------W-ER...HE.E----L...N-QQFILQ-----------------
D9STT7_CLOC7/601-707.....EGASVIQ------------------------Y-NY...AA.S----A...N-QKWVFE-----------------
C6D9K8_PECCP/404-505.....NGAAGIQ------------------------W-N...DNG.G----W...N-QLWKIT-----------------
C6L2F6_APOCT/307-416.....GGKEVLV------------------------E-SGISTSGKD----N...N-QKWRMR-----------------
C6L2F6_APOCT/611-715.....YGGKELI------------------------V-S...DSN.E----G...W-SNWYLN-----------------
C7PHL4_CHIPD/338-435.....DGQLAVR------------------------N-EY...AG.N----I...Q-QQWRFE-----------------
C9YYM1_STRSW/484-581.....APLTLQN------------------------A-TT...DG..----....S-QDWKLT-----------------
D1BKB8_SANKS/626-731.....NNAPVSL------------------------W-QF...GG.G----A...H-QRWTVR-----------------
D1Q0S6_9BACT/375-479.....DSTPVLA------------------------.-PF..DFG.S----D...N-SKWNFT-----------------
D2QTB1_SPILD/373-478......TPTLAE------------------------F-DF....S.S----D...N-SKWNFR-----------------
D2S061_HALTV/623-726.....PGADLRH------------------------W-NV...TN.S----S...N-QLWKFQ-----------------
D2VXQ3_NAEGR/45-151.....NYSSIVQ------------------------V-NG....H.Y----S...S-VQWLIE-----------------
D3Q6V6_STANL/130-238.....KGMAIST------------------------V-EC...GD.D----R...L-QLFTLK-----------------
D4J5M3_9FIRM/492-590.....NGKNIDL------------------------W-NY...NM.R----G...S-QRWYLI-----------------
D4J5M3_9FIRM/739-837.....NGKNIEI------------------------W-NY...NM.G----K...A-QRWSLV-----------------
Q8A5P7_BACTN/65-167......GEPVFQ------------------------L-EP..EAS.K----S...N-QQWQIR-----------------
Q8X123_9AGAR/44-154.....DGAKIAG------------------------W-TGTWDEG.N----P...H-QKWYFN-----------------
Q9L153_STRCO/584-686.....DGAAVTT------------------------W-PP...NS.G----A...N-QRWTLT-----------------

PF00652

GALT3_MOUSE/505-627-----NGEHPNL------------------------V.PC...DATD....L---L.QKW--------------------
CRBG3_HUMAN/888-1017-----DKTHVIV------------------------NQPL....EGE....E---T.QKW--------------------
GLT10_CAEEL/536-662-----GKGFLHM------------------------K.KC...DSSS....D---L.QKW--------------------
CUPF_DICDI/32-142-----DNLKICV------------------------A.PL....NGN....A---T.QKW--------------------
Q7QIK5_ANOGA/491-617-----TKSYVHV------------------------A.TC...H.PG....I---KTQKW--------------------
Q7PZM5_ANOGA/438-564-----HTNKLFV------------------------R.SCD..K.DK....A---S.QKW--------------------
Q7Q0E9_ANOGA/461-587-----NNREVFV------------------------N.PCE..P.TN....P---R.QKW--------------------
Q7QDR0_ANOGA/437-565-----MNDKLIL------------------------N.RCN..R.KQ....E---S.QRW--------------------
ML1_VISAL/440-560-----KLRRIII------------------------Y.PA...T.GK....P---N.QMW--------------------
O96048_LUMTE/132-255-----SDKEAGA------------------------H.ICAWKQHGG....P---N.QKF--------------------
GALT7_CAEEL/478-592-----SGSEVTL------------------------Q.TC...TEDN....E---R.QKF--------------------
GLTL2_HUMAN/505-628-----NNKDLYL------------------------R.PC....DGK....A---R.QQW--------------------
GLT13_DROME/435-548-----LKDRLEM------------------------S.TC...RSHA....V---S.QSF--------------------
Q7NQK0_CHRVO/5-133-----VGSLIWL------------------------Y.EF....NAS....P---A.QQW--------------------
GALT4_CAEEL/461-580-----GGDWLIY------------------------GAHC...ELNN....G---A.QRW--------------------
Q8W2E8_IRIHO/447-569-----SLQQIII------------------------W.ST....TGN....P---N.QMW--------------------
Q9SLV9_CUCSA/35-159-----DLDYVTL------------------------Q.......SNKY..TP---S.QSW--------------------
AGALA_ASPNG/424-536-----TEGSVQM------------------------K.SC....LYE....R---DGQVF--------------------
GALT1_MOUSE/430-548-----DSQVPSI------------------------R.DC....TGS....R---S.QQW--------------------
GALT3_DROME/512-658-----KVEKVVL------------------------SMEC...DFKD....I---T.QKW--------------------
Q7Y0V1_9FABA/7-131-----MGGTLTV------------------------Q...M..NEYR....M---R.QGW--------------------
GLT12_MOUSE/440-569-----NGFAPYL------------------------R.DC....TNS....D---N.QRW--------------------
Q9ADL1_SORCE/171-307-----SGTALVQ------------------------R.AS....SGG....T---S.QQF--------------------
Q8C2S1_MOUSE/660-788-----DQNHIIL------------------------NTVS....TEK....L---T.QVW--------------------
Q9X583_9ACTO/367-502-----NGTPVQI------------------------W.DT....NGG....A---N.QRW--------------------
GALT9_MACFA/467-595-----FGLRLVV------------------------Q.RC...........S---G.QKW--------------------
Q8KKH3_BACCI/270-405-----DGAVVQQ------------------------W.TD....NGT....D---A.QKW--------------------
GALT5_HUMAN/810-932-----SQKILKV------------------------A.AC...DPVK....P---Y.QKW--------------------
Q7SBD7_NEUCR/100-230-----TRGNTDA------------------------Q.......EST....T---S.QQP--------------------
O04071_SAMNI/439-558-----SLRQIII------------------------YHP.....TGN....L---N.QQW--------------------
Q9HFA9_9TREE/43-172-----NGNQLQV------------------------W.SC...GNGN....A---N.QVW--------------------
Q9EWL6_STRCO/70-209-----DNAPVIV------------------------W.SC....NDR....P---N.QKW--------------------
Q824Z7_STRAW/111-218-----SSRGVRL------------------------V.KC....NDS....K---Y.QHW--------------------
Q9HFB1_9ASCO/416-528-----SGDGTAT------------------------ATNC....GNE....L---GSQVV--------------------
Y1454_MYCBO/33-153-----PGTWVST------------------------R.WC...DPNA....P---D.QQW--------------------
Q6TBQ9_CRYPV/535-659-----TKHKAEL------------------------L.DC...DPND....P---S.QHW--------------------
Q825I1_STRAW/713-838-----RGAALVL------------------------K.PR....TDS....E---S.QRW--------------------
Q7TLZ3_9ZZZZ/377-504-----NGALAEL------------------------W.TC....NSQ....S---N.QQW--------------------
Q7X2C9_STRTE/266-386-----NGARIQL------------------------Y.AC....SGG....S---N.QRW--------------------
GALT9_DROME/521-640-----SKDKLLM------------------------E.EC....SAS....L---SRQQW--------------------
GLT10_DROME/483-615-----KVGKVLA------------------------NKIC...DKNQ....L---E.QQW--------------------
Q825L5_STRAW/296-417-----NGTRLQI------------------------W.SC....SGA....A---N.QKW--------------------
Q6BE06_BACTU/699-826-----NGTNIIL------------------------W.NY....NGS....T---N.QKF--------------------
ENVE_SALTY/53-170-----KGDPVVL------------------------A.DC....DFS....R---A.LEF--------------------
Q6YBY0_TOXGO/500-612-----FGRKLRM------------------------V.EC...DDTD....P---Y.QIW--------------------
O86669_STRCO/329-444-----YQDDRRL------------------------P...............---..ARW--------------------
FLVS_FLAME/296-437-----NLTPIVI------------------------G.ST....DQTLQPYT---K.QRF--------------------
Q8RTY5_9GAMM/861-988-----AGAALIL------------------------Y.HH....HGD....S---N.QKW--------------------
Q7VN40_HAEDU/61-177-----DRNKLTL------------------------Q.QC....DGS....R---S.QQF--------------------
GLTL3_HUMAN/465-591-----AGIDLIL------------------------R.SC...........T---G.QRW--------------------
Q82LA2_STRAW/332-460-----NSAALIT------------------------Y.TC....NGG....T---N.QQW--------------------
GALT3_CAEEL/484-604-----ADQRVTL------------------------D.EC...GLGR....K---D.QMW--------------------
GLTL1_HUMAN/431-552-----KPAQLVT------------------------S.KC....QAD....A---QAQQW--------------------
Q825H7_STRAW/402-529-----PDADIVV------------------------K.VR....DGS....D---K.QRW--------------------
GALT7_DROME/467-582-----ATQQLSL------------------------G.HC...DVND....S---Y.QQW--------------------
Q8VUT1_9PSED/305-438-----NGADIRQ------------------------W.QC....NGN....T---N.QQF--------------------
Q70US9_ADEVO/400-521-----SLNEIIA------------------------H.PW....HGN....S---N.QQW--------------------
GALT8_DROME/446-570-----ELNAVTS------------------------S.VC...DPKN....H---K.QQW--------------------
Q9K438_STRCO/427-551-----NGTKLQI------------------------Y.DC....NGL....G---T.QKW--------------------
Q7SIF1_TRIKI/2-122-----SLLDLGV------------------------Q...T..NSYA....S---A.QGW--------------------
GALT4_MOUSE/444-574-----GRPSVHM------------------------K.TC...DALD....K---N.QLW--------------------
GALT4_DROME/511-641-----GIAKVVA------------------------N.SC...ENGN....D---R.QRW--------------------
GALT6_CAEEL/475-606-----EFNPPIV------------------------Q.KC....RSS....N---DRQNW--------------------
GLT11_CAEEL/482-602-----DVSALST------------------------LKFC....SLA....N---S.FQF--------------------
Q8GB62_9GAMM/313-450-----NGADLRQ------------------------W.SC....DGG....T---N.QRF--------------------
Q6BE03_BACTU/674-805-----NGTNIQV------------------------W.SN....YGT....L---N.QKF--------------------
O68641_CELCE/306-433-----DGQRLQT------------------------W.TC....NGT....T---A.QQW--------------------
Q8RTY5_9GAMM/724-853-----NDAQVGQ------------------------W.QF....HGG....A---N.QQW--------------------
Q9RDQ1_STRCO/383-509-----NSQDAWL------------------------W.QC....NGT....D---P.QKF--------------------
Q9SLV9_CUCSA/165-289-----TFPSVLV------------------------TNRR....DGS....A---S.QRW--------------------
GLT11_DROME/425-535-----NKVGLIL------------------------S.AC....DSD....V---TEQRW--------------------
Q9L0N4_STRCO/326-472-----TETPLNI------------------------A.TC....TNT....D---D.QEW--------------------
GALT7_MOUSE/533-649-----VLHQVFI------------------------S.TC...DSSK....M---T.QKW--------------------
GALT2_DROME/507-627-----SQQGVSA------------------------Q.HC....NSA....L---GTQRW--------------------
GLT10_HUMAN/459-587-----SDHRIFM------------------------N.TC...NPSS....L---T.QQW--------------------
Q9K473_STRCO/837-959-----DGTPVHL------------------------W.TC....HTG....P---N.QKW--------------------
GLT12_DROME/433-546-----DELNIFL------------------------A.IC...DAAN....G---K.QRW--------------------
GALT1_DROME/473-597-----SLDDAQV------------------------A.PC...DPHS....E---S.QRW--------------------
AHV_ACTSK/47-157-----NGNVYTL------------------------P.......ANG....G---NYQKW--------------------
Q8LKQ3_VISAL/8-135-----RGTTFTL------------------------Q.TL....GYS....L---G.QGW--------------------
Q82HL7_STRAW/418-544-----YGDALFL------------------------V.PA....EGR....A---A.QRW--------------------
GALT9_CAEEL/450-571-----PGDNAIV------------------------V.EC...DEKD....E---H.QKW--------------------
O62004_BRAFL/490-604-----SKSKVVL------------------------N.......NRH....D---D.AVW--------------------
Q7NYA5_CHRVO/248-356-----SGQSVSL------------------------L.QC....SGS....A---S.QRW--------------------
O96048_LUMTE/2-124-----GSKDVGA------------------------Q.VCAWKYHGG....T---N.QQW--------------------
Q86S91_9CILI/376-511-----DGGNIIQ------------------------Y.QF....NGN....G---N.QQW--------------------
Q97TI2_CLOAB/443-579-----DGTNVCQ------------------------W.TY....GGN....A---N.QLW--------------------
O04071_SAMNI/311-434-----QGTTLLL------------------------Q.KN...IH.A....A---S.QGW--------------------
Q9ZBF7_STRCO/336-461-----NGARLQL------------------------W.EC....SGR....D---N.QKW--------------------
Q868M7_CUCEC/115-242-----GSGNVGI------------------------Y.RC....DDL....R---D.QMW--------------------
GALT6_MOUSE/497-619-----QDKKPAM------------------------A.PC...NPRD....P---Y.QLW--------------------
Q9EWL5_STRCO/41-182-----NNANVIQ------------------------W.SC....NGN....T---N.QMW--------------------
Q82P89_STRAW/370-505-----DGTDVRQ------------------------W.TW....LDN....A---C.QQW--------------------
Q7Y0V1_9FABA/137-258-----SLKQIIL------------------------W.PY....TGN....P---N.QIW--------------------
GLT11_HUMAN/479-604-----QKGSVAM------------------------A.IC....DGS....S---S.QQW--------------------
GALT2_HUMAN/446-563-----KSGGLSV------------------------E.VC....GPA....L---S.QQW--------------------
GLT14_MOUSE/420-545-----DGKEVVV------------------------N.PC...ESSL....M---S.QHW--------------------

PF03498

Q46102_CAMJU/29-187-----IQKRFGI------------------------A-PCTLDPIF...FAE---VNELMIITPP...L-TAATP-----
Q6UPC3_ECOLX/79-232-----YATTLTM------------------------E-RC..PSSG...ERN---FEFMWSISEP...L-RPALA-----
Q7DK11_AGGAC/39-178-----...DLRL------------------------E-PC..GISVSGRTFS---LAYQWGILPPFGPS-KILRP-----
Q9RFY4_HELHT/29-183-----SGRGIGI------------------------T-PCSVDKIL...TIN---LYKLMLILPPLVEA-KTINP-----
O32587_ECOLX/37-179-----...SFET------------------------G-KCITDLKQPFKVVP---QSHLWMLNP....L-NTESP-----
CDTA_HELHP/86-226-----TYYSIYL------------------------T-KC....AT...SSN---LDQQWYITPV...A-LEPEP-----
CDTA_HAEDU/77-221-----FYSTVTL------------------------S-VC..DGAT...EPS---RDQTWYLAPP...V-LEATA-----
Q6EZE1_ECOLX/49-197-----FAFTITL------------------------E-KC..PGAK...EET---QEMLWAISPP...V-RAAKP-----
CDTA_CAMJJ/115-260-----KVFKIFT------------------------V-EC....AK...KDN---FDQQWFLTTP...P-FTAKP-----
Q47090_ECOLX/44-187-----...DFRL------------------------K-KCVDDLGRPFDTVP---PGLLWMLNPPLS.P-AIMSP-----

PF05588

O06016_CLOBO/1-147-----SDQPLLL------------------------Q-QLFYYEKSN----------QMFIFEKI---------------
Q9LBT0_CLOBO/1-146-----TDQPILN------------------------L-PNFDINNSN----------QILKLEKL---------------
Q45841_CLOBO/1-146-----LSQPLLL------------------------L-PNFDIYNSN----------QMFKLEKI---------------

PF07468

Q38719_AMAHP/2-154-----TGSKDVF------------------------H-VI---------------D------------------------
Q38719_AMAHP/159-299-----ETA..IL------------------------E-II---------------E------------------------

PF08709

ITPR1_MOUSE/4-229--------------------------------------------------------------------------------
A7SEK1_NEMVE/3-227--------------------------------------------------------------------------------
A8HAL5_DANRE/4-229--------------------------------------------------------------------------------
O13054_MAKNI/9-216--------------------------------------------------------------------------------
O77089_PANAR/5-231--------------------------------------------------------------------------------
P91905_CAEEL/13-215--------------------------------------------------------------------------------
ITPR3_HUMAN/3-230--------------------------------------------------------------------------------
RY44_DROME/11-206--------------------------------------------------------------------------------
Q27J07_APLCA/1-225--------------------------------------------------------------------------------
Q4DBL7_TRYCC/3-204--------------------------------------------------------------------------------
Q4QEZ2_LEIMA/11-201--------------------------------------------------------------------------------
Q4RLR0_TETNG/15-213--------------------------------------------------------------------------------
Q4RY06_TETNG/4-165--------------------------------------------------------------------------------
Q57XB2_TRYB2/3-212--------------------------------------------------------------------------------
Q5TQX0_ANOGA/7-234--------------------------------------------------------------------------------
Q66S77_OIKDI/1-221--------------------------------------------------------------------------------
Q8TA74_HEMPU/8-204--------------------------------------------------------------------------------
ITPR_ASTPE/4-229--------------------------------------------------------------------------------
Q9Y0A1_CAEEL/78-317--------------------------------------------------------------------------------

PF02815

RYR2_RABIT/226-406--------------------------------------------------------------------------------
Q6J9T9_ASPFM/358-545--------------------------------------------------------------------------------
RYR3_HUMAN/216-398--------------------------------------------------------------------------------
Q759J8_ASHGO/342-519--------------------------------------------------------------------------------
ITPR_ASTPE/231-419--------------------------------------------------------------------------------
Q6FL03_CANGA/354-530--------------------------------------------------------------------------------
Q9GS15_CAEBR/327-562--------------------------------------------------------------------------------
PMT1_SCHPO/329-505--------------------------------------------------------------------------------
Q91313_LITCT/214-394--------------------------------------------------------------------------------
Q7SH94_NEUCR/369-558--------------------------------------------------------------------------------
O13054_MAKNI/219-399--------------------------------------------------------------------------------
ITPR_DROME/239-453--------------------------------------------------------------------------------
Q6W3E4_RAT/232-432--------------------------------------------------------------------------------
ITPR1_HUMAN/232-433--------------------------------------------------------------------------------
Q6BFC5_PARTE/240-444--------------------------------------------------------------------------------
Q8TA74_HEMPU/220-400--------------------------------------------------------------------------------
Q6FK90_CANGA/355-531--------------------------------------------------------------------------------
Q8MXI9_CAEEL/274-503--------------------------------------------------------------------------------
Q96WN5_EMEND/353-528--------------------------------------------------------------------------------
P91905_CAEEL/220-400--------------------------------------------------------------------------------
O77089_PANAR/234-422--------------------------------------------------------------------------------
Q6CPY0_KLULA/347-524--------------------------------------------------------------------------------
Q6CAY4_YARLI/355-531--------------------------------------------------------------------------------
Q6C5U6_YARLI/339-516--------------------------------------------------------------------------------
RY44_DROME/211-392--------------------------------------------------------------------------------
RYR1_PIG/212-391--------------------------------------------------------------------------------
PMT5_YEAST/339-517--------------------------------------------------------------------------------
PMT1_CANAL/359-534--------------------------------------------------------------------------------
PMT1_YEAST/343-520--------------------------------------------------------------------------------
ITPR3_RAT/233-432--------------------------------------------------------------------------------

PF06268

FASC_STRPU/393-496--------------------------------------------------------------------------------
Q6AXQ1_RAT/24-138--------------------------------------------------------------------------------
SING_DROME/33-147--------------------------------------------------------------------------------
FSCN2_HUMAN/389-492--------------------------------------------------------------------------------
FSCN3_HUMAN/271-381--------------------------------------------------------------------------------
FSCN1_HUMAN/268-378--------------------------------------------------------------------------------
Q6PBS5_DANRE/19-131--------------------------------------------------------------------------------
FASC_XENLA/382-483--------------------------------------------------------------------------------
FASC_STRPU/138-254--------------------------------------------------------------------------------
FSCN2_HUMAN/20-133--------------------------------------------------------------------------------
Q6AZJ6_XENLA/277-387--------------------------------------------------------------------------------
Q6EEB3_PRODO/230-340--------------------------------------------------------------------------------
FSCN2_HUMAN/141-254--------------------------------------------------------------------------------
FSCN1_HUMAN/391-493--------------------------------------------------------------------------------
FSCN2_HUMAN/266-376--------------------------------------------------------------------------------
Q6EE45_SCYCA/96-208--------------------------------------------------------------------------------
FSCN1_HUMAN/20-134--------------------------------------------------------------------------------
Q6AZJ6_XENLA/152-265--------------------------------------------------------------------------------
FASC_STRPU/16-130--------------------------------------------------------------------------------
Q6AZJ6_XENLA/32-144--------------------------------------------------------------------------------
FSCN1_HUMAN/142-256--------------------------------------------------------------------------------
SING_DROME/155-270--------------------------------------------------------------------------------
Q6PBS5_DANRE/139-252--------------------------------------------------------------------------------

PF06229

Q7QC94_ANOGA/71-260.EDISSKELPVEESGDLDQVELNYVKKFQ....KFQDKKI......RVSKEDKLTLKKAKEDGALHEALLDRRSKMKADR
A7RWZ5_NEMVE/69-257.S.KPKTDSQVEDEEDVTNLELSYVKKFQ....SFQDRKI......KLSKEEQSNLKKARLDGRLHEEMLDRREKMKSDK
Q15ER4_SCHMA/95-286.IHDPLLDIPEEEREGLKKAEVNYVRKFQ....SWQDPKL......RLSKEDFSDVKRARHSGNLYECLLDRREKMKSDR
A1D4G2_NEOFI/89-280.GFETTLRIRMQARFKPRIKASKETRARE....KISRKELEGIVGRRLEEHEVKRLKRARREGTFHEEVLDVRVKGKHDK
Q96MD3_HUMAN/4-156.......................................L......PLSLKGPGDPRSASAALLLHAIFTD.KISLQPGF
Q2UKA8_ASPOR/84-274.SFETTMRIRMQARFKPRIKASKETKAKE....KISRKELEEIVGRRLDDDEVRRLKRARKEGNFHEEVLDVRVRGKHDK
FRG1_DROME/72-260.D.VVIDTEPKEEKGDLGEVEKNYVKKFQ....KFQDKKM......RINQNDVKELEQAKAQGSLHETLLDRRSKMKADR
Q6DDA8_XENTR/66-254.DGKSEDEIPKEDKGNVKQCEINYVKKFQ....SFQDNKL......KVSLEDNKDLKKARKEGNFHETLLDRRSKLKADR
FRG1_CAEEL/78-273.E.GPVDWRSVEDRKNARECETAYVKMYQHSKVDLKNRHI......AIDVKDKKGVKKAQADGSAHELLLDRRMKMKSDR
Q0UA03_PHANO/83-265.TFNTTFRIRMQARFKPRLKASKEEKAQA....KISKKELEDIIGRRLNDDEVRRLKKSRREGNFHETALDMKVKSSHDK
A2Q890_ASPNC/96-312DGGGTNIRVRMQARFKPRIQASKEIKARE....KIGRKELEGIVGRRLDDDEVKRLRKARKEGDFHEVVLDVRVRGKHDK
Q566W5_DANRE/65-253.EVKRKDDIADEDRGDVKNCELNYVKKFQ....SFQDRKL......RLNEEDSGSLKKARTDGKFHEALLDRRSKMKADR
A6SI98_BOTFB/86-272.NFNTTIRIRMQARFKPKLKASKEERASQ....KISRKELEDAVGRRLDDDEVRKLKRARKEGDYHEALLLIKVKNKHDK

PF04601

Q9LJJ2_ARATH/1-141--------------------------------------------------------------------------------
Q9LQ43_ARATH/1-142--------------------------------------------------------------------------------
Q9CAS3_ARATH/251-396--------------------------------------------------------------------------------
O04559_ARATH/227-368--------------------------------------------------------------------------------
O04559_ARATH/1-144--------------------------------------------------------------------------------
Q9CAS2_ARATH/1-139--------------------------------------------------------------------------------
Q9CAS3_ARATH/1-144--------------------------------------------------------------------------------

PF00167

Q28XC7_DROPS/16-141--------------------------------------------------------------------------------
Q4S3V1_TETNG/61-182--------------------------------------------------------------------------------
P91672_DROME/249-377--------------------------------------------------------------------------------
Q8R5L5_RAT/84-205--------------------------------------------------------------------------------
B1AK17_HUMAN/79-205--------------------------------------------------------------------------------
FGF1_CHICK/25-148--------------------------------------------------------------------------------
Q8I6J6_CIOIN/91-218--------------------------------------------------------------------------------
Q9YH31_NOTVI/72-193--------------------------------------------------------------------------------
FGF16_MOUSE/61-187--------------------------------------------------------------------------------
Q5TLD5_DANRE/43-168--------------------------------------------------------------------------------
A1YJ27_NPVSF/70-196--------------------------------------------------------------------------------
Q90XQ4_AMBME/55-181--------------------------------------------------------------------------------
Q86GG2_CIOSA/55-180--------------------------------------------------------------------------------
Q8I6J7_CIOIN/133-264--------------------------------------------------------------------------------
FG17_DANRE/53-178--------------------------------------------------------------------------------
Q9E225_9ABAC/33-160--------------------------------------------------------------------------------
Q8I6J5_CIOIN/56-181--------------------------------------------------------------------------------
Q4SAA6_TETNG/81-202--------------------------------------------------------------------------------
Q2NP32_NPVHC/29-154--------------------------------------------------------------------------------
Q4RWE4_TETNG/71-205--------------------------------------------------------------------------------
FGF1_NOTVI/2-125--------------------------------------------------------------------------------
Q544I6_MOUSE/65-189--------------------------------------------------------------------------------
Q8VI79_RAT/32-156--------------------------------------------------------------------------------
A3EXK2_NEMVE/57-180--------------------------------------------------------------------------------
Q4RSP6_TETNG/17-145--------------------------------------------------------------------------------
FGFH_NPVOP/29-156--------------------------------------------------------------------------------
Q5M7N7_XENTR/65-189--------------------------------------------------------------------------------
FGF1_XENLA/25-148--------------------------------------------------------------------------------
O92401_NPVBM/28-154--------------------------------------------------------------------------------
A6Y7S4_DIDAL/29-153--------------------------------------------------------------------------------
Q66IF7_XENTR/61-197--------------------------------------------------------------------------------
Q4T869_TETNG/30-155--------------------------------------------------------------------------------
Q91BB2_NPVST/26-158--------------------------------------------------------------------------------
Q9N1B9_SHEEP/84-207--------------------------------------------------------------------------------
A7RZP2_NEMVE/41-163--------------------------------------------------------------------------------
LE756_CAEEL/72-207--------------------------------------------------------------------------------
Q8R5L6_RAT/78-192--------------------------------------------------------------------------------
Q8T8A3_CIOSA/159-283--------------------------------------------------------------------------------
A7YT71_DANRE/25-149--------------------------------------------------------------------------------
Q4SCS5_TETNG/71-197--------------------------------------------------------------------------------
A7SH09_NEMVE/102-230--------------------------------------------------------------------------------
FGF1_DANRE/17-138--------------------------------------------------------------------------------
Q287N3_NPVAS/32-156--------------------------------------------------------------------------------
Q80LI4_NPVAH/49-164--------------------------------------------------------------------------------
Q5TKR7_DANRE/53-179--------------------------------------------------------------------------------
Q8QLI3_9ABAC/34-158--------------------------------------------------------------------------------
Q2LGG1_DANRE/81-202--------------------------------------------------------------------------------
FGF18_MOUSE/53-178--------------------------------------------------------------------------------
Q9J897_9ABAC/33-159--------------------------------------------------------------------------------
Q0PV85_HALRO/186-312--------------------------------------------------------------------------------
Q1LXT4_DANRE/17-141--------------------------------------------------------------------------------
Q1HGX9_NPVAP/32-158--------------------------------------------------------------------------------
Q4SFA3_TETNG/9-140--------------------------------------------------------------------------------
Q9DFC9_DANRE/67-188--------------------------------------------------------------------------------
A5PM81_DANRE/55-181--------------------------------------------------------------------------------
A7SRV3_NEMVE/407-534--------------------------------------------------------------------------------
Q8NF90_HUMAN/87-216--------------------------------------------------------------------------------
FGF11_HUMAN/71-197--------------------------------------------------------------------------------
Q0KJ02_ORYLA/70-196--------------------------------------------------------------------------------
FGF4B_XENLA/68-189--------------------------------------------------------------------------------
A7RFG7_NEMVE/73-195--------------------------------------------------------------------------------
Q4VBV7_DANRE/72-196--------------------------------------------------------------------------------
FGF3_DANRE/62-204--------------------------------------------------------------------------------
Q4SJV9_TETNG/17-140--------------------------------------------------------------------------------
Q6VTW1_NPVCD/28-157--------------------------------------------------------------------------------
Q8QG59_AMBME/67-191--------------------------------------------------------------------------------
Q3YAG3_STRPU/203-330--------------------------------------------------------------------------------
FGF17_RAT/53-178--------------------------------------------------------------------------------
A7SHR3_NEMVE/45-169--------------------------------------------------------------------------------
Q5TLE2_DANRE/41-170--------------------------------------------------------------------------------
Q6E7C8_OIKDI/1583-1704--------------------------------------------------------------------------------
Q9PVY1_XENLA/62-188--------------------------------------------------------------------------------
Q8JMA6_9ABAC/35-159--------------------------------------------------------------------------------
Q1XG75_DANRE/59-183--------------------------------------------------------------------------------
Q0IIQ7_DANRE/50-175--------------------------------------------------------------------------------
A7T359_NEMVE/53-177--------------------------------------------------------------------------------
Q5GAD8_9VIRU/23-148--------------------------------------------------------------------------------

PF00340

IL1B_BOVIN/144-261--------------------------------------------------------------------------------
IL1RA_MOUSE/61-174--------------------------------------------------------------------------------
IL1RA_HUMAN/60-173--------------------------------------------------------------------------------
IL1B_FELCA/146-263--------------------------------------------------------------------------------
Q9GL09_SHEEP/72-185--------------------------------------------------------------------------------
IL1A_MOUSE/158-269--------------------------------------------------------------------------------
Q96KJ8_HUMAN/72-185--------------------------------------------------------------------------------
IL1B_CERAT/147-264--------------------------------------------------------------------------------
Q9I8D2_CHICK/66-187--------------------------------------------------------------------------------
IL1B_PIG/145-262--------------------------------------------------------------------------------
IL1B_MOUSE/148-264--------------------------------------------------------------------------------
IL1A_RABIT/156-266--------------------------------------------------------------------------------
IL1A_BOVIN/156-265--------------------------------------------------------------------------------
Q91Z66_SIGHI/73-186--------------------------------------------------------------------------------
IL1A_CERAT/155-266--------------------------------------------------------------------------------
IL1RA_RABIT/60-173--------------------------------------------------------------------------------

PF05270

OTOG_MOUSE/1241-1384--------------------------------------------------------------------------------
ABFB_ASPOR/358-502--------------------------------------------------------------------------------
Q82P18_STRAW/329-465--------------------------------------------------------------------------------
Q829S7_STRAW/176-312--------------------------------------------------------------------------------
Q55841_SYNY3/35-174--------------------------------------------------------------------------------
Q9HEY2_COCCA/355-499--------------------------------------------------------------------------------
Q86ZN9_FUSOX/351-495--------------------------------------------------------------------------------
Q82P90_STRAW/346-481--------------------------------------------------------------------------------
ABFB_EMENI/357-506--------------------------------------------------------------------------------
ABF1_HYPJE/352-496--------------------------------------------------------------------------------
ABFB_ASPKW/350-494--------------------------------------------------------------------------------

PF00197

IT2_PSOTE/2-176--------------------------------------------------------------------------------
IAAS_ORYSJ/26-193--------------------------------------------------------------------------------
MIRA_RICDU/35-216--------------------------------------------------------------------------------
ALB1_PSOTE/4-171--------------------------------------------------------------------------------
ASP_THECC/30-208--------------------------------------------------------------------------------
IAAS_HORVU/27-199--------------------------------------------------------------------------------
API8_SOLTU/39-219--------------------------------------------------------------------------------
ICW3_PSOTE/27-198--------------------------------------------------------------------------------
IDE3_ERYCA/1-168--------------------------------------------------------------------------------
IECI_ERYVA/2-173--------------------------------------------------------------------------------
IT1A_PSOTE/2-168--------------------------------------------------------------------------------
ITRA_SOYBN/26-199--------------------------------------------------------------------------------
ITRY_ACACO/2-171--------------------------------------------------------------------------------
KTI1_SOYBN/27-197--------------------------------------------------------------------------------
CPI1_SOLTU/47-221--------------------------------------------------------------------------------
SPOR1_IPOBA/42-216--------------------------------------------------------------------------------
GWIN3_POPSP/32-195--------------------------------------------------------------------------------

PF07951

BXB_CLOBO/1075-1291--------------------------------------------------------------------------------
BXE_CLOBU/1063-1250--------------------------------------------------------------------------------
TETX_CLOTE/1105-1314--------------------------------------------------------------------------------
BXA1_CLOBO/1088-1293--------------------------------------------------------------------------------
BXG_CLOBO/1083-1297--------------------------------------------------------------------------------
BXC1_CLOBO/1089-1291--------------------------------------------------------------------------------
Q45851_9CLOT/1072-1268--------------------------------------------------------------------------------
Q45967_CLOBO/1085-1285--------------------------------------------------------------------------------
BXF_CLOBO/1083-1274--------------------------------------------------------------------------------
BXD_CLOBO/1076-1276--------------------------------------------------------------------------------

PF14200

C6I1A8_9BACE/97-198--------------------------------------------------------------------------------
A8NAT6_COPC7/44-145--------------------------------------------------------------------------------
A8P1Y0_COPC7/90-188--------------------------------------------------------------------------------
A8PCJ2_COPC7/37-137--------------------------------------------------------------------------------
A1Z5I4_BEABA/43-129--------------------------------------------------------------------------------
A6EHX4_9SPHI/63-161--------------------------------------------------------------------------------
A6ERL3_9BACT/65-184--------------------------------------------------------------------------------
A6G9W3_9DELT/412-502--------------------------------------------------------------------------------
A6G9W3_9DELT/550-640--------------------------------------------------------------------------------
A7EWX9_SCLS1/45-151--------------------------------------------------------------------------------
A7WK54_LYSSH/385-485--------------------------------------------------------------------------------
A8NDJ7_COPC7/40-145--------------------------------------------------------------------------------
A8NDJ7_COPC7/189-287--------------------------------------------------------------------------------
A9E912_9FLAO/86-187--------------------------------------------------------------------------------
B0DSD3_LACBS/40-138--------------------------------------------------------------------------------
B0MJQ2_9FIRM/249-352--------------------------------------------------------------------------------
B1VUB2_STRGG/50-155--------------------------------------------------------------------------------
B2WIQ5_PYRTR/45-143--------------------------------------------------------------------------------
B2ZRS9_CLINE/46-144--------------------------------------------------------------------------------
B3C971_9BACE/378-483--------------------------------------------------------------------------------
B3PKR2_CELJU/520-621--------------------------------------------------------------------------------
B4V2C9_9ACTO/39-139--------------------------------------------------------------------------------
B4V8E2_9ACTO/575-676--------------------------------------------------------------------------------
B5GTM6_STRCL/44-154--------------------------------------------------------------------------------
B6SS31_MAIZE/56-169--------------------------------------------------------------------------------
B8P008_POSPM/56-152--------------------------------------------------------------------------------
B8P2U3_POSPM/41-134--------------------------------------------------------------------------------
B8PDH6_POSPM/53-148--------------------------------------------------------------------------------
C0PSY5_PICSI/62-180--------------------------------------------------------------------------------
C3I9T1_BACTU/507-614--------------------------------------------------------------------------------
C4LYE8_ENTHI/157-265--------------------------------------------------------------------------------
C4M3J3_ENTHI/137-243--------------------------------------------------------------------------------
D9STT7_CLOC7/601-707--------------------------------------------------------------------------------
C6D9K8_PECCP/404-505--------------------------------------------------------------------------------
C6L2F6_APOCT/307-416--------------------------------------------------------------------------------
C6L2F6_APOCT/611-715--------------------------------------------------------------------------------
C7PHL4_CHIPD/338-435--------------------------------------------------------------------------------
C9YYM1_STRSW/484-581--------------------------------------------------------------------------------
D1BKB8_SANKS/626-731--------------------------------------------------------------------------------
D1Q0S6_9BACT/375-479--------------------------------------------------------------------------------
D2QTB1_SPILD/373-478--------------------------------------------------------------------------------
D2S061_HALTV/623-726--------------------------------------------------------------------------------
D2VXQ3_NAEGR/45-151--------------------------------------------------------------------------------
D3Q6V6_STANL/130-238--------------------------------------------------------------------------------
D4J5M3_9FIRM/492-590--------------------------------------------------------------------------------
D4J5M3_9FIRM/739-837--------------------------------------------------------------------------------
Q8A5P7_BACTN/65-167--------------------------------------------------------------------------------
Q8X123_9AGAR/44-154--------------------------------------------------------------------------------
Q9L153_STRCO/584-686--------------------------------------------------------------------------------

PF00652

GALT3_MOUSE/505-627--------------------------------------------------------------------------------
CRBG3_HUMAN/888-1017--------------------------------------------------------------------------------
GLT10_CAEEL/536-662--------------------------------------------------------------------------------
CUPF_DICDI/32-142--------------------------------------------------------------------------------
Q7QIK5_ANOGA/491-617--------------------------------------------------------------------------------
Q7PZM5_ANOGA/438-564--------------------------------------------------------------------------------
Q7Q0E9_ANOGA/461-587--------------------------------------------------------------------------------
Q7QDR0_ANOGA/437-565--------------------------------------------------------------------------------
ML1_VISAL/440-560--------------------------------------------------------------------------------
O96048_LUMTE/132-255--------------------------------------------------------------------------------
GALT7_CAEEL/478-592--------------------------------------------------------------------------------
GLTL2_HUMAN/505-628--------------------------------------------------------------------------------
GLT13_DROME/435-548--------------------------------------------------------------------------------
Q7NQK0_CHRVO/5-133--------------------------------------------------------------------------------
GALT4_CAEEL/461-580--------------------------------------------------------------------------------
Q8W2E8_IRIHO/447-569--------------------------------------------------------------------------------
Q9SLV9_CUCSA/35-159--------------------------------------------------------------------------------
AGALA_ASPNG/424-536--------------------------------------------------------------------------------
GALT1_MOUSE/430-548--------------------------------------------------------------------------------
GALT3_DROME/512-658--------------------------------------------------------------------------------
Q7Y0V1_9FABA/7-131--------------------------------------------------------------------------------
GLT12_MOUSE/440-569--------------------------------------------------------------------------------
Q9ADL1_SORCE/171-307--------------------------------------------------------------------------------
Q8C2S1_MOUSE/660-788--------------------------------------------------------------------------------
Q9X583_9ACTO/367-502--------------------------------------------------------------------------------
GALT9_MACFA/467-595--------------------------------------------------------------------------------
Q8KKH3_BACCI/270-405--------------------------------------------------------------------------------
GALT5_HUMAN/810-932--------------------------------------------------------------------------------
Q7SBD7_NEUCR/100-230--------------------------------------------------------------------------------
O04071_SAMNI/439-558--------------------------------------------------------------------------------
Q9HFA9_9TREE/43-172--------------------------------------------------------------------------------
Q9EWL6_STRCO/70-209--------------------------------------------------------------------------------
Q824Z7_STRAW/111-218--------------------------------------------------------------------------------
Q9HFB1_9ASCO/416-528--------------------------------------------------------------------------------
Y1454_MYCBO/33-153--------------------------------------------------------------------------------
Q6TBQ9_CRYPV/535-659--------------------------------------------------------------------------------
Q825I1_STRAW/713-838--------------------------------------------------------------------------------
Q7TLZ3_9ZZZZ/377-504--------------------------------------------------------------------------------
Q7X2C9_STRTE/266-386--------------------------------------------------------------------------------
GALT9_DROME/521-640--------------------------------------------------------------------------------
GLT10_DROME/483-615--------------------------------------------------------------------------------
Q825L5_STRAW/296-417--------------------------------------------------------------------------------
Q6BE06_BACTU/699-826--------------------------------------------------------------------------------
ENVE_SALTY/53-170--------------------------------------------------------------------------------
Q6YBY0_TOXGO/500-612--------------------------------------------------------------------------------
O86669_STRCO/329-444--------------------------------------------------------------------------------
FLVS_FLAME/296-437--------------------------------------------------------------------------------
Q8RTY5_9GAMM/861-988--------------------------------------------------------------------------------
Q7VN40_HAEDU/61-177--------------------------------------------------------------------------------
GLTL3_HUMAN/465-591--------------------------------------------------------------------------------
Q82LA2_STRAW/332-460--------------------------------------------------------------------------------
GALT3_CAEEL/484-604--------------------------------------------------------------------------------
GLTL1_HUMAN/431-552--------------------------------------------------------------------------------
Q825H7_STRAW/402-529--------------------------------------------------------------------------------
GALT7_DROME/467-582--------------------------------------------------------------------------------
Q8VUT1_9PSED/305-438--------------------------------------------------------------------------------
Q70US9_ADEVO/400-521--------------------------------------------------------------------------------
GALT8_DROME/446-570--------------------------------------------------------------------------------
Q9K438_STRCO/427-551--------------------------------------------------------------------------------
Q7SIF1_TRIKI/2-122--------------------------------------------------------------------------------
GALT4_MOUSE/444-574--------------------------------------------------------------------------------
GALT4_DROME/511-641--------------------------------------------------------------------------------
GALT6_CAEEL/475-606--------------------------------------------------------------------------------
GLT11_CAEEL/482-602--------------------------------------------------------------------------------
Q8GB62_9GAMM/313-450--------------------------------------------------------------------------------
Q6BE03_BACTU/674-805--------------------------------------------------------------------------------
O68641_CELCE/306-433--------------------------------------------------------------------------------
Q8RTY5_9GAMM/724-853--------------------------------------------------------------------------------
Q9RDQ1_STRCO/383-509--------------------------------------------------------------------------------
Q9SLV9_CUCSA/165-289--------------------------------------------------------------------------------
GLT11_DROME/425-535--------------------------------------------------------------------------------
Q9L0N4_STRCO/326-472--------------------------------------------------------------------------------
GALT7_MOUSE/533-649--------------------------------------------------------------------------------
GALT2_DROME/507-627--------------------------------------------------------------------------------
GLT10_HUMAN/459-587--------------------------------------------------------------------------------
Q9K473_STRCO/837-959--------------------------------------------------------------------------------
GLT12_DROME/433-546--------------------------------------------------------------------------------
GALT1_DROME/473-597--------------------------------------------------------------------------------
AHV_ACTSK/47-157--------------------------------------------------------------------------------
Q8LKQ3_VISAL/8-135--------------------------------------------------------------------------------
Q82HL7_STRAW/418-544--------------------------------------------------------------------------------
GALT9_CAEEL/450-571--------------------------------------------------------------------------------
O62004_BRAFL/490-604--------------------------------------------------------------------------------
Q7NYA5_CHRVO/248-356--------------------------------------------------------------------------------
O96048_LUMTE/2-124--------------------------------------------------------------------------------
Q86S91_9CILI/376-511--------------------------------------------------------------------------------
Q97TI2_CLOAB/443-579--------------------------------------------------------------------------------
O04071_SAMNI/311-434--------------------------------------------------------------------------------
Q9ZBF7_STRCO/336-461--------------------------------------------------------------------------------
Q868M7_CUCEC/115-242--------------------------------------------------------------------------------
GALT6_MOUSE/497-619--------------------------------------------------------------------------------
Q9EWL5_STRCO/41-182--------------------------------------------------------------------------------
Q82P89_STRAW/370-505--------------------------------------------------------------------------------
Q7Y0V1_9FABA/137-258--------------------------------------------------------------------------------
GLT11_HUMAN/479-604--------------------------------------------------------------------------------
GALT2_HUMAN/446-563--------------------------------------------------------------------------------
GLT14_MOUSE/420-545--------------------------------------------------------------------------------

PF03498

Q46102_CAMJU/29-187--------------------------------------------------------------------------------
Q6UPC3_ECOLX/79-232--------------------------------------------------------------------------------
Q7DK11_AGGAC/39-178--------------------------------------------------------------------------------
Q9RFY4_HELHT/29-183--------------------------------------------------------------------------------
O32587_ECOLX/37-179--------------------------------------------------------------------------------
CDTA_HELHP/86-226--------------------------------------------------------------------------------
CDTA_HAEDU/77-221--------------------------------------------------------------------------------
Q6EZE1_ECOLX/49-197--------------------------------------------------------------------------------
CDTA_CAMJJ/115-260--------------------------------------------------------------------------------
Q47090_ECOLX/44-187--------------------------------------------------------------------------------

PF05588

O06016_CLOBO/1-147--------------------------------------------------------------------------------
Q9LBT0_CLOBO/1-146--------------------------------------------------------------------------------
Q45841_CLOBO/1-146--------------------------------------------------------------------------------

PF07468

Q38719_AMAHP/2-154--------------------------------------------------------------------------------
Q38719_AMAHP/159-299--------------------------------------------------------------------------------

PF08709

ITPR1_MOUSE/4-229-
A7SEK1_NEMVE/3-227-
A8HAL5_DANRE/4-229-
O13054_MAKNI/9-216-
O77089_PANAR/5-231-
P91905_CAEEL/13-215-
ITPR3_HUMAN/3-230-
RY44_DROME/11-206-
Q27J07_APLCA/1-225-
Q4DBL7_TRYCC/3-204-
Q4QEZ2_LEIMA/11-201-
Q4RLR0_TETNG/15-213-
Q4RY06_TETNG/4-165-
Q57XB2_TRYB2/3-212-
Q5TQX0_ANOGA/7-234-
Q66S77_OIKDI/1-221-
Q8TA74_HEMPU/8-204-
ITPR_ASTPE/4-229-
Q9Y0A1_CAEEL/78-317-

PF02815

RYR2_RABIT/226-406-
Q6J9T9_ASPFM/358-545-
RYR3_HUMAN/216-398-
Q759J8_ASHGO/342-519-
ITPR_ASTPE/231-419-
Q6FL03_CANGA/354-530-
Q9GS15_CAEBR/327-562-
PMT1_SCHPO/329-505-
Q91313_LITCT/214-394-
Q7SH94_NEUCR/369-558-
O13054_MAKNI/219-399-
ITPR_DROME/239-453-
Q6W3E4_RAT/232-432-
ITPR1_HUMAN/232-433-
Q6BFC5_PARTE/240-444-
Q8TA74_HEMPU/220-400-
Q6FK90_CANGA/355-531-
Q8MXI9_CAEEL/274-503-
Q96WN5_EMEND/353-528-
P91905_CAEEL/220-400-
O77089_PANAR/234-422-
Q6CPY0_KLULA/347-524-
Q6CAY4_YARLI/355-531-
Q6C5U6_YARLI/339-516-
RY44_DROME/211-392-
RYR1_PIG/212-391-
PMT5_YEAST/339-517-
PMT1_CANAL/359-534-
PMT1_YEAST/343-520-
ITPR3_RAT/233-432-

PF06268

FASC_STRPU/393-496-
Q6AXQ1_RAT/24-138-
SING_DROME/33-147-
FSCN2_HUMAN/389-492-
FSCN3_HUMAN/271-381-
FSCN1_HUMAN/268-378-
Q6PBS5_DANRE/19-131-
FASC_XENLA/382-483-
FASC_STRPU/138-254-
FSCN2_HUMAN/20-133-
Q6AZJ6_XENLA/277-387-
Q6EEB3_PRODO/230-340-
FSCN2_HUMAN/141-254-
FSCN1_HUMAN/391-493-
FSCN2_HUMAN/266-376-
Q6EE45_SCYCA/96-208-
FSCN1_HUMAN/20-134-
Q6AZJ6_XENLA/152-265-
FASC_STRPU/16-130-
Q6AZJ6_XENLA/32-144-
FSCN1_HUMAN/142-256-
SING_DROME/155-270-
Q6PBS5_DANRE/139-252-

PF06229

Q7QC94_ANOGA/71-260Y
A7RWZ5_NEMVE/69-257F
Q15ER4_SCHMA/95-286Y
A1D4G2_NEOFI/89-280F
Q96MD3_HUMAN/4-156Y
Q2UKA8_ASPOR/84-274F
FRG1_DROME/72-260Y
Q6DDA8_XENTR/66-254Y
FRG1_CAEEL/78-273Y
Q0UA03_PHANO/83-265Y
A2Q890_ASPNC/96-312F
Q566W5_DANRE/65-253Y
A6SI98_BOTFB/86-272Y

PF04601

Q9LJJ2_ARATH/1-141W
Q9LQ43_ARATH/1-142W
Q9CAS3_ARATH/251-396W
O04559_ARATH/227-368W
O04559_ARATH/1-144W
Q9CAS2_ARATH/1-139W
Q9CAS3_ARATH/1-144W

PF00167

Q28XC7_DROPS/16-141-
Q4S3V1_TETNG/61-182-
P91672_DROME/249-377-
Q8R5L5_RAT/84-205-
B1AK17_HUMAN/79-205-
FGF1_CHICK/25-148-
Q8I6J6_CIOIN/91-218-
Q9YH31_NOTVI/72-193-
FGF16_MOUSE/61-187-
Q5TLD5_DANRE/43-168-
A1YJ27_NPVSF/70-196-
Q90XQ4_AMBME/55-181-
Q86GG2_CIOSA/55-180-
Q8I6J7_CIOIN/133-264-
FG17_DANRE/53-178-
Q9E225_9ABAC/33-160-
Q8I6J5_CIOIN/56-181-
Q4SAA6_TETNG/81-202-
Q2NP32_NPVHC/29-154-
Q4RWE4_TETNG/71-205-
FGF1_NOTVI/2-125-
Q544I6_MOUSE/65-189-
Q8VI79_RAT/32-156-
A3EXK2_NEMVE/57-180-
Q4RSP6_TETNG/17-145-
FGFH_NPVOP/29-156-
Q5M7N7_XENTR/65-189-
FGF1_XENLA/25-148-
O92401_NPVBM/28-154-
A6Y7S4_DIDAL/29-153-
Q66IF7_XENTR/61-197-
Q4T869_TETNG/30-155-
Q91BB2_NPVST/26-158-
Q9N1B9_SHEEP/84-207-
A7RZP2_NEMVE/41-163-
LE756_CAEEL/72-207-
Q8R5L6_RAT/78-192-
Q8T8A3_CIOSA/159-283-
A7YT71_DANRE/25-149-
Q4SCS5_TETNG/71-197-
A7SH09_NEMVE/102-230-
FGF1_DANRE/17-138-
Q287N3_NPVAS/32-156-
Q80LI4_NPVAH/49-164-
Q5TKR7_DANRE/53-179-
Q8QLI3_9ABAC/34-158-
Q2LGG1_DANRE/81-202-
FGF18_MOUSE/53-178-
Q9J897_9ABAC/33-159-
Q0PV85_HALRO/186-312-
Q1LXT4_DANRE/17-141-
Q1HGX9_NPVAP/32-158-
Q4SFA3_TETNG/9-140-
Q9DFC9_DANRE/67-188-
A5PM81_DANRE/55-181-
A7SRV3_NEMVE/407-534-
Q8NF90_HUMAN/87-216-
FGF11_HUMAN/71-197-
Q0KJ02_ORYLA/70-196-
FGF4B_XENLA/68-189-
A7RFG7_NEMVE/73-195-
Q4VBV7_DANRE/72-196-
FGF3_DANRE/62-204-
Q4SJV9_TETNG/17-140-
Q6VTW1_NPVCD/28-157-
Q8QG59_AMBME/67-191-
Q3YAG3_STRPU/203-330-
FGF17_RAT/53-178-
A7SHR3_NEMVE/45-169-
Q5TLE2_DANRE/41-170-
Q6E7C8_OIKDI/1583-1704-
Q9PVY1_XENLA/62-188-
Q8JMA6_9ABAC/35-159-
Q1XG75_DANRE/59-183-
Q0IIQ7_DANRE/50-175-
A7T359_NEMVE/53-177-
Q5GAD8_9VIRU/23-148-

PF00340

IL1B_BOVIN/144-261-
IL1RA_MOUSE/61-174-
IL1RA_HUMAN/60-173-
IL1B_FELCA/146-263-
Q9GL09_SHEEP/72-185-
IL1A_MOUSE/158-269-
Q96KJ8_HUMAN/72-185-
IL1B_CERAT/147-264-
Q9I8D2_CHICK/66-187-
IL1B_PIG/145-262-
IL1B_MOUSE/148-264-
IL1A_RABIT/156-266-
IL1A_BOVIN/156-265-
Q91Z66_SIGHI/73-186-
IL1A_CERAT/155-266-
IL1RA_RABIT/60-173-

PF05270

OTOG_MOUSE/1241-1384-
ABFB_ASPOR/358-502-
Q82P18_STRAW/329-465-
Q829S7_STRAW/176-312-
Q55841_SYNY3/35-174-
Q9HEY2_COCCA/355-499-
Q86ZN9_FUSOX/351-495-
Q82P90_STRAW/346-481-
ABFB_EMENI/357-506-
ABF1_HYPJE/352-496-
ABFB_ASPKW/350-494-

PF00197

IT2_PSOTE/2-176-
IAAS_ORYSJ/26-193-
MIRA_RICDU/35-216-
ALB1_PSOTE/4-171-
ASP_THECC/30-208-
IAAS_HORVU/27-199-
API8_SOLTU/39-219-
ICW3_PSOTE/27-198-
IDE3_ERYCA/1-168-
IECI_ERYVA/2-173-
IT1A_PSOTE/2-168-
ITRA_SOYBN/26-199-
ITRY_ACACO/2-171-
KTI1_SOYBN/27-197-
CPI1_SOLTU/47-221-
SPOR1_IPOBA/42-216-
GWIN3_POPSP/32-195-

PF07951

BXB_CLOBO/1075-1291-
BXE_CLOBU/1063-1250-
TETX_CLOTE/1105-1314-
BXA1_CLOBO/1088-1293-
BXG_CLOBO/1083-1297-
BXC1_CLOBO/1089-1291-
Q45851_9CLOT/1072-1268-
Q45967_CLOBO/1085-1285-
BXF_CLOBO/1083-1274-
BXD_CLOBO/1076-1276-

PF14200

C6I1A8_9BACE/97-198-
A8NAT6_COPC7/44-145-
A8P1Y0_COPC7/90-188-
A8PCJ2_COPC7/37-137-
A1Z5I4_BEABA/43-129-
A6EHX4_9SPHI/63-161-
A6ERL3_9BACT/65-184-
A6G9W3_9DELT/412-502-
A6G9W3_9DELT/550-640-
A7EWX9_SCLS1/45-151-
A7WK54_LYSSH/385-485-
A8NDJ7_COPC7/40-145-
A8NDJ7_COPC7/189-287-
A9E912_9FLAO/86-187-
B0DSD3_LACBS/40-138-
B0MJQ2_9FIRM/249-352-
B1VUB2_STRGG/50-155-
B2WIQ5_PYRTR/45-143-
B2ZRS9_CLINE/46-144-
B3C971_9BACE/378-483-
B3PKR2_CELJU/520-621-
B4V2C9_9ACTO/39-139-
B4V8E2_9ACTO/575-676-
B5GTM6_STRCL/44-154-
B6SS31_MAIZE/56-169-
B8P008_POSPM/56-152-
B8P2U3_POSPM/41-134-
B8PDH6_POSPM/53-148-
C0PSY5_PICSI/62-180-
C3I9T1_BACTU/507-614-
C4LYE8_ENTHI/157-265-
C4M3J3_ENTHI/137-243-
D9STT7_CLOC7/601-707-
C6D9K8_PECCP/404-505-
C6L2F6_APOCT/307-416-
C6L2F6_APOCT/611-715-
C7PHL4_CHIPD/338-435-
C9YYM1_STRSW/484-581-
D1BKB8_SANKS/626-731-
D1Q0S6_9BACT/375-479-
D2QTB1_SPILD/373-478-
D2S061_HALTV/623-726-
D2VXQ3_NAEGR/45-151-
D3Q6V6_STANL/130-238-
D4J5M3_9FIRM/492-590-
D4J5M3_9FIRM/739-837-
Q8A5P7_BACTN/65-167-
Q8X123_9AGAR/44-154-
Q9L153_STRCO/584-686-

PF00652

GALT3_MOUSE/505-627-
CRBG3_HUMAN/888-1017-
GLT10_CAEEL/536-662-
CUPF_DICDI/32-142-
Q7QIK5_ANOGA/491-617-
Q7PZM5_ANOGA/438-564-
Q7Q0E9_ANOGA/461-587-
Q7QDR0_ANOGA/437-565-
ML1_VISAL/440-560-
O96048_LUMTE/132-255-
GALT7_CAEEL/478-592-
GLTL2_HUMAN/505-628-
GLT13_DROME/435-548-
Q7NQK0_CHRVO/5-133-
GALT4_CAEEL/461-580-
Q8W2E8_IRIHO/447-569-
Q9SLV9_CUCSA/35-159-
AGALA_ASPNG/424-536-
GALT1_MOUSE/430-548-
GALT3_DROME/512-658-
Q7Y0V1_9FABA/7-131-
GLT12_MOUSE/440-569-
Q9ADL1_SORCE/171-307-
Q8C2S1_MOUSE/660-788-
Q9X583_9ACTO/367-502-
GALT9_MACFA/467-595-
Q8KKH3_BACCI/270-405-
GALT5_HUMAN/810-932-
Q7SBD7_NEUCR/100-230-
O04071_SAMNI/439-558-
Q9HFA9_9TREE/43-172-
Q9EWL6_STRCO/70-209-
Q824Z7_STRAW/111-218-
Q9HFB1_9ASCO/416-528-
Y1454_MYCBO/33-153-
Q6TBQ9_CRYPV/535-659-
Q825I1_STRAW/713-838-
Q7TLZ3_9ZZZZ/377-504-
Q7X2C9_STRTE/266-386-
GALT9_DROME/521-640-
GLT10_DROME/483-615-
Q825L5_STRAW/296-417-
Q6BE06_BACTU/699-826-
ENVE_SALTY/53-170-
Q6YBY0_TOXGO/500-612-
O86669_STRCO/329-444-
FLVS_FLAME/296-437-
Q8RTY5_9GAMM/861-988-
Q7VN40_HAEDU/61-177-
GLTL3_HUMAN/465-591-
Q82LA2_STRAW/332-460-
GALT3_CAEEL/484-604-
GLTL1_HUMAN/431-552-
Q825H7_STRAW/402-529-
GALT7_DROME/467-582-
Q8VUT1_9PSED/305-438-
Q70US9_ADEVO/400-521-
GALT8_DROME/446-570-
Q9K438_STRCO/427-551-
Q7SIF1_TRIKI/2-122-
GALT4_MOUSE/444-574-
GALT4_DROME/511-641-
GALT6_CAEEL/475-606-
GLT11_CAEEL/482-602-
Q8GB62_9GAMM/313-450-
Q6BE03_BACTU/674-805-
O68641_CELCE/306-433-
Q8RTY5_9GAMM/724-853-
Q9RDQ1_STRCO/383-509-
Q9SLV9_CUCSA/165-289-
GLT11_DROME/425-535-
Q9L0N4_STRCO/326-472-
GALT7_MOUSE/533-649-
GALT2_DROME/507-627-
GLT10_HUMAN/459-587-
Q9K473_STRCO/837-959-
GLT12_DROME/433-546-
GALT1_DROME/473-597-
AHV_ACTSK/47-157-
Q8LKQ3_VISAL/8-135-
Q82HL7_STRAW/418-544-
GALT9_CAEEL/450-571-
O62004_BRAFL/490-604-
Q7NYA5_CHRVO/248-356-
O96048_LUMTE/2-124-
Q86S91_9CILI/376-511-
Q97TI2_CLOAB/443-579-
O04071_SAMNI/311-434-
Q9ZBF7_STRCO/336-461-
Q868M7_CUCEC/115-242-
GALT6_MOUSE/497-619-
Q9EWL5_STRCO/41-182-
Q82P89_STRAW/370-505-