Sequence alignment for CL0079

PF00243

NGF_BOVIN/125-239--------------------------------------------------------------------HPVFHRGEFSVC
NTF4_HUMAN/86-209--------------------------------------------------------------------APASRRGELAVC
BDNF_CHICK/129-246--------------------------------------------------------------------SDPARRGELSVC
NTF4_XENLA/120-235--------------------------------------------------------------------VSLSRRGELSVC
NTF3_CHICK/141-256--------------------------------------------------------------------EHKSHRGEYSVC
NGF_XIPMA/82-193--------------------------------------------------------------------Q...HRGVYSVC
NGFV_BUNMU/128-242--------------------------------------------------------------------HPVHNQGEHSVC

PF02035

COAG_TACTR/23-195------------------------------------------------------------------------TNAPICLC
COAG_LIMPO/23-195------------------------------------------------------------------------PNVPTCLC

PF05463

Q1LXE0_DANRE/6-198CEYQLLF.LLCFLMKSCH.........AFKNDATEEFNRHALASAQ.ETPNNASLNRARNGGRRPESR..HQTEQHQVGC
SOST_MOUSE/1-208MQPSLAPCLICLLVHAAFCAVEGQGWQAFRNDATEVIPGLGEYPEP.PPENNQTMNRAENGGRPPHHP.YDAKGVSEYSC
SOSD1_MOUSE/6-206IHLSLIP.LLCILMRNCL.........AFKNDATEILYSHVVKPVPAHPSSNSTLNQARNGGRHFSSTGLDRNSRVQVGC
Q688C5_XENTR/6-213LQCCMLY.FACIFIESCM.........SFKNDATEILYSHVDKNIQ.ESANSSALNQARNGGRHTANSAMDRTNPHQVGC

PF03045

Q76C27_PAROL/127-248------------------------------------------------QMWQRAMDKGGK.....LSLPVNLTQDTKQTC
Q2A123_9CNID/35-145------------------------------------------------EEPNTGILGKNE........WLTDKNSKNCMV
NBL1_HUMAN/3-125------------------------------------------------RVLVGAVLPAMLLAAPPPINKLALFPDKSAWC
Q2A124_9CNID/46-158------------------------------------------------DQGKSSVKKIDPGYM.............KDEC
Q0Q621_NEMVE/30-125------------------------------------------------SGTNEEVF............IMDNSLLKRGWC
A8E7M9_DANRE/115-232------------------------------------------------EMWKKVVHKSERKKE.AVALRINPKDMNKQSC
CER1_MOUSE/132-247------------------------------------------------RFWHRFMFRKGPAFQ.GVILPIKSHEVHWETC
GREM2_HUMAN/46-163------------------------------------------------QHQIKEVLASSQEAL....VVTERKYLKSDWC
Q7YX42_CAEEL/217-337------------------------------------------------DEHGDTVFEGRKHAL..LQLADPDALIMNQRC
CER1_CHICK/138-253------------------------------------------------KFWDHFMLRKNSASE.EVVLPIKTNEMHQETC
CER1_HUMAN/132-247------------------------------------------------KFWHHFMFRKTPASQ.GVILPIKSHEVHWETC
NBL1_DANRE/7-129------------------------------------------------AVLVCVLLELSRAAPHAHINRLALFPDKSAWC
Q4H3R0_CIOIN/111-239------------------------------------------------HKKNHNILKTSAKAK....TITERKYLKRDWC
Q6T937_DANRE/60-177------------------------------------------------PSAGDEVLDSSQEAL....HVTERRYLKLDWC
CER1_XENLA/139-253------------------------------------------------MFWNNFLVKMNGAPQ.NTSHGSKAQEIMKEAC
DAND5_XENTR/87-203------------------------------------------------LVWESAIRREKMRSHPDQVLPIGQDALKRSRC
Q4RXN8_TETNG/99-212------------------------------------------------IQICCTLFALCWAAPPAPINRLALFPDKSAWC
GREM1_MOUSE/67-184------------------------------------------------AMPGEEVLESSQEAL....HVTERKYLKRDWC
Q76C28_TAKRU/125-244------------------------------------------------QMWQKAVSKGDLMP...VSLPASL.KEGKQSC
Q566Z5_DANRE/44-161------------------------------------------------RTRKQEVLASSQEAL....VVTEKKYLKSDWC

PF00007

TSHB_HUMAN/19-125----------------------------------------------------------------------------MSFC
FSHB_RAT/19-123----------------------------------------------------------------------------CHSC
CYR61_MOUSE/281-374----------------------------------------------------------------------------GKKC
GTHB2_FUNHE/24-128----------------------------------------------------------------------------LPRC
GTHB1_THUOB/5-99----------------------------------------------------------------------------SYGC
GTHB1_FUNHE/17-114----------------------------------------------------------------------------CFGC
LSHB_HUMAN/26-130----------------------------------------------------------------------------RPWC
CTGF_HUMAN/253-346----------------------------------------------------------------------------GKKC
FSHB_BOVIN/18-122----------------------------------------------------------------------------CRSC
TSHB_BOVIN/19-125----------------------------------------------------------------------------MSFC
MUC2_HUMAN/5072-5176----------------------------------------------------------------------------RVPC
TSHB_ANGAN/19-125----------------------------------------------------------------------------LSIC
CYR61_CHICK/278-371----------------------------------------------------------------------------GKKC
GTHB2_CTEID/32-136----------------------------------------------------------------------------LPPC
GTHB2_ANGAN/27-131----------------------------------------------------------------------------LLPC
GTHB2_ONCKE/26-130----------------------------------------------------------------------------MQPC
CGHB_HUMAN/26-130----------------------------------------------------------------------------RPRC
NOV_CHICK/255-348----------------------------------------------------------------------------GKKC
LSHB_HORSE/26-130----------------------------------------------------------------------------RPLC
TSHB_ONCMY/19-125----------------------------------------------------------------------------VPMC
LSHB_LITCT/1-105----------------------------------------------------------------------------RHVC
CGHB_PAPAN/26-130----------------------------------------------------------------------------RPLC
GTHB2_THUOB/3-107----------------------------------------------------------------------------LPPC
GTHB1_ONCKE/29-130----------------------------------------------------------------------------RYGC

PF05806

NOGG_TAKRU/6-221LRVATYLLLLSVGLLLHGGACQPYYLLRPIPSDSLPIVELKEDPGPVFDPKERDLNETELKSVLGD..FDSRFLSVLPPA
NOGG2_DANRE/3-212SITRALPLLLLLLLCAHGTASQHHLRLRPLPSEGLPVPDLIENPDPEHDPREQDLSEKTLLKKLGS.NFDANFMSIHLPA
NOGG3_DANRE/6-221YFLAT.VLIFSLGFRIEEGMCQHYYLLRPIPSDSLPIVELKEDPDPVLDPKERDLNETELRAILGS.HFEQNFMSINPP.
NOGG1_DANRE/6-214FLLSAYLLLLS......FAQCQHYYLLRPIPSDTLPLLELKEDPDPIYDPREKDLNETELRSALGD..FDSRFLSVGPP.
Q8MY69_DUGJA/1-269MVNSLIFVLAILNIFQESFTVNAYYSGR...INMHSTNTDRSTPDP.HVPGENALNVKLLQKILGKRNYDFSWMSINTPS
NOGG_XENLA/6-222CLVTIYALMVFLGLRIDQGGCQHYLHIRPAPSENLPLVDLIEHPDPIYDPKEKDLNETLLRTLMVG.HFDPNFMATILP.

PF00019

BMP3_HUMAN/367-472----------------------------------------------------------------------------PRNC
TGFB1_BOVIN/290-390----------------------------------------------------------------------------EKNC
BMP8B_HUMAN/298-402----------------------------------------------------------------------------RQVC
60A_DROME/351-455----------------------------------------------------------------------------TRSC
BMP2_HUMAN/293-396----------------------------------------------------------------------------KSSC
BMP5_HUMAN/350-454----------------------------------------------------------------------------KQAC
DECA_DROME/484-588----------------------------------------------------------------------------DDTC
DSL1_CHICK/322-427----------------------------------------------------------------------------ANHC
DVR1_DANRE/251-355----------------------------------------------------------------------------SNVC
DVR1_XENLA/256-360----------------------------------------------------------------------------SNIC
GDF1_HUMAN/264-372----------------------------------------------------------------------------GGAC
INHA_BOVIN/253-360----------------------------------------------------------------------------HADC
INHBA_BOVIN/317-425----------------------------------------------------------------------------VNIC
INHBB_HUMAN/300-407----------------------------------------------------------------------------TNLC
MIS_BOVIN/474-575----------------------------------------------------------------------------DGPC
TGFB2_CHICK/312-412----------------------------------------------------------------------------QDNC
GDNF_RAT/115-211----------------------------------------------------------------------------NRGC
PSPN_RAT/63-155----------------------------------------------------------------------------PGLC
NRTN_HUMAN/100-197----------------------------------------------------------------------------ARPC
PSPN_HUMAN/63-155----------------------------------------------------------------------------SGPC

PF00236

GLHA_HORSE/25-120-------------------------------------------------------------------------------F
GLHA1_ONCKE/14-108-------------------------------------------------------------------------------Y
GLHA_ACALA/24-117-------------------------------------------------------------------------------Y
GLHA1_CYPCA/24-118-------------------------------------------------------------------------------Y
GLHA_RAT/25-120-------------------------------------------------------------------------------L
GLHA_MACMU/25-120-------------------------------------------------------------------------------F
GLHA_HUMAN/25-116-------------------------------------------------------------------------------A
GLHA_ANGAN/25-117-------------------------------------------------------------------------------Y
GLHA_LITCT/1-97-------------------------------------------------------------------------------F
GLHA2_ONCTS/23-114-------------------------------------------------------------------------------Y

PF00341

B0X067_CULQU/55-138-------------------------------------------------------------------------------C
Q16I04_AEDAE/108-191-------------------------------------------------------------------------------C
B3MZW0_DROAN/145-226-------------------------------------------------------------------------------C
Q29GD9_DROPS/139-221-------------------------------------------------------------------------------C
B4I6X7_DROSE/58-139-------------------------------------------------------------------------------C
A5JL80_ORYLA/9-87-------------------------------------------------------------------------------C
E9QGX7_DANRE/83-161-------------------------------------------------------------------------------C
D3XLB1_PSEGE/50-128-------------------------------------------------------------------------------C
Q4SV40_TETNG/13-91-------------------------------------------------------------------------------C
Q38KY2_ANGJA/48-126-------------------------------------------------------------------------------C
Q6H8S8_ONCMY/50-128-------------------------------------------------------------------------------C
D2W908_9SAUR/52-130-------------------------------------------------------------------------------C
VEGFA_BITGA/52-130-------------------------------------------------------------------------------C
D2W911_9SAUR/47-125-------------------------------------------------------------------------------C
VEGFA_CHICK/52-130-------------------------------------------------------------------------------C
Q9GK00_CALJA/12-90-------------------------------------------------------------------------------C
Q07G81_XENTR/52-130-------------------------------------------------------------------------------C
C3KGR8_ANOFI/46-124-------------------------------------------------------------------------------C
Q4SCW7_TETNG/46-125-------------------------------------------------------------------------------C
F1Q7V5_DANRE/13-92-------------------------------------------------------------------------------C
E2QZR3_CANFA/52-130-------------------------------------------------------------------------------C
PLGF_BOVIN/52-130-------------------------------------------------------------------------------C
PLGF_RAT/48-127-------------------------------------------------------------------------------C
E7EZR4_DANRE/55-132-------------------------------------------------------------------------------C
E9QDL3_DANRE/5-87-------------------------------------------------------------------------------C
TXVE_SISCA/38-117-------------------------------------------------------------------------------C
TXVE_BOTER/38-117-------------------------------------------------------------------------------C
TXVE_BITAR/38-117-------------------------------------------------------------------------------C
TXVE_DABRR/38-117-------------------------------------------------------------------------------C
F1RQ05_PIG/47-124-------------------------------------------------------------------------------C
B6VAE7_9POXV/47-128-------------------------------------------------------------------------------C
D0VXD7_ORFV/37-118-------------------------------------------------------------------------------C
Q772M8_ORFV/35-113-------------------------------------------------------------------------------C
Q6R5A5_9POXV/50-140-------------------------------------------------------------------------------C
Q6TVI2_9POXV/49-135-------------------------------------------------------------------------------C
E5KXN4_9POXV/47-131-------------------------------------------------------------------------------C
VEGFH_ORFN7/46-132-------------------------------------------------------------------------------C
Q6TVI8_ORFSA/46-132-------------------------------------------------------------------------------C
Q8B571_9POXV/54-136-------------------------------------------------------------------------------C
A5JTQ1_CHICK/111-191-------------------------------------------------------------------------------C
F1PEV4_CANFA/71-151-------------------------------------------------------------------------------C
B5X5X7_SALSA/128-207-------------------------------------------------------------------------------C
Q208T6_DANRE/107-188-------------------------------------------------------------------------------C
C0HAQ2_SALSA/127-207-------------------------------------------------------------------------------C
O57352_COTCO/130-210-------------------------------------------------------------------------------C
Q4T6L6_TETNG/117-197-------------------------------------------------------------------------------C
C3XWJ2_BRAFL/27-104-------------------------------------------------------------------------------C
PDGFD_HUMAN/272-362-------------------------------------------------------------------------------C
Q674V2_PODCA/179-255-------------------------------------------------------------------------------C
B1H1E3_XENTR/92-175-------------------------------------------------------------------------------C
Q549C6_MOUSE/97-180-------------------------------------------------------------------------------C
Q90W23_CHICK/104-187-------------------------------------------------------------------------------C
Q7TPH7_MOUSE/96-179-------------------------------------------------------------------------------C
Q9DE50_DANRE/95-179-------------------------------------------------------------------------------C
E7FBB3_DANRE/86-169-------------------------------------------------------------------------------C
F1QS30_DANRE/95-178-------------------------------------------------------------------------------C
E9G4R4_DAPPU/48-125-------------------------------------------------------------------------------C

PF00243

NGF_BOVIN/125-239DSI-----------------------------------SVW----VG..DKTTATD-----------IKGKEVMVLG---
NTF4_HUMAN/86-209DAV-----------------------------------SGW----VT..DRRTAVD-----------LRGREVEVLG---
BDNF_CHICK/129-246DST-----------------------------------SEW----VTAAEKKTAVD-----------MSGATVTVLE---
NTF4_XENLA/120-235DSV-----------------------------------NVW----VT..DKRTAVD-----------DRGKIVTVMS---
NTF3_CHICK/141-256DSE-----------------------------------SLW----VT..DKSSAID-----------IRGHQVTVLG---
NGF_XIPMA/82-193ESV-----------------------------------SVW----VGN..KTKATD-----------ISGKEVTVLP---
NGFV_BUNMU/128-242DSI-----------------------------------SVW----VTN..KTKATD-----------IKGNTVTVMV---

PF02035

COAG_TACTR/23-195DEP-----------------------------------GVLGRTQIVTTEIKDKIEKAVEAVAQESGVSGRGFSIFSHHP
COAG_LIMPO/23-195EEP-----------------------------------TLLGRKVIVSQETKDKIEEAVQAITDKDEISGRGFSIFGGHP

PF05463

Q1LXE0_DANRE/6-198REL-----------------------------------R-------STKYI-S-DG-----------Q------CTS---
SOST_MOUSE/1-208REL-----------------------------------H-------YTRFL-T-DG-----------P------CRS---
SOSD1_MOUSE/6-206REL-----------------------------------R-------STKYI-S-DG-----------Q------CTS---
Q688C5_XENTR/6-213REL-----------------------------------R-------STKYI-S-DG-----------Q------CTS---

PF03045

Q76C27_PAROL/127-248TAV-----------------------------------P-------FTQRV.T-AD-----------G------CET---
Q2A123_9CNID/35-145HGT-----------------------------------K-------YQQVI.S-ER-----------D------CKA---
NBL1_HUMAN/3-125EAK-----------------------------------N-------ITQIV.G-HS-----------G------CEA---
Q2A124_9CNID/46-158GVF-----------------------------------P-------FNQTV.T-KN-----------G------CEG---
Q0Q621_NEMVE/30-125KTK-----------------------------------P-------VKQII.R-IE-----------G------CEP---
A8E7M9_DANRE/115-232AAV-----------------------------------P-------FTQRI.T-EE-----------G------CET---
CER1_MOUSE/132-247RTV-----------------------------------P-------FNQTI.A-HE-----------D------CQK---
GREM2_HUMAN/46-163KTQ-----------------------------------P-------LRQTV.S-EE-----------G------CRS---
Q7YX42_CAEEL/217-337DGQ-----------------------------------K-------FKQRI.R-VD-----------G------CLT---
CER1_CHICK/138-253RTL-----------------------------------P-------FSQSV.A-HE-----------S------CEK---
CER1_HUMAN/132-247RTV-----------------------------------P-------FSQTI.T-HE-----------G------CEK---
NBL1_DANRE/7-129EAK-----------------------------------N-------ITQIV.G-HT-----------G------CTP---
Q4H3R0_CIOIN/111-239KSQ-----------------------------------P-------VRQYIRT-AD-----------G------CKG---
Q6T937_DANRE/60-177KTQ-----------------------------------P-------LKLMI.Y-ED-----------G------CQP---
CER1_XENLA/139-253KTL-----------------------------------P-------FTQNI.V-HE-----------N------CDR---
DAND5_XENTR/87-203HAL-----------------------------------P-------FIQNV.F-RK-----------N------CFP---
Q4RXN8_TETNG/99-212EAK-----------------------------------N-------ITQIV.G-HT-----------G------CLP---
GREM1_MOUSE/67-184KTQ-----------------------------------P-------LKQTI.H-EE-----------G------CNS---
Q76C28_TAKRU/125-244SGV-----------------------------------P-------FTQRV.T-AA-----------G------CSA---
Q566Z5_DANRE/44-161KTQ-----------------------------------P-------LRQTV.S-QE-----------G------CRS---

PF00007

TSHB_HUMAN/19-125IPT-----------------------------------E..----.YTMHI-E-RR-----------E------CAY---
FSHB_RAT/19-123ELT-----------------------------------N..----.ITISV-E-KE-----------E------CRF---
CYR61_MOUSE/281-374SKT-----------------------------------KKS----PEPVRF-T-YA-----------G------CSS---
GTHB2_FUNHE/24-128QLL-----------------------------------N..----.QTISL-E-KR-----------G------CSG---
GTHB1_THUOB/5-99HPK-----------------------------------N..----.ISISV-E-S.-----------.------CGI---
GTHB1_FUNHE/17-114HLK-----------------------------------N..----.VSIPM-E-R.-----------.------CGQ---
LSHB_HUMAN/26-130HPI-----------------------------------N..----.AILAV-E-KE-----------G------CPV---
CTGF_HUMAN/253-346IRT-----------------------------------PKI----SKPIKF-E-LS-----------G------CTS---
FSHB_BOVIN/18-122ELT-----------------------------------N..----.ITITV-E-KE-----------E------CGF---
TSHB_BOVIN/19-125IPT-----------------------------------E..----.YMMHV-E-RK-----------E------CAY---
MUC2_HUMAN/5072-5176STV-----------------------------------P..----.VTTEV-S-YA-----------G------CT.---
TSHB_ANGAN/19-125SPV-----------------------------------D..----.YTLYV-E-KP-----------E------CDF---
CYR61_CHICK/278-371TKT-----------------------------------KKS----PSPVRF-T-YA-----------G------CSS---
GTHB2_CTEID/32-136EPV-----------------------------------N..----.ETVAV-E-KE-----------G------CPK---
GTHB2_ANGAN/27-131EPI-----------------------------------N..----.ETISV-E-KD-----------G------CPK---
GTHB2_ONCKE/26-130QPI-----------------------------------N..----.QTVSL-E-KE-----------G------CPT---
CGHB_HUMAN/26-130RPI-----------------------------------N..----.ATLAV-E-KE-----------G------CPV---
NOV_CHICK/255-348IQT-----------------------------------KKS----MKAVRF-E-YK-----------N------CTS---
LSHB_HORSE/26-130RPI-----------------------------------N..----.ATLAA-E-KE-----------A------CPI---
TSHB_ONCMY/19-125VPT-----------------------------------D..----.YTLYE-E-RR-----------E------CDF---
LSHB_LITCT/1-105HLA-----------------------------------N..----.ATISA-E-KD-----------H------CPV---
CGHB_PAPAN/26-130RPI-----------------------------------N..----.ATLAA-E-KE-----------A------CPV---
GTHB2_THUOB/3-107QLI-----------------------------------N..----.QTVSV-E-KE-----------G------CAS---
GTHB1_ONCKE/29-130RLN-----------------------------------N..----.MTIIV-E-RE-----------D------CHG---

PF05806

NOGG_TAKRU/6-221EDGHAGNDELDDFDA...QRWGGALPKEIRAVDF.DAPQ-------LGKKH-K-PS-----------K------KLK---
NOGG2_DANRE/3-212QLNASAPPEL..........PRLPMPAELKKLDLTET.P-------YGRRV-K-VG-----------K------KAR---
NOGG3_DANRE/6-221EDKHAGQDELNESEL.MKQRPNGIMPKEIKAMEF.DI.Q-------HGKKH-K-PS-----------K------KLR---
NOGG1_DANRE/6-214QDRYAGNEDLDEQELQ..LNLAGMMPKDIKNLDF.DA.P-------WGKKR-K-AS-----------K------KLK---
Q8MY69_DUGJA/1-269KIYEPANIDIPNNKLLDVL.......LSFKNLTLTD..E-------NGQLI-N-TS-----------K------NLE---
NOGG_XENLA/6-222EERL.GVEDLGELDLLLRQKPSGAMPAEIKGLEFYEG.L-------QSKKH-R-LS-----------K------KLR---

PF00019

BMP3_HUMAN/367-472ARR-----------------------------------Y-------LKVDF-A.DI-----------GWSEW--IIS---
TGFB1_BOVIN/290-390CVR-----------------------------------Q-------LYIDF-RKDL-----------GWK.W--IHE---
BMP8B_HUMAN/298-402RRH-----------------------------------E-------LYVSF-Q.DL-----------GWLDW--VIA---
60A_DROME/351-455QMQ-----------------------------------T-------LYIDF-K.DL-----------GWHDW--IIA---
BMP2_HUMAN/293-396KRH-----------------------------------P-------LYVDF-S.DV-----------GWNDW--IVA---
BMP5_HUMAN/350-454KKH-----------------------------------E-------LYVSF-R.DL-----------GWQDW--IIA---
DECA_DROME/484-588RRH-----------------------------------S-------LYVDF-S.DV-----------GWDDW--IVA---
DSL1_CHICK/322-427RRT-----------------------------------S-------LHVNF-K.EI-----------GWDSW--IIA---
DVR1_DANRE/251-355KPR-----------------------------------R-------LYIDF-K.DV-----------GWQDW--IIA---
DVR1_XENLA/256-360KKR-----------------------------------H-------LYVEF-K.DV-----------GWQNW--VIA---
GDF1_HUMAN/264-372RAR-----------------------------------R-------LYVSF-R.EV-----------GWHRW--VIA---
INHA_BOVIN/253-360HRA-----------------------------------A-------LNISF-Q.EL-----------GWDRW--IVH---
INHBA_BOVIN/317-425CKK-----------------------------------Q-------FFVSF-K.DI-----------GWNDW--IIA---
INHBB_HUMAN/300-407CRQ-----------------------------------Q-------FFIDF-R.LI-----------GWNDW--IIA---
MIS_BOVIN/474-575ALR-----------------------------------E-------LSVDL-R..A-----------ERS..--VLI---
TGFB2_CHICK/312-412CLR-----------------------------------P-------LYIDF-KRDL-----------GWK.W--IHE---
GDNF_RAT/115-211VLT-----------------------------------A-------IHLNV-T.DL-----------GLG..--YET---
PSPN_RAT/63-155RLW-----------------------------------S-------LTLPV-A.EL-----------GLG..--YAS---
NRTN_HUMAN/100-197GLR-----------------------------------E-------LEVRV-S.EL-----------GLG..--YAS---
PSPN_HUMAN/63-155QLW-----------------------------------S-------LTLSV-A.EL-----------GLG..--YAS---

PF00236

GLHA_HORSE/25-120PDG-----------------------------------E-------FTTQDCPECK-----------LRENK--YFF---
GLHA1_ONCKE/14-108QNS-----------------------------------D-------MTNVGCEECK-----------LKENK--VFS---
GLHA_ACALA/24-117PNT-----------------------------------D-------LSNMGCEACT-----------LRKNT--VFS---
GLHA1_CYPCA/24-118PRN-----------------------------------D-------MNNFGCEECK-----------LKENN--IFS---
GLHA_RAT/25-120PDG-----------------------------------D-------LIIQGCPECK-----------LKENK--YFS---
GLHA_MACMU/25-120PDG-----------------------------------E-------FTMQDCPECK-----------PRENK--FFS---
GLHA_HUMAN/25-116PD.-----------------------------------.-------..VQDCPECT-----------LQENP--FFS---
GLHA_ANGAN/25-117PNN-----------------------------------E-------MARGGCDECR-----------LQENK--IFS---
GLHA_LITCT/1-97PDD-----------------------------------N-------FLTPGCPECR-----------LKENL--RFS---
GLHA2_ONCTS/23-114PNS-----------------------------------D-------KTNMGCEECT-----------LKPNT--IFP---

PF00341

B0X067_CULQU/55-138STT-----------------------------------D-------TIVPLRPKDV-----------TDPTL..IYS---
Q16I04_AEDAE/108-191NTQ-----------------------------------A-------TIVSLRPENN-----------TDPRL..IYS---
B3MZW0_DROAN/145-226SPQ-----------------------------------P-------TIVELKPPGA-----------ESSNF..FYT---
Q29GD9_DROPS/139-221SPQ-----------------------------------P-------TIVELKPPSD-----------EAGNFNVYYT---
B4I6X7_DROSE/58-139SPQ-----------------------------------P-------TIVELKPPAE-----------DEANY..YYM---
A5JL80_ORYLA/9-87QPR-----------------------------------E-------LLVDILQEYP-----------EEVEH..IFI---
E9QGX7_DANRE/83-161RPR-----------------------------------E-------MLVEIQQEYP-----------DDTEH..IFI---
D3XLB1_PSEGE/50-128QPR-----------------------------------E-------VLVDIFSEYA-----------EDTEH..TYI---
Q4SV40_TETNG/13-91QPR-----------------------------------D-------VLVDVFQAYP-----------EDTEH..IYT---
Q38KY2_ANGJA/48-126RPR-----------------------------------E-------LLVDIYQEYP-----------EEIEH..TYI---
Q6H8S8_ONCMY/50-128RTR-----------------------------------E-------MLVDVFQEYP-----------DEIEH..TYI---
D2W908_9SAUR/52-130RSI-----------------------------------E-------TMVDIFQEYP-----------DEVEY..IFK---
VEGFA_BITGA/52-130RPV-----------------------------------E-------TMVDIFQEYP-----------DEVEY..IFK---
D2W911_9SAUR/47-125RPI-----------------------------------E-------TMVDISHEYP-----------EEVEY..IFK---
VEGFA_CHICK/52-130RTI-----------------------------------E-------TLVDIFQEYP-----------DEVEY..IFR---
Q9GK00_CALJA/12-90HPI-----------------------------------E-------TLVDIFQEYP-----------DEIEY..IFK---
Q07G81_XENTR/52-130QVR-----------------------------------E-------ILVDIFQEYP-----------DEVEY..IFK---
C3KGR8_ANOFI/46-124RPM-----------------------------------E-------QLVDVEQEYP-----------GEVEY..IYM---
Q4SCW7_TETNG/46-125QPM-----------------------------------E-------QLVDVEQEYP-----------GELEY..TYM---
F1Q7V5_DANRE/13-92RTI-----------------------------------E-------KLVEVVQEYP-----------GEVEH..IFS---
E2QZR3_CANFA/52-130RAL-----------------------------------E-------KLVDVLSEYP-----------DEVEH..MFN---
PLGF_BOVIN/52-130RPV-----------------------------------E-------RLVDIVSEYP-----------SEMEH..LFS---
PLGF_RAT/48-127RPM-----------------------------------E-------KLVYIADEHP-----------NEVSH..IFS---
E7EZR4_DANRE/55-132HPR-----------------------------------E-------TLVEVWQEFP-----------WETNH..LFL---
E9QDL3_DANRE/5-87KPR-----------------------------------E-------TLVKVEDEFS-----------EVMLG..HVV---
TXVE_SISCA/38-117QTR-----------------------------------E-------MLVSILDEHP-----------DEVAH..LFR---
TXVE_BOTER/38-117QPR-----------------------------------E-------TLVSILEEYP-----------GEIAH..IFR---
TXVE_BITAR/38-117QPR-----------------------------------E-------TLVSILEEYP-----------DKISK..IFR---
TXVE_DABRR/38-117QTR-----------------------------------E-------TLVSILQEHP-----------DEISD..IFR---
F1RQ05_PIG/47-124QPR-----------------------------------E-------VVVPLTMELM-----------GTVAK..QLV---
B6VAE7_9POXV/47-128KPR-----------------------------------E-------TVVRIGDEYP-----------SLISQ..RFS---
D0VXD7_ORFV/37-118KPR-----------------------------------P-------TVLSVNGEHP-----------ELTSQ..RFN---
Q772M8_ORFV/35-113KPR-----------------------------------P-------MVFRVHDEHP-----------ELTSQ..RFN---
Q6R5A5_9POXV/50-140RPM-----------------------------------P-------TTVRVSDEYP-----------NDTSE..RYN---
Q6TVI2_9POXV/49-135QPM-----------------------------------K-------TPVKVSDEYP-----------DNTND..RHS---
E5KXN4_9POXV/47-131MPR-----------------------------------D-------TVVYIGNEYP-----------GSVGE..RYN---
VEGFH_ORFN7/46-132KPR-----------------------------------D-------TVVYLGEEYP-----------ESTNL..QYN---
Q6TVI8_ORFSA/46-132RPR-----------------------------------D-------TVVYLGDEYP-----------ENTNL..QYN---
Q8B571_9POXV/54-136KPR-----------------------------------D-------TVVQLISEYP-----------GDVEQ..RYN---
A5JTQ1_CHICK/111-191VPR-----------------------------------E-------TCVEVAKELG-----------TTTNK..FFK---
F1PEV4_CANFA/71-151SPR-----------------------------------E-------TCVEVASELG-----------RSTDT..FFK---
B5X5X7_SALSA/128-207MPR-----------------------------------E-------TCVDVAKELG-----------TTTSM..FFK---
Q208T6_DANRE/107-188MPR-----------------------------------E-------TCVDVAKELG-----------TNTAV..FFK---
C0HAQ2_SALSA/127-207MPR-----------------------------------E-------VCLDVGKEFG-----------AATNT..FYK---
O57352_COTCO/130-210MPR-----------------------------------E-------VCVDVGKEFG-----------ATTNT..FFK---
Q4T6L6_TETNG/117-197TPR-----------------------------------E-------VCVDVGREFG-----------APTNI..FYK---
C3XWJ2_BRAFL/27-104KPR-----------------------------------E-------TAVDAATELQ-----------APTDV..TYR---
PDGFD_HUMAN/272-362TPR-----------------------------------N-------YSVNIREELK-----------LANVV..FF.---
Q674V2_PODCA/179-255QPR-----------------------------------E-------AVVEI....P-----------VSSEG..ALW---
B1H1E3_XENTR/92-175KPR-----------------------------------V-------EVFEISRKIV-----------DPTNA..NFL---
Q549C6_MOUSE/97-180KTR-----------------------------------T-------EVFQISRNLI-----------DRTNA..NFL---
Q90W23_CHICK/104-187KTR-----------------------------------T-------VVFEISRDMV-----------DSTNA..NFV---
Q7TPH7_MOUSE/96-179KTR-----------------------------------T-------VIYEIPRSQV-----------DPTSA..NFL---
Q9DE50_DANRE/95-179KTR-----------------------------------T-------VIYEIPRSQV-----------DPTAA..NFL---
E7FBB3_DANRE/86-169KVR-----------------------------------T-------EVIEVTRSML-----------DRSNA..DFL---
F1QS30_DANRE/95-178KVR-----------------------------------T-------EVMEVTRAMF-----------DRRNA..NFM---
E9G4R4_DAPPU/48-125KPR-----------------------------------K-------IPVEI....P-----------KEPNV..SWL---

PF00243

NGF_BOVIN/125-239--------EVNINNSV-.FKQYFF-------------ETKCRDP.......NPVDSG---------------------CR
NTF4_HUMAN/86-209--------EVPAAGGS-PLRQYFF-------------ETRCKADNAEEGGPGAGGGG---------------------CR
BDNF_CHICK/129-246--------KVPVPKGQ-.LKQYFY-------------ETKCNPK.......GYTKEG---------------------CR
NTF4_XENLA/120-235--------EIQTLTGP-.LKQYFF-------------ETKCNPS.......GSTTRG---------------------CR
NTF3_CHICK/141-256--------EIKTGNSP-.VKQYFY-------------ETRCKEA.......KPVKNG---------------------CR
NGF_XIPMA/82-193--------YVNINNVK-.KKQYFF-------------ETTCHSP.......PSGGSR---------------------CL
NGFV_BUNMU/128-242--------DVNLNNEV-.YKQYFF-------------ETKCRNP.......NPVPSG---------------------CR

PF02035

COAG_TACTR/23-195VFRECGKYECRTVRPE-HSRCYNFPPFTHFKLECPVSTRDCEPVF------GYTVAGEFRVIVQAPRAGFRQCVWQHKCR
COAG_LIMPO/23-195AFKECGKYECRTVTSE-DSRCYNFFPFHHFPSECPVSVSACEPTF------GYTTSNELRIIVQAPKAGFRQCVWQHKCR

PF05463

Q1LXE0_DANRE/6-198----------LNP-VK-ELVCA----------------GECLPTHL-----LPNWIG----GGH...YWSRRD-----AQ
SOST_MOUSE/1-208----------AKP-VT-ELVCS----------------GQCGPARL-----LPNAIG----RVK....WWRPN-----GP
SOSD1_MOUSE/6-206----------ISP-LK-ELVCA----------------GECLPLPV-----LPNWIG----GGYGTKYWSRRS-----SQ
Q688C5_XENTR/6-213----------IQP-LK-ELVCA----------------GECLPLPI-----LPNWIG----GGYGLKYWSRRS-----SQ

PF03045

Q76C27_PAROL/127-248----------VT--VH-NKLCF----------------GQCSSLFV------PSEGE----FAGLSTGTGALP-----RR
Q2A123_9CNID/35-145----------VT--ID-VPFCY----------------GQCNSFFI------PRY..----..........GE-----DF
NBL1_HUMAN/3-125----------KS--IQ-NRACL----------------GQCFSYSV------PNTFP----QSTES.......-----.L
Q2A124_9CNID/46-158----------KY--VA-NNFCF----------------GQCGSFII------PYYNI----TNKKISRLT...-----.L
Q0Q621_NEMVE/30-125----------AE--IV-NNFCY----------------GQCNSLYI------PHYNR----QTPA........-----.F
A8E7M9_DANRE/115-232----------VT--VH-NNLCY----------------GQCSSMFV------PSS..----......GGSHGQ-----QK
CER1_MOUSE/132-247----------VV--VQ-NNLCF----------------GKCSSIRF------PGE..----.........GAD-----AH
GREM2_HUMAN/46-163----------RT--IL-NRFCY----------------GQCNSFYI------PRHVK----KEEES.......-----.F
Q7YX42_CAEEL/217-337----------KV--VV-NRLCH----------------GACASIFI------PRMHS----KKLKAA......-----.F
CER1_CHICK/138-253----------VI--VQ-NNLCF----------------GKCSSFHV------PGP..----.........DDR-----LY
CER1_HUMAN/132-247----------VV--VQ-NNLCF----------------GKCGSVHF------PGA..----.........AQH-----SH
NBL1_DANRE/7-129----------RS--IQ-NRACL----------------GQCFSYSV------PNTFP----QSTES.......-----.L
Q4H3R0_CIOIN/111-239----------EL--I.-NQFCY----------------GQCNSFYI------PKDIE----IDERDGEIETDY-----.F
Q6T937_DANRE/60-177----------RA--II-NRFCY----------------GQCNSFYI------PRHIY----QEDGA.......-----.F
CER1_XENLA/139-253----------MV--IQ-NNLCF----------------GKCISLHV------PNQ..----..........QD-----RR
DAND5_XENTR/87-203----------VR--LP-NKFCF----------------GQCNSFYV------PGW..----.........PAG-----LS
Q4RXN8_TETNG/99-212----------QS--VQ-NRACL----------------GQCFSYSV------PNTFP----QSTES.......-----.L
GREM1_MOUSE/67-184----------RT--II-NRFCY----------------GQCNSFYI------PRHIR----KEEGS.......-----.F
Q76C28_TAKRU/125-244----------VT--VH-NKLCF----------------GQCSSLFV------PSE..----.APLGTGMGLLH-----HR
Q566Z5_DANRE/44-161----------RT--VI-NRFCY----------------GQCNSFYI------PRHVK----KEQES.......-----.F

PF00007

TSHB_HUMAN/19-125----------CLT-IN-TTICA----------------GYCMTRDI-----NGKLFL----PKYA--------------L
FSHB_RAT/19-123----------CIS-IN-TTWCE----------------GYCYTRD.-----.LVYKD----PARP--------------N
CYR61_MOUSE/281-374----------VKK-YR-PKYC.----------------GSCV....-----.....D----GR..--------------.
GTHB2_FUNHE/24-128----------CHR-VE-TTICS----------------GYCATKD.-----.PNYKT----SYNK--------------A
GTHB1_THUOB/5-99----------TEF-IL-TTICE----------------GQCYLED.-----.PVYIS----HD..--------------.
GTHB1_FUNHE/17-114----------RVC-IH-TTICE----------------GLCFSED.-----.AVFES----PDEA--------------P
LSHB_HUMAN/26-130----------CIT-VN-TTICA----------------GYCPTMM.-----.RVLQA----VLPP--------------L
CTGF_HUMAN/253-346----------MKT-YR-AKFC.----------------GVCT....-----.....D----GR..--------------.
FSHB_BOVIN/18-122----------CIS-IN-TTWCA----------------GYCYTRD.-----.LVYRD----PARP--------------N
TSHB_BOVIN/19-125----------CLT-IN-TTVCA----------------GYCMTRDV-----NGKLFL----PKYA--------------L
MUC2_HUMAN/5072-5176----------.KT-VL-MNHCS----------------GSCGTFV.-----.MYSAK----AQAL--------------D
TSHB_ANGAN/19-125----------CVA-IN-TTICM----------------GFCYSLDP-----NVVGPA----VKRL--------------V
CYR61_CHICK/278-371----------VKK-YR-PKYC.----------------GSCV....-----.....D----GR..--------------.
GTHB2_CTEID/32-136----------CLV-FQ-TTICS----------------GHCLTKE.-----.PVYKS----PFST--------------V
GTHB2_ANGAN/27-131----------CLV-FQ-TSICS----------------GHCITKD.-----.PSYKS----PLST--------------V
GTHB2_ONCKE/26-130----------CLV-IQ-TPICS----------------GHCVTKE.-----.PVFKS----PFST--------------V
CGHB_HUMAN/26-130----------CIT-VN-TTICA----------------GYCPTMT.-----.RVLQG----VLPA--------------L
NOV_CHICK/255-348----------VQT-YK-PRYC.----------------GLCN....-----.....D----GR..--------------.
LSHB_HORSE/26-130----------CIT-FT-TSICA----------------GYCPSMV.-----.RVMPA----ALPA--------------I
TSHB_ONCMY/19-125----------CVA-IN-TTICM----------------GFCYSRDS-----NMKELA----GPRF--------------L
LSHB_LITCT/1-105----------CIT-FT-TSICT----------------GYCQTMD.-----.PVYKT----ALSS--------------F
CGHB_PAPAN/26-130----------CVT-VN-TTICA----------------GYCPTMM.-----.RVLQA----VLPP--------------V
GTHB2_THUOB/3-107----------CHP-VE-TTICS----------------GHCITKD.-----.PVIKI----PFSK--------------V
GTHB1_ONCKE/29-130----------..S-IT-ITTCA----------------GLCETTD.-----.LNYQS----TWLP--------------R

PF05806

NOGG_TAKRU/6-221----------RRL-QQ-WLWAY----------------SFCPLAHA------WTDLG----SRFWPRFVRAGS-----CL
NOGG2_DANRE/3-212----------RKF-LQ-WLWMY----------------THCPVLYT------WKDLG----LRFWPRYIKEGN-----CF
NOGG3_DANRE/6-221----------RRL-QL-WLWSY----------------TFCPVVHT------WQDLG----NRFWPRYLKVGS-----CY
NOGG1_DANRE/6-214----------RRL-QM-WLWSY----------------SFCPVLYA------WNDLG----SRFWPRFVRAGS-----CY
Q8MY69_DUGJA/1-269----------SAI-RR-WMVQQ----------------AACKIDYL------WKRLD----DTHWPSFIKHGV-----CN
NOGG_XENLA/6-222----------RKL-QM-WLWSQ----------------TFCPVLYT------WNDLG----TRFWPRYVKVGS-----CY

PF00019

BMP3_HUMAN/367-472----------PKS-FD-AYYCS----------------GACQFPMP-----KSLKPS....NHATIQSIVRAV.GVV.PG
TGFB1_BOVIN/290-390----------PKG-YH-ANFCL----------------GPCPYIWS-----LDTQYS....K...VLALYNQH..NP.GA
BMP8B_HUMAN/298-402----------PQG-YS-AYYCE----------------GECSFPLD-----SCMNAT....NHAILQSLVHLM..MP.DA
60A_DROME/351-455----------PEG-YG-AFYCS----------------GECNFPLN-----AHMNAT....NHAIVQTLVHLL..EP.KK
BMP2_HUMAN/293-396----------PPG-YH-AFYCH----------------GECPFPLA-----DHLNST....NHAIVQTLVNSV..N..SK
BMP5_HUMAN/350-454----------PEG-YA-AFYCD----------------GECSFPLN-----AHMNAT....NHAIVQTLVHLM..FP.DH
DECA_DROME/484-588----------PLG-YD-AYYCH----------------GKCPFPLA-----DHFNST....NHAVVQTLVNNM..NP.GK
DSL1_CHICK/322-427----------PKD-YE-AFECK----------------GGCFFPLT-----DNVTPT....KHAIVQTLVHLQ..NP.KK
DVR1_DANRE/251-355----------PQG-YL-ANYCH----------------GECPFPLS-----ESLNGT....NHAILQTLVHSF..DP.KG
DVR1_XENLA/256-360----------PQG-YM-ANYCY----------------GECPYPLT-----EILNGS....NHAILQTLVHSI..EP.ED
GDF1_HUMAN/264-372----------PRG-FL-ANYCQ----------------GQCALPVA-----LSGSGGPPALNHAVLRALMHAA..AP.GA
INHA_BOVIN/253-360----------PPS-FI-FYYCH----------------GGCGLSPP-----QDLPLP....VPGVPPTPVQPLSLVP...
INHBA_BOVIN/317-425----------PSG-YH-ANYCE----------------GECPSHIA-----GTSGSSLSFHSTVINHYRMRGH..SP.FA
INHBB_HUMAN/300-407----------PTG-YY-GNYCE----------------GSCPAYLA-----GVPGSASSFHTAVVNQYRMRGL..NP..G
MIS_BOVIN/474-575----------PET-YQ-ANNCQ----------------GACGWPQS-----DRNPRY...GNHVVLLLKMQAR.G..ATL
TGFB2_CHICK/312-412----------PKG-YH-ANFCA----------------GACPYLWS-----SDTQHS.......RVLSLYNTI..NP.EA
GDNF_RAT/115-211----------KEE-LI-FRYCS----------------GSCEAAET-----MYDKIL...K...NLSRSRRLT.S...DK
PSPN_RAT/63-155----------EEK-II-FRYCA----------------GSCPQEVR-----TQHSLV...L..ARLRGQG........RA
NRTN_HUMAN/100-197----------DET-VL-FRYCA----------------GACEAAAR-----VYDLGL...R...RLRQRRRLR..RE.RV
PSPN_HUMAN/63-155----------EEK-VI-FRYCA----------------GSCPRGAR-----TQHGLA...L..ARLQGQG........RA

PF00236

GLHA_HORSE/25-120----------KLG-VP.IYQCK----------------GCCF--------------------------------------
GLHA1_ONCKE/14-108----------NPG-AP.VYQCT----------------GCCF--------------------------------------
GLHA_ACALA/24-117----------R.D-RP.IYQCM----------------GCCF--------------------------------------
GLHA1_CYPCA/24-118----------KPG-AP.VYQCM----------------GCCF--------------------------------------
GLHA_RAT/25-120----------KLG-AP.IYQCM----------------GCCF--------------------------------------
GLHA_MACMU/25-120----------KPG-AP.IYQCM----------------GCCF--------------------------------------
GLHA_HUMAN/25-116----------QPG-AP.ILQCM----------------GCCF--------------------------------------
GLHA_ANGAN/25-117----------KPS-AP.IFQCV----------------GCCF--------------------------------------
GLHA_LITCT/1-97----------NMG-IGRIYQCS----------------GCCY--------------------------------------
GLHA2_ONCTS/23-114----------N..-...IMQCT----------------GCCF--------------------------------------

PF00341

B0X067_CULQU/55-138--------..PEC.TR-VKRCS..-------------.GCCV------------------------------------.S
Q16I04_AEDAE/108-191--------..PSC.TR-VERCS..-------------.GCCV------------------------------------.S
B3MZW0_DROAN/145-226--------..PAC.TR-VNRCS..-------------.GCCG------------------------------------.S
Q29GD9_DROPS/139-221--------..PAC.TR-INRCN..-------------.GCCG------------------------------------.S
B4I6X7_DROSE/58-139--------..PAC.TR-ISRCN..-------------.GCCG------------------------------------.S
A5JL80_ORYLA/9-87--------..PSC.VV-LKRCA..-------------.GCCN------------------------------------.D
E9QGX7_DANRE/83-161--------..PSC.VV-LTRCA..-------------.GCCN------------------------------------.D
D3XLB1_PSEGE/50-128--------..PSC.VV-LNRCG..-------------.GCCS------------------------------------.D
Q4SV40_TETNG/13-91--------..PSC.VV-LKRCG..-------------.GCCN------------------------------------.D
Q38KY2_ANGJA/48-126--------..PSC.VV-LMRCG..-------------.GCCN------------------------------------.D
Q6H8S8_ONCMY/50-128--------..PSC.VV-LMRCA..-------------.GCCN------------------------------------.D
D2W908_9SAUR/52-130--------..PSC.VP-LLRCA..-------------.GCCN------------------------------------.D
VEGFA_BITGA/52-130--------..PSC.VA-LMRCG..-------------.GCCN------------------------------------.D
D2W911_9SAUR/47-125--------..PSC.VS-LMRCG..-------------.GCCS------------------------------------.D
VEGFA_CHICK/52-130--------..PSC.VP-LMRCA..-------------.GCCG------------------------------------.D
Q9GK00_CALJA/12-90--------..PSC.VP-LMRCG..-------------.GCCN------------------------------------.D
Q07G81_XENTR/52-130--------..PSC.VP-LMRCA..-------------.GCCN------------------------------------.D
C3KGR8_ANOFI/46-124--------..PAC.VP-LWRCS..-------------.GCCM------------------------------------.D
Q4SCW7_TETNG/46-125--------..PSC.VP-LKRCS..-------------.GCCG------------------------------------.D
F1Q7V5_DANRE/13-92--------..PAC.VP-LVRCA..-------------.GCCG------------------------------------.D
E2QZR3_CANFA/52-130--------..PSC.VS-LLRCS..-------------.GCCG------------------------------------.D
PLGF_BOVIN/52-130--------..PSC.VS-LMRCT..-------------.GCCS------------------------------------.D
PLGF_RAT/48-127--------..PSC.VL-LSRCS..-------------.GCCG------------------------------------.D
E7EZR4_DANRE/55-132--------..PSC.VT-LRRCG..-------------.GCCS------------------------------------.D
E9QDL3_DANRE/5-87--------..PSC.VP-LQRCG..-------------.GCCS------------------------------------.D
TXVE_SISCA/38-117--------..PSC.VT-VLRCG..-------------.GCCT------------------------------------.D
TXVE_BOTER/38-117--------..PSC.VT-ALRCG..-------------.GCCT------------------------------------.D
TXVE_BITAR/38-117--------..PSC.VA-VLRCG..-------------.GCCS------------------------------------.D
TXVE_DABRR/38-117--------..PSC.VA-VLRCS..-------------.GCCT------------------------------------.D
F1RQ05_PIG/47-124--------..PSC.VT-VQRCG..-------------.GCCP------------------------------------.D
B6VAE7_9POXV/47-128--------..PPC.VS-VMRCG..-------------.GCCN------------------------------------.D
D0VXD7_ORFV/37-118--------..PPC.VT-LMRCG..-------------.GCCN------------------------------------.D
Q772M8_ORFV/35-113--------..PPC.VT-LMRCG..-------------.GCCN------------------------------------.D
Q6R5A5_9POXV/50-140--------..PQC.VT-LMRCG..-------------.GCCN------------------------------------.D
Q6TVI2_9POXV/49-135--------..PPC.VT-LMRCG..-------------.GCCN------------------------------------.D
E5KXN4_9POXV/47-131--------..PQC.VT-VKKCG..-------------.GCCN------------------------------------.G
VEGFH_ORFN7/46-132--------..PRC.VT-VKRCS..-------------.GCCN------------------------------------.G
Q6TVI8_ORFSA/46-132--------..PRC.VT-VKRCS..-------------.GCCN------------------------------------.G
Q8B571_9POXV/54-136--------..PRC.VT-VRRCG..-------------.GCCN------------------------------------.D
A5JTQ1_CHICK/111-191--------..PPC.VN-VFRCG..-------------.GCCN------------------------------------.E
F1PEV4_CANFA/71-151--------..PPC.VN-VFRCG..-------------.GCCN------------------------------------.E
B5X5X7_SALSA/128-207--------..PPC.VS-VFRCN..-------------.GCCN------------------------------------.K
Q208T6_DANRE/107-188--------..PPC.VS-VFRCG..-------------.GCCN------------------------------------.K
C0HAQ2_SALSA/127-207--------..PPC.VS-VYRCG..-------------.GCCN------------------------------------.S
O57352_COTCO/130-210--------..PPC.VS-IYRCG..-------------.GCCN------------------------------------.S
Q4T6L6_TETNG/117-197--------..PPC.VS-VYRCG..-------------.GCCH------------------------------------.S
C3XWJ2_BRAFL/27-104--------..PSC.VS-VFRCG..-------------.GCCN------------------------------------.D
PDGFD_HUMAN/272-362--------..PRC.LL-VQRCGGN-------------CGCGT------------------------------------VN
Q674V2_PODCA/179-255--------..PAC.TV-MKQCG..-------------.GCCT------------------------------------.H
B1H1E3_XENTR/92-175--------VWPPC.VE-VQRCS..-------------.GCCN------------------------------------.S
Q549C6_MOUSE/97-180--------VWPPC.VE-VQRCS..-------------.GCCN------------------------------------.N
Q90W23_CHICK/104-187--------VWPPC.VE-VQRCS..-------------.GCCN------------------------------------.N
Q7TPH7_MOUSE/96-179--------IWPPC.VE-VKRCT..-------------.GCCN------------------------------------.T
Q9DE50_DANRE/95-179--------IWPPCGGE-VRRCS..-------------.GCCN------------------------------------.T
E7FBB3_DANRE/86-169--------LWPPC.VE-VQRCS..-------------.GCCN------------------------------------.T
F1QS30_DANRE/95-178--------LWPSC.VE-VQRCS..-------------.GCCN------------------------------------.A
E9G4R4_DAPPU/48-125--------..PTC.AL-VERCG..-------------.GCCK------------------------------------.H

PF00243

NGF_BOVIN/125-239--GIDAKHWNS--------YCTTTHTFVKALT------------------------------------------------
NTF4_HUMAN/86-209--GVDRRHWVS--------ECKAKQSYVRALT------------------------------------------------
BDNF_CHICK/129-246--GIDKRHWNS--------QCRTTQSYVRALT------------------------------------------------
NTF4_XENLA/120-235--GVDKKQWIS--------ECKAKQSYVRALT------------------------------------------------
NTF3_CHICK/141-256--GIDDKHWNS--------QCKTSQTYVRALT------------------------------------------------
NGF_XIPMA/82-193--GIDARHWNS--------HCTNSHTFVRALT------------------------------------------------
NGFV_BUNMU/128-242--GIDSRHWNS--------YCTTTDTFVKALT------------------------------------------------

PF02035

COAG_TACTR/23-195.FGSNSCGYNG--------RCTQQRSVVRLVT------------------------------------------------
COAG_LIMPO/23-195AYGSNFCQRTG--------RCTQQRSVVRLVT------------------------------------------------

PF05463

Q1LXE0_DANRE/6-198--EW--RCVTD--------RTRTQRIKLQCQD------------------------------------------------
SOST_MOUSE/1-208--DF--RCIPD--------RYRAQRVQLLCPG------------------------------------------------
SOSD1_MOUSE/6-206--EW--RCVND--------KTRTQRIQLQCQD------------------------------------------------
Q688C5_XENTR/6-213--EW--RCVND--------KTRTQRIQLQCED------------------------------------------------

PF03045

Q76C27_PAROL/127-248--APCSRCAPS--------KAHTVTVPLRCRG------------------------------------------------
Q2A123_9CNID/35-145--NSCNTCMPK--------KWNETKVQLNCKT------------------------------------------------
NBL1_HUMAN/3-125--VHCDSCMPA--------QSMWEIVTLECPG------------------------------------------------
Q2A124_9CNID/46-158--ENCKQCVPE--------DFELTKIPIYCPE------------------------------------------------
Q0Q621_NEMVE/30-125--ESCATCIPV--------RVHRRSVYLNCPN------------------------------------------------
A8E7M9_DANRE/115-232--AQCTRCGPS--------RARSVLLHLRCGS------------------------------------------------
CER1_MOUSE/132-247--SFCSHCSPT--------KFTTVHLMLNCTS------------------------------------------------
GREM2_HUMAN/46-163--QSCAFCKPQ--------RVTSVLVELECPG------------------------------------------------
Q7YX42_CAEEL/217-337--RSCAACAPA--------EYDYVDITLDCPG------------------------------------------------
CER1_CHICK/138-253--TFCSKCLPT--------KFSMKHLDLNCTS------------------------------------------------
CER1_HUMAN/132-247--TSCSHCLPA--------KFTTMHLPLNCTE------------------------------------------------
NBL1_DANRE/7-129--VHCDSCMPA--------QTQWEVVTLDCSG------------------------------------------------
Q4H3R0_CIOIN/111-239--RFCAFCKPK--------TEEWISVRLRCRR------------------------------------------------
Q6T937_DANRE/60-177--QSCSVCKPK--------SFTTVTYTLFCPG------------------------------------------------
CER1_XENLA/139-253--NTCSHCLPS--------KFTLNHLTLNCTG------------------------------------------------
DAND5_XENTR/87-203--QPCTSCAPS--------RSRRISLPLRCRA------------------------------------------------
Q4RXN8_TETNG/99-212--VHCDSCMPA--------QTQWEVV.LNAPS------------------------------------------------
GREM1_MOUSE/67-184--QSCSFCKPK--------KFTTMMVTLNCPE------------------------------------------------
Q76C28_TAKRU/125-244--GPCSRCAPS--------KAHAVVLPLLCGA------------------------------------------------
Q566Z5_DANRE/44-161--QSCAFCRPQ--------RFTSLTVELDCSD------------------------------------------------

PF00007

TSHB_HUMAN/19-125--SQDVCTYRD--------FIYRTVEIPGCPL------------------------------------------------
FSHB_RAT/19-123--TQKVCTFKE--------LVYETIRLPGCAR------------------------------------------------
CYR61_MOUSE/281-374--....CCTPL--------QTRTVKMRFRCED------------------------------------------------
GTHB2_FUNHE/24-128--IQHVCTYGD--------LYYKTFEFPECVP------------------------------------------------
GTHB1_THUOB/5-99--EQKICNG.D--------WSYEVKHIEGCPV------------------------------------------------
GTHB1_FUNHE/17-114--EHRVCNG.D--------WSYEVKHIQGCPE------------------------------------------------
LSHB_HUMAN/26-130--PQVVCTYRD--------VRFESIRLPGCPR------------------------------------------------
CTGF_HUMAN/253-346--....CCTPH--------RTTTLPVEFKCPD------------------------------------------------
FSHB_BOVIN/18-122--IQKTCTFKE--------LVYETVKVPGCAH------------------------------------------------
TSHB_BOVIN/19-125--SQDVCTYRD--------FMYKTAEIPGCPR------------------------------------------------
MUC2_HUMAN/5072-5176--HSCSCCKEE--------KTSQREVVLSCPN------------------------------------------------
TSHB_ANGAN/19-125--VQRGCTYQA--------VEYRTAELPGCPP------------------------------------------------
CYR61_CHICK/278-371--....CCTPQ--------QTRTVKIRFRCDD------------------------------------------------
GTHB2_CTEID/32-136--YQHVCTYRD--------VRYETVRLPDCPP------------------------------------------------
GTHB2_ANGAN/27-131--YQRVCTYRD--------VRYETVRLPDCRP------------------------------------------------
GTHB2_ONCKE/26-130--YQHVCTYRD--------VRYETIRLPDCPP------------------------------------------------
CGHB_HUMAN/26-130--PQVVCNYRD--------VRFESIRLPGCPR------------------------------------------------
NOV_CHICK/255-348--....CCTPH--------NTKTIQVEFRCPQ------------------------------------------------
LSHB_HORSE/26-130--PQPVCTYRE--------LRFASIRLPGCPP------------------------------------------------
TSHB_ONCMY/19-125--IQRGCTYDQ--------VEYRTVILPGCPL------------------------------------------------
LSHB_LITCT/1-105--KQNICTYKE--------IRYDTIKLPDCLP------------------------------------------------
CGHB_PAPAN/26-130--PQVVCNYRE--------VRFESIRLPGCPP------------------------------------------------
GTHB2_THUOB/3-107--YQHVCTYRD--------FYYKTFELPDCPP------------------------------------------------
GTHB1_ONCKE/29-130--SQGVCNFKE--------WSYEKVYLEGCPS------------------------------------------------

PF05806

NOGG_TAKRU/6-221--SKRSCSVPEGMTCKPATSTHLTILRWRCVQ................................................
NOGG2_DANRE/3-212--SERSCSFPEGMSCKPVKAVTKTFLRWYCQG................................................
NOGG3_DANRE/6-221--NKRSCSVPEGMVCKPPKSSHLTVLRWRCVQ................................................
NOGG1_DANRE/6-214--TKRSCSVPEGMVCKPAKSTHITLLRWRCVA................................................
Q8MY69_DUGJA/1-269--SRESCSWPPGMNCRPNDQKLLKILKWTCISDPLGKRWNEFRESIFADKRKRRLRRHKIKRHLSQKRKTNKVIRPKRMK
NOGG_XENLA/6-222--SKRSCSVPEGMVCKAAKSMHLTILRWRC.Q................................................

PF00019

BMP3_HUMAN/367-472--IPEPCCVPE--------..KMSSLSILFFD------------------------------------------------
TGFB1_BOVIN/290-390--SAAPCCVPQ--------..ALEPLPIVYYV------------------------------------------------
BMP8B_HUMAN/298-402--VPKACCAPT--------..KLSATSVLYYD------------------------------------------------
60A_DROME/351-455--VPKPCCAPT--------..RLGALPVLYHL------------------------------------------------
BMP2_HUMAN/293-396--IPKACCVPT--------..ELSAISMLYLD------------------------------------------------
BMP5_HUMAN/350-454--VPKPCCAPT--------..KLNAISVLYFD------------------------------------------------
DECA_DROME/484-588--VPKACCVPT--------..QLDSVAMLYLN------------------------------------------------
DSL1_CHICK/322-427--ASKACCVPT--------..KLDAISILYKD------------------------------------------------
DVR1_DANRE/251-355--TPQPCCVPI--------..KLSPISMLYYD------------------------------------------------
DVR1_XENLA/256-360--IPLPCCVPT--------..KMSPISMLFYD------------------------------------------------
GDF1_HUMAN/264-372--ADLPCCVPA--------..RLSPISVLFFD------------------------------------------------
INHA_BOVIN/253-360--GAQPCCAAL--------PGTMRPLHVRTTS------------------------------------------------
INHBA_BOVIN/317-425--NLKSCCVPT--------..KLRPMSMLYYD------------------------------------------------
INHBB_HUMAN/300-407--TVNSCCIPT--------..KLSTMSMLYFD------------------------------------------------
MIS_BOVIN/474-575--ARPPCCVPT--------..AYTGKLLISLS------------------------------------------------
TGFB2_CHICK/312-412--SASPCCVSQ--------..DLEPLTILYYI------------------------------------------------
GDNF_RAT/115-211--VGQACCRPV--------..AFDDDLS.FLD------------------------------------------------
PSPN_RAT/63-155--HGRPCCQPT--------..SYADVTF..LD------------------------------------------------
NRTN_HUMAN/100-197--RAQPCCRPT--------..AYEDEVS.FLD------------------------------------------------
PSPN_HUMAN/63-155--HGGPCCRPT--------..RYTDVAF..LD------------------------------------------------

PF00236

GLHA_HORSE/25-120---SRAYPTPA--------RSRKTMLVPKNI-------------------------------------------------
GLHA1_ONCKE/14-108---SRAYPTPL--------QSKKAMLVPKNI-------------------------------------------------
GLHA_ACALA/24-117---SRAYPTPL--------KAMKTMTIPKNI-------------------------------------------------
GLHA1_CYPCA/24-118---SRAYPTPL--------RSKKTMLVPKNI-------------------------------------------------
GLHA_RAT/25-120---SRAYPTPA--------RSKKTMLVPKNI-------------------------------------------------
GLHA_MACMU/25-120---SRAYPTPV--------RSKKTMLVQKNV-------------------------------------------------
GLHA_HUMAN/25-116---SRAYPTPL--------RSKKTMLVQKNV-------------------------------------------------
GLHA_ANGAN/25-117---SRAYPTPL--------RSKKTMLVPKNI-------------------------------------------------
GLHA_LITCT/1-97---SRAYPTPM--------RSKKTMLVPKNI-------------------------------------------------
GLHA2_ONCTS/23-114---SRAYPTPL--------RSKQTMLVPKNI-------------------------------------------------

PF00341

B0X067_CULQU/55-138--.SRLACLPT--------ATRTIPFTVTVL.------------------------------------------------
Q16I04_AEDAE/108-191--.KRLSCQPT--------STRLRTFSVNVL.------------------------------------------------
B3MZW0_DROAN/145-226--.TLITCQPT--------ETEIVQMRVWRG.------------------------------------------------
Q29GD9_DROPS/139-221--.TLISCQPT--------QTEKVQMRVRKF.------------------------------------------------
B4I6X7_DROSE/58-139--.TLISCQPT--------EVEQVQLRVRKV.------------------------------------------------
A5JL80_ORYLA/9-87--.EMLQCTPT--------ETYNITMEIKRI.------------------------------------------------
E9QGX7_DANRE/83-161--.EMMECTPT--------VTYNITLEIKRL.------------------------------------------------
D3XLB1_PSEGE/50-128--.EALECVPT--------ETHNVTMEVMRH.------------------------------------------------
Q4SV40_TETNG/13-91--.EGKECVPA--------ESRNVTLQLQRF.------------------------------------------------
Q38KY2_ANGJA/48-126--.EALECVPV--------ATRNVTLEVKRV.------------------------------------------------
Q6H8S8_ONCMY/50-128--.EALECVPT--------ETKNVTMEVIQV.------------------------------------------------
D2W908_9SAUR/52-130--.EALECVPT--------EVHNVTMEIMRL.------------------------------------------------
VEGFA_BITGA/52-130--.EALECVPT--------EMYNVTMEVMKL.------------------------------------------------
D2W911_9SAUR/47-125--.EALECVPL--------ELQNVTMEVMRI.------------------------------------------------
VEGFA_CHICK/52-130--.EGLECVPV--------DVYNVTMEIARI.------------------------------------------------
Q9GK00_CALJA/12-90--.EGLECVPT--------EEFNITMQIMRI.------------------------------------------------
Q07G81_XENTR/52-130--.ESLECVPT--------ESYNITMQIMKI.------------------------------------------------
C3KGR8_ANOFI/46-124--.ENLECQAS--------LKSNITLEVMRI.------------------------------------------------
Q4SCW7_TETNG/46-125--.EHLECQPT--------LESNVTLQVIKI.------------------------------------------------
F1Q7V5_DANRE/13-92--.ENLECHPT--------LTSNTTMQLLKI.------------------------------------------------
E2QZR3_CANFA/52-130--.ENLHCMPV--------ETANVTMQLLMI.------------------------------------------------
PLGF_BOVIN/52-130--.ESMHCVPL--------ETANVTMQLMKY.------------------------------------------------
PLGF_RAT/48-127--.EGLHCVAL--------KTANITMQILKI.------------------------------------------------
E7EZR4_DANRE/55-132--.EALECVPS--------QTHTLVMELMKT.------------------------------------------------
E9QDL3_DANRE/5-87--.EAMVCVNV--------AKHTTIIQLQQY.------------------------------------------------
TXVE_SISCA/38-117--.ESLMCTAT--------GKRSVGREIMRV.------------------------------------------------
TXVE_BOTER/38-117--.ESLECTAT--------GKRSVGREIMRL.------------------------------------------------
TXVE_BITAR/38-117--.ESLTCTSV--------GERTVELQVMQV.------------------------------------------------
TXVE_DABRR/38-117--.ESMKCTPV--------GKHTADIQIMRM.------------------------------------------------
F1RQ05_PIG/47-124--.DGLECVPT--------GQHQVRMQILMI.------------------------------------------------
B6VAE7_9POXV/47-128--.ESLECVPT--------EEANITMEVMSV.------------------------------------------------
D0VXD7_ORFV/37-118--.ESLECVPT--------EEANVTMEFMGV.------------------------------------------------
Q772M8_ORFV/35-113--.ESLECVPT--------EEANVTMQLMGA.------------------------------------------------
Q6R5A5_9POXV/50-140--.ESLECVPT--------ETSNVTMQLMVTS------------------------------------------------
Q6TVI2_9POXV/49-135--.ESLECVPT--------ETSNVTMQIMTTS------------------------------------------------
E5KXN4_9POXV/47-131--.DNKVCTST--------ETANTTVTVMVT.------------------------------------------------
VEGFH_ORFN7/46-132--.DGQICTAV--------ETRNTTVTVSVT.------------------------------------------------
Q6TVI8_ORFSA/46-132--.EGQICTAV--------ETRNTTVVVSVT.------------------------------------------------
Q8B571_9POXV/54-136--.ESQICTAI--------ETANVTVTVMLT.------------------------------------------------
A5JTQ1_CHICK/111-191--.ESLSCMNT--------STTYVSKTLFEI.------------------------------------------------
F1PEV4_CANFA/71-151--.ESLVCMNT--------STSYVSKQLFEI.------------------------------------------------
B5X5X7_SALSA/128-207--.EGVSCRNT--------STAYVNKTLLSV.------------------------------------------------
Q208T6_DANRE/107-188--.EGVTCRNT--------SMTYVNKTILSV.------------------------------------------------
C0HAQ2_SALSA/127-207--.EAHQCMNI--------STSYISKTLFEI.------------------------------------------------
O57352_COTCO/130-210--.EGLQCMNI--------STNYISKTLFEI.------------------------------------------------
Q4T6L6_TETNG/117-197--.EDKQCRNI--------STGYLSKTLFEI.------------------------------------------------
C3XWJ2_BRAFL/27-104--.EMYECIAS--------EKNMVSKTIFEV.------------------------------------------------
PDGFD_HUMAN/272-362--WRSCTCNSG--------KTVKKYHEVLQF.------------------------------------------------
Q674V2_PODCA/179-255--LQFKECVPT--------VLENIKATVMMI.------------------------------------------------
B1H1E3_XENTR/92-175--.KNMRCAPT--------RIHVRHVQVNKI.------------------------------------------------
Q549C6_MOUSE/97-180--.RNVQCRAS--------QVQMRPVQVRKI.------------------------------------------------
Q90W23_CHICK/104-187--.RNVQCRPM--------QIRVRHVQVNKI.------------------------------------------------
Q7TPH7_MOUSE/96-179--.SSVKCQPS--------RVHHRSVKVAKV.------------------------------------------------
Q9DE50_DANRE/95-179--.SNMRCHPS--------KKHHRNVKVAKV.------------------------------------------------
E7FBB3_DANRE/86-169--.KTLQCVPV--------LTHTRYLQVMKI.------------------------------------------------
F1QS30_DANRE/95-178--.RTLQCVPV--------ITETRHLQITKI.------------------------------------------------
E9G4R4_DAPPU/48-125--.ERLHCVPV--------PEDITMMKKKVI.------------------------------------------------

PF00243

NGF_BOVIN/125-239------------MDGKQ.AAWRFIRIDTACVCVLSRKTGQ----------------------------------------
NTF4_HUMAN/86-209------------ADAQGRVGWRWIRIDTACVCTLLSRTGR----------------------------------------
BDNF_CHICK/129-246------------MDNKKRVGWRFIRIDTSCVCTLTIKRGR----------------------------------------
NTF4_XENLA/120-235------------IDANKLVGWRWIRIDTACVCTLLSRTGR----------------------------------------
NTF3_CHICK/141-256------------SENNKLVGWRWIRIDTSCVCALSRKIGR----------------------------------------
NGF_XIPMA/82-193------------SSENQ.VAWRLIRINVACVCVLSRKSWQ----------------------------------------
NGFV_BUNMU/128-242------------MEGNR.ASWRFIRIDTACVCVISRKTEN----------------------------------------

PF02035

COAG_TACTR/23-195------------YNLEK-DGFLCESFRTCCGCPCRSF-------------------------------------------
COAG_LIMPO/23-195------------YDLEK-GVFFCENVRTCCGCPCRS.-------------------------------------------

PF05463

Q1LXE0_DANRE/6-198------------GTT.RT-----YKITAVTSCTCKRYTRQNNESSHAPQSHSKDHP..........LQSPKKKKSKNKNS
SOST_MOUSE/1-208------------GAAPRS-----RKVRLVASCKCKRLTRFHNQSELKDFGPETARP......QKGRKPRPGARGAKANQA
SOSD1_MOUSE/6-206------------GST.RT-----YKITVVTACKCKRYTRQHNESSHNFESVSPAKP........AQHHRERKRASKSSKH
Q688C5_XENTR/6-213------------GTT.RT-----YKVTVVTSCKCKRYTRQHNESSHNYEGASPMKPIHSLQHHHSHHNRDKKRLIKMSKH

PF03045

Q76C27_PAROL/127-248------------EVRE.......KRVMVVEECKCETGIEE----------------------------------------
Q2A123_9CNID/35-145------------DGEWKV...VIKKVLLIGSCECQEVHCD----------------------------------------
NBL1_HUMAN/3-125------------HEEVPR...VDKLVEKILHCSCQACGKE----------------------------------------
Q2A124_9CNID/46-158------------RKKKHQ....FAKVLLIKKCVCKKNSCL----------------------------------------
Q0Q621_NEMVE/30-125------------AKQKRK.................RHRYT----------------------------------------
A8E7M9_DANRE/115-232------------EVRE.......RRVLIVEECKCETSSEE----------------------------------------
CER1_MOUSE/132-247------------PTPV......VKMVMQVEECQCMVKTER----------------------------------------
GREM2_HUMAN/46-163------------LDPPFR....LKKIQKVKQCRCMSVNLS----------------------------------------
Q7YX42_CAEEL/217-337------------RTPPTA....TKTIVKVKSCKCKEVRIA----------------------------------------
CER1_CHICK/138-253------------SVPV......VKKVMIVEECNCETQKIE----------------------------------------
CER1_HUMAN/132-247------------LSSV......IKVVMLVEECQCKVKTEH----------------------------------------
NBL1_DANRE/7-129------------SDEAPR...VDKLVERILHCSCQSCSKE----------------------------------------
Q4H3R0_CIOIN/111-239------------KGRKKRGRYVIKRVKRVKGCTCISVPEQ----------------------------------------
Q6T937_DANRE/60-177------------QTPNTK....KKRVRRVKQCRCTSVDLD----------------------------------------
CER1_XENLA/139-253------------SKNV......VKVVMMVEECTCEAHKSN----------------------------------------
DAND5_XENTR/87-203------------GHLA......WQEVELVEECECETRYDR----------------------------------------
Q4RXN8_TETNG/99-212------------A...........VCHYLDDNSCSALIIL----------------------------------------
GREM1_MOUSE/67-184------------LQPPTK....KKRVTRVKQCRCISIDLD----------------------------------------
Q76C28_TAKRU/125-244------------RVQE.......KRVLVVEECKCETGREE----------------------------------------
Q566Z5_DANRE/44-161------------LQPPVR....YRKIQRIKQCRCMSVSVS----------------------------------------

PF00007

TSHB_HUMAN/19-125------------HVAP------YFSYPVALSCKCG..KCNTDYSDCIHEAIKTNYC------------------------
FSHB_RAT/19-123------------HSDS------LYTYPVATECHCG..KCDSDSTDCTVRGLGPSYC------------------------
CYR61_MOUSE/281-374------------GEMF------SKNVMMIQSCKCN.YNCPHPNEASFRLYSLFNDI------------------------
GTHB2_FUNHE/24-128------------GVDP------VVTYPVALSCRCG..GCAMATSDCTFESLQPDFC------------------------
GTHB1_THUOB/5-99------------G...------.VTYPVARNCECT..ACNTGNTYCGRLPGYVPSC------------------------
GTHB1_FUNHE/17-114------------S...------.ITYPVATNCYCS..ACNTKDTYCTRLYAHIPSC------------------------
LSHB_HUMAN/26-130------------GVDP------VVSFPVALSCRCG..PCRRSTSDCGGPKDHPLTC------------------------
CTGF_HUMAN/253-346------------GEVM------KKNMMFIKTCACH.YNCPGDNDIFESLYYRKMYG------------------------
FSHB_BOVIN/18-122------------HADS------LYTYPVATECHCS..KCDSDSTDCTVRGLGPSYC------------------------
TSHB_BOVIN/19-125------------HVTP------YFSYPVAISCKCG..KCNTDYSDCIHEAIKTNYC------------------------
MUC2_HUMAN/5072-5176------------GGSL------THTYTHIESCQCQDTVCGLPTGTSRRARRSPRHL------------------------
TSHB_ANGAN/19-125------------HVDP------RFSYPVALHCTCR..ACDPARDECTHRASADGDR------------------------
CYR61_CHICK/278-371------------GETF------TKSVMMIQSCRCN.YNCPHANEAYPFYRLVNDIH------------------------
GTHB2_CTEID/32-136------------GVDP------HITYPVALSCDCS..LCTMDTSDCTIESLQPDFC------------------------
GTHB2_ANGAN/27-131------------GVDP------HVTFPVALSCDCN..LCTMDTSDCAIQSLRPDFC------------------------
GTHB2_ONCKE/26-130------------WVDP------HVTYPVALSCDCS..LCNMDTSDCTIESLQPDFC------------------------
CGHB_HUMAN/26-130------------GVNP------VVSYAVALSCQCA..LCRRSTTDCGGPKDHPLTC------------------------
NOV_CHICK/255-348------------GKFL------KKPMMLINTCVCH.GNCPQSNNAFFQPLDPMSSE------------------------
LSHB_HORSE/26-130------------GVDP------MVSFPVALSCHCG..PCQIKTTDCGVFRDQPLAC------------------------
TSHB_ONCMY/19-125------------HANP------LFTYPVALSCHCG..TCNTDSDECAHKASSGDGA------------------------
LSHB_LITCT/1-105------------GTDP------FFTYPVALSCYCD..LCKMDYSDCTVESSEPDVC------------------------
CGHB_PAPAN/26-130------------GVDP------MVSVPVALSCRCA..LCRRSTSDCGGPKDHPLTC------------------------
GTHB2_THUOB/3-107------------GVDP------TVTYPVALSCHCG..RCAMDTSDCTFESLQPDFC------------------------
GTHB1_ONCKE/29-130------------GVEP------.FFIPVAKSCDCI..KCKTDNTDCDRISMATPSC------------------------

PF05806

NOGG_TAKRU/6-221............RKVGLKCAWIPMQYPVITDCKCS---C-----------------------------------------
NOGG2_DANRE/3-212............FMRQKYCTWIQVQYPIISQCKCS---C-----------------------------------------
NOGG3_DANRE/6-221............RKGGLKCAWIPVQYPVISECKCS---C-----------------------------------------
NOGG1_DANRE/6-214............RRGALKCAWIPVQYPIITECKCS---C-----------------------------------------
Q8MY69_DUGJA/1-269RLVKRYLYRTSKYVSGYLCQWKPIDYTVHQSCTCS---C-----------------------------------------
NOGG_XENLA/6-222............RRVQQKCAWITIQYPVISECKCS---C-----------------------------------------

PF00019

BMP3_HUMAN/367-472-------------ENKN.VVLKVYPNMTVESCACR---------------------------------------------
TGFB1_BOVIN/290-390-------------GRKP..KVEQLSNMIVRSCKCS---------------------------------------------
BMP8B_HUMAN/298-402-------------SSNN.VILRKHRNMVVKACGCH---------------------------------------------
60A_DROME/351-455-------------NDEN.VNLKKYRNMIVKSCGCH---------------------------------------------
BMP2_HUMAN/293-396-------------ENEK.VVLKNYQDMVVEGCGCR---------------------------------------------
BMP5_HUMAN/350-454-------------DSSN.VILKKYRNMVVRSCGCH---------------------------------------------
DECA_DROME/484-588-------------DQST.VVLKNYQEMTVVGCGCR---------------------------------------------
DSL1_CHICK/322-427-------------DAGVPTLIYNYEGMKVAECGCR---------------------------------------------
DVR1_DANRE/251-355-------------NNDN.VVLRHYEDMVVDECGCR---------------------------------------------
DVR1_XENLA/256-360-------------NNDN.VVLRHYENMAVDECGCR---------------------------------------------
GDF1_HUMAN/264-372-------------NSDN.VVLRQYEDMVVDECGCR---------------------------------------------
INHA_BOVIN/253-360-------------DGGYSFKYEMVPNLLTQHCACI---------------------------------------------
INHBA_BOVIN/317-425-------------DGQN.IIKKDIQNMIVEECGCS---------------------------------------------
INHBB_HUMAN/300-407-------------DEYN.IVKRDVPNMIVEECGCA---------------------------------------------
MIS_BOVIN/474-575-------------EERI..SAHHVPNMVATECGCR---------------------------------------------
TGFB2_CHICK/312-412-------------GKTP..KIEQLSNMIVKSCKCS---------------------------------------------
GDNF_RAT/115-211-------------DSLV..YHILRK.HSAKRCGCI---------------------------------------------
PSPN_RAT/63-155-------------DHHH..WQQLPQ.LSAAACGCG---------------------------------------------
NRTN_HUMAN/100-197-------------AHSR..YHTVHE.LSARECACV---------------------------------------------
PSPN_HUMAN/63-155-------------DRHR..WQRLPQ.LSAAACGCG---------------------------------------------

PF00236

GLHA_HORSE/25-120---TSESTCCVAKAFIRVTVMGNIKLENHTQCYCSTCYHHKI--------------------------------------
GLHA1_ONCKE/14-108---TSEATCCVAKEGERVVVDN.IKLTNHTECWCNTCYHHKS--------------------------------------
GLHA_ACALA/24-117---TSEATCCVAKHVYETEVAG.IRVRNHTDCHCSTCYYHKI--------------------------------------
GLHA1_CYPCA/24-118---TSEATCCVAK.EVKRVLVNDVKLVNHTDCHCSTCYYHKS--------------------------------------
GLHA_RAT/25-120---TSEATCCVAKSFTKATVMGNARVENHTDCHCSTCYYHKS--------------------------------------
GLHA_MACMU/25-120---TSESTCCVAKSLTRVMVMGSVRVENHTECHCSTCYYHKF--------------------------------------
GLHA_HUMAN/25-116---TSESTCCVAKSYNRVTVMGGFKVENHTACHCSTCYYHKS--------------------------------------
GLHA_ANGAN/25-117---TSEATCCVAR...EVTRLDNMKLENHTDCHCSTCYYHKF--------------------------------------
GLHA_LITCT/1-97---TSEAKCCVAKTQYRVTVMDNVKIENHTACHCSTCLYHKS--------------------------------------
GLHA2_ONCTS/23-114---TSEATCCVAKEGERVTTKDGFPVTNHTECHCSTCYYHKS--------------------------------------

PF00341

B0X067_CULQU/55-138--......EYKTGTKLKFKNRDVTLVEEHVSCQC----------------------------------------------
Q16I04_AEDAE/108-191--......EYVSGTKTRFKNRDLAVIEEHVGCAC----------------------------------------------
B3MZW0_DROAN/145-226--........DRSGAEPRRKVTIVDVEQHLACRC----------------------------------------------
Q29GD9_DROPS/139-221--.........ERGGTSKRSSEIIVVEQHLACRC----------------------------------------------
B4I6X7_DROSE/58-139--........DRAATSGRRPFTIITVEQHTQCRC----------------------------------------------
A5JL80_ORYLA/9-87--...........KPQRQQNDIFMSFTEHSACEC----------------------------------------------
E9QGX7_DANRE/83-161--...........KPLRHQGDIFMSFAEHSECQC----------------------------------------------
D3XLB1_PSEGE/50-128--...........RPMVKKGTIQLSFTEHKSCIC----------------------------------------------
Q4SV40_TETNG/13-91--...........RPRVIKEVVDLSFTEHVLCVC----------------------------------------------
Q38KY2_ANGJA/48-126--...........KLHVTQHNFLLSFTEHTSCDC----------------------------------------------
Q6H8S8_ONCMY/50-128--...........KQRVSQHHFLLSFTEHRKCEC----------------------------------------------
D2W908_9SAUR/52-130--...........KYHQGQHLSWMSFQQHKTCEC----------------------------------------------
VEGFA_BITGA/52-130--...........KPFQSQHIHPVSFQQHSKCEC----------------------------------------------
D2W911_9SAUR/47-125--...........KIHQSQHITRMTFQQHKKCEC----------------------------------------------
VEGFA_CHICK/52-130--...........KPHQSQHIAHMSFLQHSKCDC----------------------------------------------
Q9GK00_CALJA/12-90--...........KPHQGQHIGEMSFLQHNKCEC----------------------------------------------
Q07G81_XENTR/52-130--...........KPHISQHIMDMSFQQHSQCEC----------------------------------------------
C3KGR8_ANOFI/46-124--...........HPMISMHHVLLTFVEHQRCEC----------------------------------------------
Q4SCW7_TETNG/46-125--..........QQTVVSMHYVEITFVEHQRCEC----------------------------------------------
F1Q7V5_DANRE/13-92--..........KPAEQGQEYVEMTFVEHKACEC----------------------------------------------
E2QZR3_CANFA/52-130--...........HSTGRPSYVELTFSQHIRCQC----------------------------------------------
PLGF_BOVIN/52-130--...........RSLDQPFFVEMSFSQHVRCEC----------------------------------------------
PLGF_RAT/48-127--..........PPNRDPHSYVEMTFSQDVLCEC----------------------------------------------
E7EZR4_DANRE/55-132--............SYMKHELVQLPFIEHNQCEC----------------------------------------------
E9QDL3_DANRE/5-87--.......ATDSEGNMAESIIELPFVEHSQCQC----------------------------------------------
TXVE_SISCA/38-117--..........DPRKETSKIEVMQFTEHTECEC----------------------------------------------
TXVE_BOTER/38-117--..........SPHKGTSEKEVMQFTEHTDCEC----------------------------------------------
TXVE_BITAR/38-117--..........TPKTLSSKIKVMKFREHTACEC----------------------------------------------
TXVE_DABRR/38-117--..........NPRTHSSKMEVMKFMEHTACEC----------------------------------------------
F1RQ05_PIG/47-124--............RYPSSQLGEMSLEEHSQCEC----------------------------------------------
B6VAE7_9POXV/47-128--........SVSSTGSNPGMQNMQFVEHLRCDC----------------------------------------------
D0VXD7_ORFV/37-118--........GVSSTGSSVSTQHLEFVEHTKCDC----------------------------------------------
Q772M8_ORFV/35-113--...........SVSGGNGMQHLSFVEHKKCDC----------------------------------------------
Q6R5A5_9POXV/50-140--AHNGGSNDNGSGGGIGSGMREMSFLQHNKCEC----------------------------------------------
Q6TVI2_9POXV/49-135--AY....NDGGTSGGISSGMREMSFLQHNKCEC----------------------------------------------
E5KXN4_9POXV/47-131--.....GVSSSSGNGASSNFRDISISEDKKCEC----------------------------------------------
VEGFH_ORFN7/46-132--...GVSSSSGTNSGVSTNLQRISVTEHTKCDC----------------------------------------------
Q6TVI8_ORFSA/46-132--...SVSSSSGANSGVSNNLQRISLTEHTKCDC----------------------------------------------
Q8B571_9POXV/54-136--.......GVSGSTGATSNFQTISVEEHTKCKC----------------------------------------------
A5JTQ1_CHICK/111-191--.........SVPLTSVPEPVPIKIANHTGCKC----------------------------------------------
F1PEV4_CANFA/71-151--.........SVPLTSVPELVPVKVANHTGCKC----------------------------------------------
B5X5X7_SALSA/128-207--..........IPFKYGPEPVLIKVANHTECKC----------------------------------------------
Q208T6_DANRE/107-188--........SLAPYISGPEPVLVKIANHTECKC----------------------------------------------
C0HAQ2_SALSA/127-207--.........TVSSSTSNNLVTISFANHTVCNC----------------------------------------------
O57352_COTCO/130-210--.........TVPLSHGPKPVTVSFANHTSCRC----------------------------------------------
Q4T6L6_TETNG/117-197--.........TVPITQGTKPVTISVANHTQCSC----------------------------------------------
C3XWJ2_BRAFL/27-104--............GLRGPNPVTKPFENHTRCEC----------------------------------------------
PDGFD_HUMAN/272-362--...EPGHIKRRGRAKTMALVDIQLDHHERCDC----------------------------------------------
Q674V2_PODCA/179-255--..........PYDYTRPKLHTVSFVQHKECAC----------------------------------------------
B1H1E3_XENTR/92-175--........FITPKGKKQVKVVVPLEDHHDCKC----------------------------------------------
Q549C6_MOUSE/97-180--........EIVRKKPIFKKATVTLEDHLACKC----------------------------------------------
Q90W23_CHICK/104-187--........EFFQRKPIFKKVIVPLEDHVQCRC----------------------------------------------
Q7TPH7_MOUSE/96-179--........EYVRKKPKLKEVQVRLEEHLECAC----------------------------------------------
Q9DE50_DANRE/95-179--........EYVRRRPKLREVQVQLEDHLECVC----------------------------------------------
E7FBB3_DANRE/86-169--........QYVKKRPLYDKAVVSVLDHVECRC----------------------------------------------
F1QS30_DANRE/95-178--........QYINRQPSYEKVVIPVEDHVTCSC----------------------------------------------
E9G4R4_DAPPU/48-125--........AVNNKGVYVNVTHVSIEKHNKCKC----------------------------------------------

PF00243

NGF_BOVIN/125-239---
NTF4_HUMAN/86-209---
BDNF_CHICK/129-246---
NTF4_XENLA/120-235---
NTF3_CHICK/141-256---
NGF_XIPMA/82-193---
NGFV_BUNMU/128-242---

PF02035

COAG_TACTR/23-195---
COAG_LIMPO/23-195---

PF05463

Q1LXE0_DANRE/6-198KLT
SOST_MOUSE/1-208ELE
SOSD1_MOUSE/6-206SLS
Q688C5_XENTR/6-213IPS

PF03045

Q76C27_PAROL/127-248---
Q2A123_9CNID/35-145---
NBL1_HUMAN/3-125---
Q2A124_9CNID/46-158---
Q0Q621_NEMVE/30-125---
A8E7M9_DANRE/115-232---
CER1_MOUSE/132-247---
GREM2_HUMAN/46-163---
Q7YX42_CAEEL/217-337---
CER1_CHICK/138-253---
CER1_HUMAN/132-247---
NBL1_DANRE/7-129---
Q4H3R0_CIOIN/111-239---
Q6T937_DANRE/60-177---
CER1_XENLA/139-253---
DAND5_XENTR/87-203---
Q4RXN8_TETNG/99-212---
GREM1_MOUSE/67-184---
Q76C28_TAKRU/125-244---
Q566Z5_DANRE/44-161---

PF00007

TSHB_HUMAN/19-125---
FSHB_RAT/19-123---
CYR61_MOUSE/281-374---
GTHB2_FUNHE/24-128---
GTHB1_THUOB/5-99---
GTHB1_FUNHE/17-114---
LSHB_HUMAN/26-130---
CTGF_HUMAN/253-346---
FSHB_BOVIN/18-122---
TSHB_BOVIN/19-125---
MUC2_HUMAN/5072-5176---
TSHB_ANGAN/19-125---
CYR61_CHICK/278-371---
GTHB2_CTEID/32-136---
GTHB2_ANGAN/27-131---
GTHB2_ONCKE/26-130---
CGHB_HUMAN/26-130---
NOV_CHICK/255-348---
LSHB_HORSE/26-130---
TSHB_ONCMY/19-125---
LSHB_LITCT/1-105---
CGHB_PAPAN/26-130---
GTHB2_THUOB/3-107---
GTHB1_ONCKE/29-130---

PF05806

NOGG_TAKRU/6-221---
NOGG2_DANRE/3-212---
NOGG3_DANRE/6-221---
NOGG1_DANRE/6-214---
Q8MY69_DUGJA/1-269---
NOGG_XENLA/6-222---

PF00019

BMP3_HUMAN/367-472---
TGFB1_BOVIN/290-390---
BMP8B_HUMAN/298-402---
60A_DROME/351-455---
BMP2_HUMAN/293-396---
BMP5_HUMAN/350-454---
DECA_DROME/484-588---
DSL1_CHICK/322-427---
DVR1_DANRE/251-355---
DVR1_XENLA/256-360---
GDF1_HUMAN/264-372---
INHA_BOVIN/253-360---
INHBA_BOVIN/317-425---
INHBB_HUMAN/300-407---
MIS_BOVIN/474-575---
TGFB2_CHICK/312-412---
GDNF_RAT/115-211---
PSPN_RAT/63-155---
NRTN_HUMAN/100-197---
PSPN_HUMAN/63-155---

PF00236

GLHA_HORSE/25-120---
GLHA1_ONCKE/14-108---
GLHA_ACALA/24-117---
GLHA1_CYPCA/24-118---
GLHA_RAT/25-120---
GLHA_MACMU/25-120---
GLHA_HUMAN/25-116---
GLHA_ANGAN/25-117---
GLHA_LITCT/1-97---
GLHA2_ONCTS/23-114---

PF00341

B0X067_CULQU/55-138---
Q16I04_AEDAE/108-191---
B3MZW0_DROAN/145-226---
Q29GD9_DROPS/139-221---
B4I6X7_DROSE/58-139---
A5JL80_ORYLA/9-87---
E9QGX7_DANRE/83-161---
D3XLB1_PSEGE/50-128---
Q4SV40_TETNG/13-91---
Q38KY2_ANGJA/48-126---
Q6H8S8_ONCMY/50-128---
D2W908_9SAUR/52-130---
VEGFA_BITGA/52-130---
D2W911_9SAUR/47-125---
VEGFA_CHICK/52-130---
Q9GK00_CALJA/12-90---
Q07G81_XENTR/52-130---
C3KGR8_ANOFI/46-124---
Q4SCW7_TETNG/46-125---
F1Q7V5_DANRE/13-92---
E2QZR3_CANFA/52-130---
PLGF_BOVIN/52-130---
PLGF_RAT/48-127---
E7EZR4_DANRE/55-132---
E9QDL3_DANRE/5-87---
TXVE_SISCA/38-117---
TXVE_BOTER/38-117---
TXVE_BITAR/38-117---
TXVE_DABRR/38-117---
F1RQ05_PIG/47-124---
B6VAE7_9POXV/47-128---
D0VXD7_ORFV/37-118---
Q772M8_ORFV/35-113---
Q6R5A5_9POXV/50-140---
Q6TVI2_9POXV/49-135---
E5KXN4_9POXV/47-131---
VEGFH_ORFN7/46-132---
Q6TVI8_ORFSA/46-132---
Q8B571_9POXV/54-136---
A5JTQ1_CHICK/111-191---
F1PEV4_CANFA/71-151---
B5X5X7_SALSA/128-207---
Q208T6_DANRE/107-188---
C0HAQ2_SALSA/127-207---
O57352_COTCO/130-210---
Q4T6L6_TETNG/117-197---
C3XWJ2_BRAFL/27-104---
PDGFD_HUMAN/272-362---
Q674V2_PODCA/179-255---
B1H1E3_XENTR/92-175---
Q549C6_MOUSE/97-180---
Q90W23_CHICK/104-187---
Q7TPH7_MOUSE/96-179---
Q9DE50_DANRE/95-179---
E7FBB3_DANRE/86-169---
F1QS30_DANRE/95-178---
E9G4R4_DAPPU/48-125---

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window