Sequence alignment for CL0082

PF14552

D6JQ64_ACIG3/38-114-KRFQRFISL..KPEN------------------------FIYP..S...........DRS----QHYI-----------
B7HN80_BACC7/39-123-DFFQMFLPY..QQNH------------------------FLYN..PY.Y..LLERGEKRT----ENMM-----------
D1BFT0_SANKS/38-113-KRFQRFVWL..DDDD------------------------LVAP..............QRG----PRYL-----------
D4E924_SEROD/38-119-DRFQVIDQY..RPGE------------------------LIYD..AH.Y..LGG...PRS----EDYV-----------
E8Y1J8_RAHSY/38-118-DRYQVVTQH..RPGE------------------------LVLQ..DT.G..LG...YSRS----AHVV-----------
F2K7Z3_PSEBN/38-119-DRFQVIHQH..EVGE------------------------LIFD..PD.Y..LGG...PRS----HDFV-----------
D3EB59_GEOS4/38-114-KKFHRFFPM..SRED------------------------FYFP..D...........GRT----DRYT-----------
F2EZE5_PANAA/38-122-DCFQFFDCY..DAHS------------------------RIFD..RH.Y..LCGAEAGRS----NDFL-----------
E3E492_PAEPS/38-118-DRYQIVHEH..PADH------------------------MIIE..DT.G..LG...FNRT----DSLV-----------
B9J9P6_AGRRK/38-119-DRFQAFHQL..EPNE------------------------LIFD..RT.Y..LGG...PRS----DDYV-----------
E8VEI5_BACST/38-118-DRYQIVHEH..PENH------------------------MIIE..DT.G..LG...FNRT----KNLV-----------
E1SCB2_PANVC/38-118-DRYQIVQEN..KRYQ------------------------MVFQ..DT.G..LG...FSRS----DNLV-----------
B5XPI5_KLEP3/38-118-DRYQIVHEN..KAHH------------------------MVID..DT.G..LG...LTRT----RDLV-----------
Q8YNJ7_NOSS1/38-114-KRFHRFFPL..DKLD------------------------FYYP..S...........DRT----DNYL-----------
C3H1D6_BACTU/49-133-DYFQMFLPY..PSHQ------------------------LFYN..SS.Y..LLEGSLKRS----NNMI-----------
B7VTJ1_VIBSL/38-114-KRAHRFVPL..ERDD------------------------FFYP..E...........GRT----EAYT-----------
B4SSI5_STRM5/38-119-DCFQVFHQC..DPGE------------------------LVFD..PD.Y..AGG...PRS----EGFV-----------
C7KKW6_ACEPA/38-118-DRYQIVSEH..DANH------------------------MVIE..DT.G..LD...IPRT----DKFV-----------
E3ZHI6_LISIV/38-121-DSFQLWVST..DATA------------------------NFVD..AH.Y..LLPT.GKRN----NEFL-----------
E0U1E6_BACPZ/38-119-DYFQVIRQY..ENNE------------------------FFYD..PS.Y..LQ...VERT----DELI-----------
A7HF13_ANADF/38-119-DRFQLVTEH..PAAG------------------------LIYD..PA.Y..LD...VART----DDLV-----------
D0SN89_ACIJU/38-115-DKHIRFFAH..LPHR------------------------FACP..PH.........QDQP----EFYT-----------
C3A4Q6_BACMY/39-123-DYFQIFLPY..QQNQ------------------------FLYN..PY.Y..LLERGEMRT----ENMI-----------
Q2IWE1_RHOP2/38-119-DRFVVVSEH..GAAD------------------------FQFS..KT.Y..MD...IARS----DDLV-----------
B4ULN4_ANASK/38-119-DRFQVIAGH..GDEG------------------------LSIA..PS.Y..LG...IDHG----EDVV-----------
C6CT61_PAESJ/39-119-DYFQVFHGH..KPGE------------------------FYYD..PA.Y..LN...VSRT----DRLL-----------
B8IW24_METNO/38-118-DRYQIVHEH..PAAH------------------------LVVE..DT.G..LG...IPRT----DKRV-----------
B8N5I4_ASPFN/39-119-DRYQIITQH..EPYE------------------------LICE..DT.N..LG...MERS----NKLV-----------
A4SIM9_AERS4/38-119-DKFQILEAL..PAKA------------------------LVYH..PH.Y..QTG...RRD----GDFI-----------
B8ELY1_METSB/38-118-DRYQIVQEH..PASR------------------------MIIE..DT.G..LG...FART----AKVV-----------
C4F042_HAEIF/36-112-KHAIRFLCL..EKED------------------------FYYP..F...........DRS----DDYT-----------
D8IRK4_HERSS/38-119-DRFMVITEH..DPEE------------------------LIFS..RS.Y..MG...MART----DDFV-----------
E0LSD4_9ENTR/38-119-DCFQVIEML..PACQ------------------------RVFD..IH.Y..LSG...GRS----DNFV-----------
A1TZC6_MARAV/36-112-KRAHRFIPM..EAED------------------------FYYP..G...........GRT----PAYT-----------
E1TGD7_BURSG/38-119-DVFMLITEH..DAAN------------------------FVYD..SQ.Y..LN...VART----DDLV-----------
D3RFU8_KLEVT/38-119-DKFQFIEQA..ADEQ------------------------RIYD..PN.Y..LSD...GRS----ARFV-----------
E8XXC7_RAHSY/38-119-DKFIVISEH..SPAE------------------------MMIS..PD.Y..LN...IQRS----PNCI-----------
A7Z5L4_BACA2/38-118-DRYQIVHQH..RPHE------------------------LIIE..DT.G..LG...FKRS----KDLV-----------
C3AIG8_BACMY/39-123-DYFHMFLPY..PPNH------------------------FFYD..PH.Y..LLEEEKKRT----DKMI-----------
C1F200_ACIC5/38-118-DLFVVLTAH..AEGE------------------------MVVD..PH.F..MG...VTRT----KDFV-----------
C5APP6_METEA/38-118-DRYQIVTEH..KPSR------------------------MIVE..DT.G..LD...IPRT----RNVV-----------
A3JZH5_9RHOB/38-118-DRYQIVHEH..KPGR------------------------MVFL..DT.G..LG...FTRS----DQMI-----------
C2CZD0_LACBR/38-118-DRYQIVTQH..EPYE------------------------MPVL..DT.G..LG...IKRT----DRVI-----------
Q21G56_SACD2/36-112-KRAHRFMPM..DKAD------------------------FYYP..G...........GRT----DAYT-----------
YOLI_BACSU/38-118-DRYQIVHQH..PANE------------------------LIIQ..DA.G..LG...FQRT----KDMV-----------
C7QGF3_CATAD/38-119-DDFQLIHEL..EPSA------------------------MVFP..RD.F..RG...GPRS----RDWT-----------
Q1N6A6_9GAMM/36-112-KRAHRIVPL..ERED------------------------FYYP..G...........GRS----DAYT-----------
D7C3V5_STRBB/37-119-DRFQVLTGHDGVGST------------------------LRYD..N..Y..LG...IRRD----DGIV-----------
D9UVM6_9ACTO/38-119-DRFQIMNSH..APGR------------------------LRYD..PS.Y..FG...VQRD----DDIV-----------
E3HV63_ACHXA/38-119-DQFMTMTEH..DASN------------------------FRYS..PT.Y..MD...VARS----DDLV-----------
E0RDQ5_PAEP6/39-120-DYFQAFHAH..KQSE------------------------FYYS..PD.Y..LN...VPRT----DKLL-----------
B6R495_9RHOB/38-118-DDFTLVSRY..EPED------------------------MMFH..PT.F..LG...NRDP----KATI-----------
B8HDC6_ARTCA/38-118-DYFHILTEH..PAGQ------------------------IFAQ..DA.G..LG...FERT----GGVV-----------
E2SUT1_9RALS/38-119-DRFMTLTEH..DAST------------------------FSVS..PT.Y..FG...IARS----DDVV-----------
A8GBS4_SERP5/38-119-DKFQAIDQY..RPGE------------------------LIYD..RD.Y..LGG...PRS----ADYV-----------
E8X4V4_ACISM/38-119-DRFMIIGEH..APDN------------------------FVFD..PN.F..LN...IKRT----PDLI-----------
D8MPE1_ERWBE/38-119-DRFQVFEEL..PARL------------------------RVFD..RH.Y..KSG...GRS----DNFI-----------
Q12G69_POLSJ/38-119-DQFMSISEH..DAAN------------------------FRYG..AS.Y..LG...VARS----DDLV-----------
Q1ZUX9_PHOAS/38-121-DCFQIFDIH..APQQ------------------------KVFN..SN.YPNLAQ...SRS----ESGI-----------
A1R659_ARTAT/38-118-DYFHILTEH..PQGQ------------------------IVAQ..DA.G..LG...FERS----SAVV-----------
A0AJN8_LISW6/38-121-DTFQIWIPT..NPAF------------------------HFID..EN.Y..LLTH.GKRN----DMFM-----------
B2FR97_STRMK/37-118-DRFQIFQQH..DAGT------------------------LIYD..PG.Y..LG...VDRT----DDFI-----------
E6WK69_PANSA/38-119-DRFQLIESL..PAAR------------------------FIYD..RH.Y..LSG...GRS----DRYV-----------
Q5FTM0_GLUOX/38-118-DRYQIVYEH..RKSR------------------------VRIE..DT.G..LG...IPRT----DDVM-----------
D3P7K3_AZOS1/38-119-DRFVAIHQH..RPEE------------------------LIFD..RT.Y..RGG...PRS----DDYI-----------
E6KXS2_9PAST/36-114-KHALRFICL..EDDD------------------------FYYPHTT...........NRT----DNYM-----------
B1MEJ6_MYCA9/38-118-DRFQIITAH..DAGD------------------------IIAE..DA.G..LG...FRRS----RSVV-----------
Q03TL7_LACBA/38-118-DRYQVVTQH..EPEE------------------------MVIE..DV.G..LG...LPRS----TKFL-----------
D3Q817_STANL/38-115-DRNVRLIVH..EPHR------------------------FACS..PR.........HTLP----EFYT-----------
E6PQC8_9ZZZZ/10-91-DRLQVFHQL..APDE------------------------LVFD..RH.Y..LCG...PRS----DDYV-----------
D5WEQ4_BURSC/38-119-DMFMLISEH..TADN------------------------MIYD..RQ.Y..LN...IERG----DDLV-----------
Q12CT9_POLSJ/38-113-TTMIRLFVH..EPHR------------------------FVGP..P...........DKG----DQYT-----------
E6U1F8_BACCJ/38-114-KKFHRFFPM..EKED------------------------FYYG..E...........GRT----EAYT-----------
E3E9I4_PAEPS/38-114-KRFHRFFPM..NHED------------------------FIYA..D...........GRS----EAYT-----------
Q1IHI2_KORVE/38-119-DRFEIINEV..EPDD------------------------FTFS..PT.Y..LG...IERT----DEGM-----------
E6UZN9_VARPE/38-119-DKFQVITRH..AAQD------------------------LVHP..KS.Y..LG...VEYS----AGFV-----------
D3UP74_LISSS/38-121-DTFQLWIAT..DSAA------------------------NFVN..PN.Y..LLTS.EKRN----SNFI-----------
Q1MBY6_RHIL3/38-119-DRFLAIHQH..DERE------------------------LIFD..RS.Y..LGG...PRS----DNFV-----------
D2B2C9_STRRD/38-113-KRFHRFLLL..DAED------------------------LVCP..............QRS----ERYL-----------
D1RZN5_SEROD/38-118-DRYQIVHEN..KAHH------------------------MVIE..DT.G..LN...LTRT----RDLV-----------
B1YJI0_EXIS2/38-118-DRYQIVHTH..KANE------------------------MIIE..DT.G..LG...LTRS----NQVV-----------
Q9K3M3_STRCO/39-121-DRFQVLTAHDAARGT------------------------LRYD..D..Y..PG...VRRD----AGIV-----------
B8MDG5_TALSN/39-119-DRYQIITQH..EDYE------------------------LICE..DT.N..LG...FSRS----KDLV-----------
F2JUJ3_MARM1/38-122-DQFHIIHKL..DRTQ------------------------RTIN..TS.Y..AMPKGKQRS----NDWI-----------
A2P9R5_VIBCL/36-112-KRAHRFIPL..DKRD------------------------FYYP..S...........GRS----DAYT-----------
Q2BGH4_9GAMM/36-112-KRAHRFIPM..EADD------------------------FYYP..G...........GRT----DAYT-----------
D5E1U6_BACMQ/39-123-DYFQLFLPY..PSQH------------------------FFYD..SQ.Y..LLERGEKRT----DNMI-----------
C5A915_BURGB/38-119-DRFQLVHQH..ERDE------------------------LIYD..AD.Y..LGI...RRS----DDLV-----------
E6VM91_RHOPX/38-118-DQFITLTEH..APAN------------------------FRFG..NA.Y...G...VARS----ADLV-----------
B8EMJ0_METSB/38-119-DRFQIIAEH..ADND------------------------FIID..RT.Y..LG...IERT----DDVI-----------
A7GPJ3_BACCN/39-123-DYFQMFFPY..SSNR------------------------FFYD..SD.Y..LLEGEEKRT----ENMM-----------
C0VL22_9GAMM/64-140-KKFQRFIPM..EPEN------------------------FVYP..D...........DRS----DHYV-----------
A5CMA6_CLAM3/38-118-DRFQIVTEH..APGR------------------------LTAL..DV.G..LG...IERS----EQVV-----------
C3JW70_RHOER/39-119-DRYQIITEH..QPHQ------------------------IIVE..DT.G..LG...FDRT----DDVV-----------
Q9L029_STRCO/38-117-DQFHVFHEV..TDDN------------------------FVMQ..PVVF......GLRRT----SRTL-----------
E2P255_PASHA/36-112-RHALRFDLL..DAEN------------------------FYPP..I...........NRS----QDFI-----------
F0P364_STAPE/38-118-DRYQIVTQH..EAYE------------------------MQIL..DT.G..LG...VERT----TDVL-----------
A9IL59_BORPD/38-119-DRFQVITEH..DPEM------------------------FIFD..PS.Y..LG...IARS----ADCI-----------
Q9EV83_PSEPV/38-118-DRYQTVSQH..RPGE------------------------MVLE..DT.G..LG...YGRS----SAVV-----------
A9ISV8_BORPD/38-119-DQFMTVSEH..DATN------------------------FRYG..AS.Y..LD...VARS----DNLV-----------
C8YX84_9GAMM/38-113-DRYQVINEC..EADH------------------------LQLQ..............TRA----EDRV-----------
B4WFG2_9SYNE/38-114-KRFQRFYPL..DAEN------------------------FYYP..K...........SCS----SRYT-----------
A1K821_AZOSB/38-119-NQFMTIHEH..APGN------------------------FRYG..PS.Y..LG...IQRS----DDLL-----------
B0T974_CAUSK/38-120-DMFQIIEQL..EPGS------------------------LIFD..RNFG..VK...RPRS----DDFM-----------
D4YHW3_9LACT/38-119-DKFVIVNDL..KAEE------------------------LIFS..TN.Y..LD...VDRT----EGIV-----------
D9WAV5_9ACTO/38-118-DRFQIVTEH..DADH------------------------VIAL..DA.G..LG...FDRS----DRLV-----------
D5UG10_CELFN/38-112-KRFHRFLLL..DDED------------------------LVAP...............RS----PEYL-----------
A9C379_DELAS/38-119-DQFMTITEH..DGDN------------------------FRYS..AS.Y..LG...VARS----DDLV-----------
A9VV21_BACWK/39-123-DYFQLFLPY..PPNQ------------------------FYYD..PH.Y..LLEGEEKRT----EKIM-----------
D8MX59_ERWBE/38-118-DRYQIVHEN..KAYQ------------------------MVFE..DT.G..LG...LTRT----DNLV-----------
D1AMD1_SEBTE/38-122-DIFHIWLPF..NAAD------------------------SKID..SY.Y..VLSEGKKRS----DSFL-----------
Q3KAR7_PSEPF/38-119-DNFQVLAEH..DDQH------------------------FVYD..PQ.Y..LG...IKRS----DGIV-----------
Q1I8I7_PSEE4/38-119-DNFQVLTEH..DDDR------------------------LVND..RE.Y..LG...IPRT----ERQV-----------
A7Z8K4_BACA2/39-120-DYFQVVHQH..EKGE------------------------FFYD..PS.Y..LQ...VERS----DELM-----------
Q89DY8_BRAJA/38-118-DEFMTISEH..DPAN------------------------FRCG..NA.Y...G...VERS----EDAV-----------
D2BTM6_DICD5/38-119-DRFQVIEER..PAGM------------------------LHYA..SH.Y..QAG...TRS----ERYT-----------
Q6FAM7_ACIAD/38-114-KCFQRFIVM..EQDN------------------------YIYP..N...........DRS----HFYT-----------
E8XR93_RAHSY/38-122-DCFQLFEPV..SRHQ------------------------RVIN..PT.Y..LAGENDRRS----DDFL-----------
D2S6L3_GEOOG/39-119-DRYQVITEH..RPGQ------------------------IICE..DT.G..LG...IERT----DDLV-----------
D2BWC8_DICD5/39-120-DRFIIISEH..KDDE------------------------FFIH..PT......FPDMKRS----DKRM-----------
D5DA95_BACMD/38-118-DRYQIVHQH..PAHE------------------------MIIE..DT.G..LG...FERS----KDLV-----------
Q65NT7_BACLD/38-118-DYFQVITQH..DEEE------------------------FFFD..PS.Y..MN...IKRT----KDLI-----------
D7DPH6_METS0/38-113-DRYQIIHQL..DPEC------------------------LQLQ..............TRE----GDLV-----------
Q7NSY2_CHRVO/38-119-DRFQLIHQH..EPGE------------------------MIFD..RD.Y..AGG...PRS----GDFT-----------
B2IF75_BEII9/38-119-DRFMILTEH..EKND------------------------FVYG..AD.Y..LG...INRD----DDLV-----------
B1LS78_METRJ/38-119-DRFHLIHQH..APDE------------------------LIYD..SE.Y..LGL...HRT----DDVV-----------
A4FIQ5_SACEN/38-118-DRFQVISEH..EPGR------------------------VIAQ..DA.G..LG...FQRS----DALV-----------
A0NS28_9RHOB/49-130-DKFMMITEH..ARED------------------------FLFG..RH.F..MN...IDRS----DDLI-----------
D0RZI0_ACICA/36-118-DCFHIFEQI..PQGQ------------------------VFVD..HDYW..VK...TART----EKFI-----------
F0TAP2_METSL/38-114-KIVQRLYEI..SEET------------------------CTIP.............SDRS----KNLT-----------
A5EML5_BRASB/38-118-DQFMIITEH..DPSN------------------------FRYG..NA.F...D...VNRS----DDLV-----------
A2SJ61_METPP/38-119-DKFQIIARH..GQGE------------------------LVFP..AS.Y..LG...VEYS----PGIV-----------
D7WQM9_9BACI/38-114-KKFHRFFPM..DKED------------------------FYFA..S...........ERT----ESYT-----------
A5GTW6_SYNR3/38-118-GGFYLISER..PQSR------------------------MRID..RTMW......GIERS----SHPP-----------
D8JU73_HYPDA/38-118-DRYQVVHEH..DAST------------------------LIAE..DT.G..LD...IPRT----DKFV-----------
B9XKA7_9BACT/38-119-DRFIVIGEH..SPDN------------------------LIYD..PK.F..LG...CDRS----PNFL-----------
E0I4N7_9BACL/39-120-DCFQVFHAH..RASE------------------------FFYS..RH.Y..LN...IERT----DGLL-----------
B4APB2_BACPU/39-121-DYFQVFSSH..KKDE------------------------FFYD..PH.Y..LLR..HERD----HRLL-----------
B2J5J2_NOSP7/38-114-KRFHRFFPL..DKSD------------------------FYYP..S...........DRT----NNYL-----------
Q28PN6_JANSC/38-118-DYFCLIARY..APDD------------------------MILH..PT.Y..LG...QRDA----AQTI-----------
E5VQA7_9FIRM/38-118-DRYQIVSQH..DPEE------------------------MILL..DT.G..LG...FERT----KDQI-----------
F2Z288_9CORY/37-117-DRFQILTAH..DPSD------------------------IIAE..DA.G..LG...FQRS----PSVV-----------
Q215U6_RHOPB/37-112-DRDITVDVY..DATR------------------------RAVP..T...........GKS----DRFT-----------
D0L5B9_GORB4/39-119-DRYQIITEH..KPGR------------------------IILE..DT.G..LG...FDRT----DDAV-----------
Q1ZAF8_PHOPR/38-121-DCFQMFDVH..SPQQ------------------------KVFN..QY.YPNLTQ...GRS----KFGA-----------
Q393L4_BURS3/38-119-DIFMVVTEH..AAEN------------------------FVFG..RH.Y..LD...IERS----DDLV-----------
A9F6T6_SORC5/38-114-KRAHRFFPM..ERED------------------------MLAP..G...........GRT----DAYT-----------
A7IDV7_XANP2/38-118-DQFMTISEH..APGN------------------------FRHG..TA.Y...G...VQRG----DDLV-----------
B3PZS7_RHIE6/38-116-DRFQTIHQH..DEHE------------------------LIFD..RN.Y..LAG...PRS----DDFV-----------
Q11ST9_CYTH3/38-114-KKAHRFIYI..DDDS------------------------YFYF..E...........TRT----RKHT-----------
D1BU80_XYLCX/38-112-KRFHRFLLV..DDDD------------------------LVAP...............RA----ASYL-----------
A6Q8U6_SULNB/38-114-KRFHRFFPM..KAED------------------------MLFS..E...........DRS----SAYT-----------
A8IN35_AZOC5/50-131-DRFQIFHQH..QPGE------------------------LVFD..RD.Y..GGG...PRS----AGFV-----------
B6R0J0_9RHOB/38-118-NQFMVITEH..TSAN------------------------FRFG..AS.Y..LN...IARS----EDLV-----------
C6D8V6_PECCP/38-119-DRFQIFETL..PAGQ------------------------RIFD..RH.Y..KSG...GRS----DDFI-----------
F2LDE3_BURGS/38-120-DKFQIISRH..APDE------------------------LVYP..AEGY..LG...VDYT----PGIV-----------
C5BKG7_TERTT/36-112-KRAHRFVHL..AEED------------------------FYYP..G...........GRS----SAYT-----------

PF01361

Y2002_DICD3/2-62--------------------------------------------------------------------P-----------
YWHB_BACSU/2-61--------------------------------------------------------------------P-----------
Y574_LACLA/2-61--------------------------------------------------------------------P-----------
Y3814_BACHD/2-61--------------------------------------------------------------------P-----------
Y270_CAMJE/2-62--------------------------------------------------------------------P-----------
4OT_PSEST/2-61--------------------------------------------------------------------P-----------
Y924_HELPY/2-64--------------------------------------------------------------------P-----------
Y921_STRR6/2-60--------------------------------------------------------------------P-----------
Y1725_XYLFA/2-61--------------------------------------------------------------------P-----------
YRDN_BACSU/2-61--------------------------------------------------------------------P-----------
4OT_PSEUF/2-61--------------------------------------------------------------------P-----------
PPTA_ECOLI/2-58--------------------------------------------------------------------P-----------
Y1363_STAAM/2-61--------------------------------------------------------------------P-----------
4OT_COMTE/2-61--------------------------------------------------------------------P-----------
Q9EVV8_STRTR/2-61--------------------------------------------------------------------P-----------
O29588_ARCFU/2-60--------------------------------------------------------------------P-----------
O27643_METTH/2-60--------------------------------------------------------------------P-----------
Q9K3M3_STRCO/2-63--------------------------------------------------------------------P-----------
Q9L0G0_STRCO/2-63--------------------------------------------------------------------P-----------
Q9EV85_PSEPV/2-61--------------------------------------------------------------------P-----------
Q9L029_STRCO/2-61--------------------------------------------------------------------P-----------
Q9EV84_PSEPV/2-61--------------------------------------------------------------------P-----------
Q98JE6_RHILO/2-63--------------------------------------------------------------------P-----------
Q984V7_RHILO/2-61--------------------------------------------------------------------P-----------
O85975_SPHAR/2-61--------------------------------------------------------------------P-----------
Q9A468_CAUCR/2-62--------------------------------------------------------------------P-----------
Q98EB0_RHILO/2-65--------------------------------------------------------------------P-----------
Q9R9T3_PSEPU/2-61--------------------------------------------------------------------P-----------

PF14832

B0XZS0_ASPFC/1-136MPRWLIQHSPNTLT.P.E.EKSHLAQQITQAY........VGF.GLPAFYVQVHFIEQPAG..-.TSFIGGEQHPN....
A1CC92_ASPCL/1-136MPRWLIQHSPNTLT.P.E.EKATLASEITKIY........TRV.GLPAFYVQVHYVEMPPS..-.TAFIGGEPHPN....
E3RF02_PYRTT/1-154MPLWLIYHAPSTFTTP.Q.TKQALAASITEIY........LAA.GLPAFYVNVLFQPVEPT..-.SFYVGGVARPATGGE
B8NVG2_ASPFN/1-142MPLWQIYHPPGTFTTS.T.EKEAFSKAITENY........TFV.GLPAFYVVVQFHELDPE..-.NVFVGGDQRSKTA..
Q0SD71_RHOSR/1-153MPLWQLFTPKNAYT.K.E.EKADLAKKISDIYSGPTSKGNFGF.ELPRFYTTVVFHEIEAD..-.SFFVGGQSHDK....
A9C0U3_DELAS/29-162MPLWKIYHPENAFS.D.E.DKQAIAQRITAVY........C...DLPRFYVGVVFEAVART..-.SFFIGGEPADD....
A5ELU6_BRASB/1-136MPFWKIYHPVGAFT.A.E.DKRALSERITGCY........R...GLPKFYVIVVFQEVAPD..-.SFYKGGEEASN....
A6SK63_BOTFB/1-138MPLWIIHHPKHVFD.D.ENSKKSLSQDITKLY........TDV.GLPAFYVVIVFTEVSDV..-.NMYVGGDQATT....
B1MJZ2_MYCA9/1-136MPLWTIYHTPNIFT.D.K.EKTELANSITEVY........TAV.GLPRFYVITVFKQIEPA..-.DLYVGGEQTDS....
B6HS40_PENCW/1-136MPTWDIKHSPNTIT.A.A.EKEQLAKSITSLY........VSR.GLPAFYVQVHFSEDIPG..-.TAFVGGEPHAS....
B6HI01_PENCW/1-140MPLWLIFHPPGTFEDA.S.SKQALAKDVMKIY........TGI.GLPPFYVVVNFIKLSTE..-.DIWVGGERRTEN...
Q0U6R6_PHANO/1-142MPLWLIFHPDGTFE.D.DISKEALAADITKIY........TSV.GLPAFYVVTNFIKMPGN..-.TMLVGGKKLDKED..
Q0BSZ1_GRABC/1-135MPMWQIYHPESVFS.E.S.DKQELAGKITAIY........ESF..LPRFYVNVFFHSIPKD..-.GLFIGGEVAND....
Q0CF32_ASPTN/1-140MPLWLIFHTPNTFE.DVG.SKQALVEDVTKIY........TNF.GLPPFYVVVNFIRLSGE..-.DVWVGGERRTAR...
A2QYI6_ASPNC/521-660MPLWLIYHPSGTFE.DTA.SKKALTEDITKLY........TRI.GLPAFYVVINFMKLPPG..-.DTWVGAENRTEK...
E3Q5I4_COLGM/1-139MPLWLIYHPDGTFEDD.A.SKGAFAADITKFY........TQV.GLPAFYVVVNFVKMSES..-.TVWIGGEKPKE....
Q398P0_BURS3/1-135MPLWNIYHPEHTYT.D.A.DKLEIAGRIVGFY........DGF..LPRFYVNVLFQPLPSA..-.SFLIGGKPTDD....
D5WHW6_BURSC/1-134MPLWNIYHPVGAYT.A.E.DKQEMAKRIVDIY........I....IPRFYVGVLFHEQPKD..-.SFFMGGESRGD....
D9VBZ9_9ACTO/1-137MPLWTIHHTPDLFS.A.A.EKHDLASRVADHY........EAI.GLPRFYAVTVFQEARPE..-.NFYVGGKPVEA....
Q0U745_PHANO/1-144MPDWRIYYPSGTFTEP.E.EREKLSQDITSIY........TRY.GLPAFYVVVLFIEMPAA..-.TIFRAGLPCPMKG..
E9F5N7_METAR/39-184MPYWNIYHPDDVLRDD.A.EKDAIAKAITEIY........TAI.PLPAFYVGVFFFPMPRN..-.EIYRGGQPQASSSA.
B6QU03_PENMQ/1-138MPYWKIYHSPNTLT.E.E.DKTTLSASITSYY........TSV.GLPAFYVNIFYLPLASS..-.DFFVGGKPVSK....
Q0SD79_RHOSR/1-135MPFWRIHHPVGAYT.D.Q.DKEDFAKAITARY........A.A.EMPAFYCDVFFYEVEKR..-.NAFRGGEAVDN....
E9F263_METAR/1-138MPLWKIYHSADAFTTQ.E.EKDAVARGATEFY........VSK.GLPSFYVHVIFFPIATE..-.NKFTGGTPQSR....
Q4P6H1_USTMA/1-145MPLHRIYAPPGLFS.K.D.EKRELVSSIADMY........IGV.GLPAFLVITLFCPIDGE..-EDFFIGKQSHAERAQS
C7YJ99_NECH7/1-141MPLYEFHHIL.PLT.G.A.EKSRIARLITDWH........ATTFKAPRFIVNCRFIDIRASNI-EDFWVGGRQLKT....

PF08921

A3H1V4_VIBCL/1-106MPHLRFRAVEAHIVESLVPTLLNELSSL------------LSTARNAFTFELINTQYFAEGGV-...YP-----------
A8FVM5_SHESH/1-109MPHIRMRGLPEAAVAELSKTLLERLADI------------CEVNSQGFTLDWIPSVGYRNGSA-DQSFT-----------
Q8EEJ0_SHEON/1-109MPHISMRGLPQAVVAELSQTLLQSLAAI------------CKGKAESFTLDWIPSISYRNGRI-DQRFV-----------
A6D726_9VIBR/1-109MPHLRFRAIEPELVKTLSSPLVDELQPL------------MDCPKEDFTVEHIASTFYFDNKV-THAYP-----------
Q6F289_MESFL/1-104MPILKFNGTTEEKVKEYSKK.INEIADL------------IVSKPEAILMMVNNNNIFVAKNT-NKRI.-----------
A6ATB3_VIBHA/1-109MPHLRFRAVEPQTVQALSKPLTDELQPL------------MDCPREDFTFEYIYTTFFSEGEV-SSAYP-----------
A4SQR6_AERS4/1-109MPHLRFRAVSVDTLQQISTPLLAELCAL------------TGGKPEFVTLECVDSSWVRNGAI-EAGFP-----------
A8H4B7_SHEPA/1-109MPHIRVSGIPEAAVATLSIDLLKALADI------------CQAKPESFILDWINSNSYRDGDQ-IKDIA-----------
A9VL18_BACWK/1-107MPHVVFRGITIEQLKSISKPLVEELADI------------CECGTDNFTLELPSSTFVFNGEE-IEAFP-----------
Q188J0_CLOD6/1-108MPQIKIRGINENDICKISEKMINDLVEA------------VKCPRDYFEIECIKSVAIRDGKI-ADVYP-----------
B1KF64_SHEWM/1-109MPHIRLRGLPEAAVIDLSRTLLHDLAKI------------CNVNQQAFTLDWVSSVSYRDGMR-ELSTT-----------
Q39YS1_GEOMG/1-102MPYLRFKGFDEGFLRKLGPLVVEEFSRV------------AVVPPEVVKIELLNIVQITATPR-S....-----------
A5TWA0_FUSNP/1-108MPHLKIRGIEKNLIVENSKEIIDELTKI------------IACDRNWFTIEHQNTEYIFDGKI-VDGYT-----------
Q1ZJL0_PHOAS/1-110MPHLRFRAVEFDAVKTLSTELVDELQPL------------MSCPREDFTLEHIPASFIFDGEV-SDAYP-----------
Q2SR33_MYCCT/1-99MPIIKFSGLEKDQVNQFSKN.IEKIADL------------VKADPKNIFVVWENSEIFISESN-ANPI.-----------
A1S6E5_SHEAM/1-107MPHLRIRGLASDAVARLSRELPARLAAI------------TATEVSSYTMEWIPSQFFQQGEA-CQPLV-----------
Q6MPG9_BDEBA/5-112MPHIRMRAVKKEHVQLLSDSLAKELAPA------------MKTPVDNFTFELVQTQFFSGGQQ-TDSYP-----------
A3QED2_SHELP/1-109MPHIRMRGLPQEAVCRISETLLDELANL------------CQIKAESFTLDWEPSVSYRAGKV-DTTFV-----------
A4J4K9_DESRM/1-107MPQIIIRGIEPKKIMPISNDLISNLEKI------------IGCPREDLTLECIPSIFVKDGSI-DAGYP-----------
A6W1J4_MARMS/1-109MPHLRVRGLAFDELESIADILIENLAEI------------TDTPNSHFTLEYQATTYLAVGGA-SPAYP-----------

PF01187

MIFH_BRUMA/2-115-PYFTIDTNI--PQNSISSAFLKKASNVVAKA--------LGKPESYVSIHVNGGQAMVFGGS-EDPCA-----------
MIF_BOVIN/2-115-PMFVVNTNV--PRASVPDGLLSELTQQLAQA--------TGKPAQYIAVHVVPDQLMTFGGS-SEPCA-----------
DOPD_RAT/2-116-PFVELETNL--PASRIPAGLENRLCAATATI--------LDKPEDRVSVTIRPGMTLLMNKS-TEPCA-----------
DOPD_HUMAN/2-116-PFLELDTNL--PANRVPAGLEKRLCAAAASI--------LGKPADRVNVTVRPGLAMALSGS-TEPCA-----------
MIF_CHICK/2-115-PMFTIHTNV--CKDAVPDSLLGELTQQLAKA--------TGKPAQYIAVHIVPDQMMSFGGS-TDPCA-----------
MIF2_CAEEL/2-115-PMVRVATNL--PNEKVPVDFEIRLTDLLARS--------MGKPRERIAVEIAAGARLVHGAT-HDPVT-----------

PF02962

HPCD_ECOLX/2-125-PHFIVECSDNIREEADLPGLFAKVNPTLAAT.GI-----FPLAGIRSRVHWVDTWQMADGQH.DYASV-----------
Q9RE14_KLEPN/2-125-PHFFAECTDKIREQGDLPDLFSKVKDALAAS.GI-----FPIGGICSRAHWLDTWQMADGQH.DYAFV-----------
Q9RYT1_DEIRA/2-126-PHLTLEYTDNLPEP.RIPELLQKLNGVLLARPDI-----FPVGGIRARAYRLSEYALADSSEPSDAFV-----------

PF14552

D6JQ64_ACIG3/38-114-------------IIELSMF---AGR-------------SAAT--KKQLIQ-TLFRNIQEQC---RI-S-PQDIEITIFE
B7HN80_BACC7/39-123-------------YVSITCG---PGR-------------TIKQ--KSDLYQ-SISSKVFECS---SI-K-SADIFITLNE
D1BFT0_SANKS/38-113-------------VVQVVAF---AGR-------------SQPA--RRELIR-QLYVRVCGRF---DL-P-LDDLEIVIIE
D4E924_SEROD/38-119-------------LFYITVG---RAR-------------TAAT--KQRFYQ-RLAALLQQNL---QL-S-PQDVMVVVVS
E8Y1J8_RAHSY/38-118-------------LLTVVSR---.PR-------------RQEQ--KTEFYR-LLAEKLQAAC---GL-S-PDDLIVSLVE
F2K7Z3_PSEBN/38-119-------------LITITAG---RPR-------------SVET--KQRFYR-DLVEKLRRAP---GL-D-AEDVMVVITT
D3EB59_GEOS4/38-114-------------VIEISIF---EGR-------------TVEA--KKQLIR-LLFERIQQTL---HV-S-SQDVEITIFE
F2EZE5_PANAA/38-122-------------LFTITAG---KTR-------------NTQQ--KQAFYQ-DLTRRLEKSM---GI-K-PHDVMIVLHF
E3E492_PAEPS/38-118-------------ILSIISK---.AR-------------PKEK--KQKLYS-LLAERLEAEC---GI-A-PTDLMVSIVE
B9J9P6_AGRRK/38-119-------------FFHITIG---KPR-------------STEV--KKAFYR-RLVTLLADAP---GV-R-PEDIMINIIT
E8VEI5_BACST/38-118-------------VLSVTSK---.SR-------------PEEK--KQKFYR-LLAERLESEC---GI-A-STDLIVSIVE
E1SCB2_PANVC/38-118-------------MVRVYTS---.PR-------------SREQ--KQHFMA-ELARELREHC---GV-Q-GNDLMISFIT
B5XPI5_KLEP3/38-118-------------VVRVYTS---.PR-------------SEAQ--KQRFFA-LLQEELAEHC---GL-S-GDDVMVSIIS
Q8YNJ7_NOSS1/38-114-------------IIEIIMF---EGR-------------SVET--KKQLLR-DIFKKVDEKF---GI-S-VYDIEITLFE
C3H1D6_BACTU/49-133-------------YVSITCG---PGR-------------TINQ--KKDLYK-AIATSTANIL---QI-S-TADVFITLHE
B7VTJ1_VIBSL/38-114-------------VIEINMM---EGR-------------AVNT--KKRLIK-KIFSEIEKQL---AI-S-PIDIEITIKE
B4SSI5_STRM5/38-119-------------LIHLTAG---RVR-------------SAAR--KQSFYA-RLVQRLAASP---GI-R-PEDVMIVIGT
C7KKW6_ACEPA/38-118-------------LLQVTSR---.PR-------------SKEQ--FAEFYR-LLAEALQQKC---GI-E-SSDLMVSVVE
E3ZHI6_LISIV/38-121-------------YLEIFCG---PGR-------------SIEQ--KRSLYQ-TIVAQMEQAT---SL-S-KQNIFILLNE
E0U1E6_BACPZ/38-119-------------YIHFTLK---QSR-------------TTEQ--KRALYR-SIASRIHSEL---GV-R-KEDVFIMLAG
A7HF13_ANADF/38-119-------------VVQITLN---AGR-------------TTEM--KKALYA-RIAELLAESP---GV-R-REDVLVSLVE
D0SN89_ACIJU/38-115-------------QISIDAF---AGR-------------SVDA--KRNLYQ-GIVNNLEL.L---GI-P-PKYVTIIIRD
C3A4Q6_BACMY/39-123-------------HVSITCG---PGR-------------TVQQ--KKGLYQ-SISFEISACS---NV-K-VTDIFITLHE
Q2IWE1_RHOP2/38-119-------------IIQITVS---NTR-------------NVAQ--KQALYA-RIAELLAREP---GV-R-GEDVFINLIE
B4ULN4_ANASK/38-119-------------VVQITAN---AGR-------------TVDM--KRALFR-RIADDLHAAV---GV-R-REDVIVSLVE
C6CT61_PAESJ/39-119-------------YVQITLK---SGR-------------TEEQ--KRGFYA-RLAE.LLPAC---GV-R-AEDIFVVLVG
B8IW24_METNO/38-118-------------VLQVTTR---.PR-------------SREM--KETFYR-LLCENLQARC---GI-S-PTDVVVSMVS
B8N5I4_ASPFN/39-119-------------IIQILQQ---.GR-------------SAEQ--KLATYR-ALQERLFESC---GL-P-GEDLIISCAE
A4SIM9_AERS4/38-119-------------LFQILAG---RPR-------------STEV--KQRLYE-RLAERLHADM---DI-H-PDNLMVVIQL
B8ELY1_METSB/38-118-------------VVQVTTR---.PR-------------PRDQ--KVDFYA-RLARYLQERC---GI-D-PADLMVSCVE
C4F042_HAEIF/36-112-------------VIEINLM---AGR-------------MEGT--KKRLIK-MLFSELEYKL---GI-R-AHDVEITIKE
D8IRK4_HERSS/38-119-------------LIQLTVS---NTR-------------TQAQ--KNALYA-RIVERLQQDP---GI-A-PDDVMISLVE
E0LSD4_9ENTR/38-119-------------LFQVTAG---RPR-------------SRDQ--KQRFYH-ALCAALQVEM---AI-D-PDDVMIIIQF
A1TZC6_MARAV/36-112-------------AIEINMM---QGR-------------NPET--QKALIK-ELFNKIESVV---GI-S-PVDVEVTIKE
E1TGD7_BURSG/38-119-------------MIQITVS---NTR-------------TLEQ--KKALYQ-RMVDELHESP---GL-R-REDVLINLVE
D3RFU8_KLEVT/38-119-------------LFHIFAG---KPR-------------SRAQ--KQRLYR-RLCARLADEM---AV-S-PQDLMVVIQF
E8XXC7_RAHSY/38-119-------------VIQVTLN---TGR-------------TLEM--KKAFYH-AVAYGLHEKV---GL-R-LEDVFISLVE
A7Z5L4_BACA2/38-118-------------IISIVSK---.AR-------------TEHQ--KETLYQ-LMADQLKTEC---GI-S-PEDVMISITE
C3AIG8_BACMY/39-123-------------HVSITCG---PER-------------TIQQ--KRNLYQ-SISEAFYDHL---NI-S-TTNIFITLNE
C1F200_ACIC5/38-118-------------LVQITFR---.HR-------------PVEI--KQKLYA-EIASLLQQRA---GI-A-PDDVMIVITE
C5APP6_METEA/38-118-------------VVQMITR---.PR-------------GREK--KELFYR-LLTEKLQAAC---GI-A-PADVMVSTVE
A3JZH5_9RHOB/38-118-------------SIQFFTS---.PR-------------THVE--KMKVYK-LLAENLEHTC---GL-D-PNDLLISVFT
C2CZD0_LACBR/38-118-------------IFNLVTR---.PR-------------TTEQ--KQQFYQ-QLVDRLHEKL---GM-R-KEDIVVSLVV
Q21G56_SACD2/36-112-------------VIEINMM---AGR-------------KPET--QKALIK-AIFTNIEDQL---GM-A-PVDVEIVIKE
YOLI_BACSU/38-118-------------IISMTSK---.AR-------------TESQ--KEKLYA-LLAERLEKKC---EI-S-PDDLMVSITE
C7QGF3_CATAD/38-119-------------VIRITDG---LER-------------GPQA--KRRFYT-TLVRLLGADP---GI-D-PADVFVMMTL
Q1N6A6_9GAMM/36-112-------------VIEINMM---AGR-------------KPET--QKDLIK-AIFSEVESKL---GL-S-SVDVEITIKE
D7C3V5_STRBB/37-119-------------YIAITMR---SGR-------------TPAQ--KRALYR-RIAELAHAYA---GT-E-PRNVFIVLTE
D9UVM6_9ACTO/38-119-------------YIAITMR---AGR-------------TDEQ--KTALYR-RATELIAEST---GI-E-PRNVFFSLTE
E3HV63_ACHXA/38-119-------------YIQITAN---NTR-------------SLEQ--KKALFQ-RIAQRLGDDP---GL-R-PEDVFVNLVE
E0RDQ5_PAEP6/39-120-------------YIQITMG---TGR-------------TTEQ--KKSFYQ-KLAELLSIEC---KI-R-PEEVFVTLIE
B6R495_9RHOB/38-118-------------VIEIALL---GGR-------------SDEQ--KEHLYK-DMRQRL.SNI---GF-E-PDNSIMFLIE
B8HDC6_ARTCA/38-118-------------MIQIFTQ---AGR-------------SQEA--KQQLFA-AVADRL.AGL---GV-A-GEDVFIGYVE
E2SUT1_9RALS/38-119-------------IIQITAN---NTR-------------NREQ--KQALYR-RIVELLGEEP---GI-R-PEDVFINLVE
A8GBS4_SERP5/38-119-------------LFYITIG---RPR-------------DTAT--KQRFYQ-RLAALLAENL---QL-R-PQDVMVVITT
E8X4V4_ACISM/38-119-------------ILQVTST---VGN-------------TKEQ--KLAFFR-HMADELNRRL---NV-R-REDVFISLVF
D8MPE1_ERWBE/38-119-------------QFHILAG---RPR-------------SFAQ--KQNLSR-VLCDRLHGGL---NI-D-PDDVMIMIQF
Q12G69_POLSJ/38-119-------------FIQITAN---NTR-------------TVEQ--KKALFR-RIAELLGESP---GI-R-PEDVFVSLVE
Q1ZUX9_PHOAS/38-121-------------LFHIFAG---KSR-------------DHEQ--KRALYK-ALCEQLQAQT---PI-R-KEDIMIIVQF
A1R659_ARTAT/38-118-------------MIQIFTQ---GGR-------------SQEA--KSSLFE-AIAGRL.ADV---GI-A-GEDVFVGYVE
A0AJN8_LISW6/38-121-------------YIEIFCG---PGR-------------SDDQ--KKQLYE-MLALKVERET---TV-T-KQNLFILLNE
B2FR97_STRMK/37-118-------------CIQITWN---EGR-------------TLEQ--KKALYA-GIADGLHAAV---GI-R-REDVFINLVE
E6WK69_PANSA/38-119-------------LFSLVAG---KSR-------------STEQ--KRSFYR-VLSERLQQRL---DL-D-PNDVMVVIQQ
Q5FTM0_GLUOX/38-118-------------ILSITTR---.PR-------------SVEE--KTAFFR-ILTEALSEKC---GI-A-PSDVMVNYVE
D3P7K3_AZOS1/38-119-------------FFHITTG---KAR-------------SAET--KARFYR-RLVEALAASP---GV-R-PEDVMVAIAN
E6KXS2_9PAST/36-114-------------VIEINLM---QGR-------------LEQT--KKRLIK-MLFSEFEYKL---GI-S-PFDVEITIKE
B1MEJ6_MYCA9/38-118-------------IVHIFTQ---TGR-------------TTET--KQRIFA-ELADRL.GAV---GV-T-GADLFVGISE
Q03TL7_LACBA/38-118-------------LFSLTSS---.PR-------------AEAD--KERFYA-RLVQELSTHT---DV-A-PSDIMINLVT
D3Q817_STANL/38-115-------------LVSVDCF---AGR-------------SVRA--KRKLYT-EIVDRLAP.F---GI-P-RDHVTINLRE
E6PQC8_9ZZZZ/10-91-------------LIAITAG---RPR-------------STHT--KKAFDQ-RLVELLEEAP---GI-R-REDVMVVINT
D5WEQ4_BURSC/38-119-------------VIQLTVS---NTR-------------SVEQ--KKALYR-RIVDELGRSP---GV-R-PEDVFVNLVE
Q12CT9_POLSJ/38-113-------------LVSIDCF---IGR-------------SVET--KRALYQ-AIVQNLGL.C---GV-P-ADHIKVVMRE
E6U1F8_BACCJ/38-114-------------IIEISMF---DGR-------------TIEA--KKRLIK-LLFERIESEC---HI-T-PQDVEITIFE
E3E9I4_PAEPS/38-114-------------IIEISIF---EGR-------------TTEA--KKQLIN-LLFQRINELL---GI-S-PQDLEITIFE
Q1IHI2_KORVE/38-119-------------FIQITLN---SGR-------------TLDQ--KKAFYK-AVADGLHQQV---HV-R-KQDVLINLVE
E6UZN9_VARPE/38-119-------------LIQITLN---QGR-------------TIEM--KKAFYK-RVADDLHEKL---GI-R-REDVFINLVE
D3UP74_LISSS/38-121-------------YIEIFCG---PGR-------------TVEQ--KQLLYQ-TLVEKMESAT---SL-S-KQNIFILLNE
Q1MBY6_RHIL3/38-119-------------YISITIG---RPR-------------TGEM--KAALYR-RLADLLAQSP---GL-R-PEDVMIVIST
D2B2C9_STRRD/38-113-------------IVEIICF---QGR-------------SDEA--KRDLIR-TLFARAQEEL---DL-P-AEDLEIVILE
D1RZN5_SEROD/38-118-------------VVRVITS---.PR-------------AEEQ--KQRFYA-DLSRELKESC---GI-E-SSDLMVSITT
B1YJI0_EXIS2/38-118-------------VISVTSK---.TR-------------TEEK--KQALYR-LLAERLEAVC---GL-S-PADLMVSIVE
Q9K3M3_STRCO/39-121-------------FVAITLR---AGR-------------TTRQ--KAALYG-RIAQLAEEYA---GT-D-PRNVFVTLTE
B8MDG5_TALSN/39-119-------------IIQIFQQ---.GR-------------NDQQ--KQEVFK-ALHESLFQKC---GL-S-GEDLIVCCAQ
F2JUJ3_MARM1/38-122-------------LIEITGG---KPR-------------LKEM--KARFYK-VAATKISVAL---NI-D-PADIMFVLSH
A2P9R5_VIBCL/36-112-------------VIEVNMM---EGR-------------KVET--KKALIK-ALFSNIESRL---GI-S-PIDIEITIKE
Q2BGH4_9GAMM/36-112-------------VIEINMM---AGR-------------KEET--KKRLIK-ALFREIESNL---SI-S-PVDIEITIKE
D5E1U6_BACMQ/39-123-------------YISITCG---QGR-------------TVEQ--KKKLYQ-SIAEGLSTHL---NI-S-TNNIFITLNE
C5A915_BURGB/38-119-------------IIQIIAG---NWR-------------DTPQ--KQALYG-AIAANLARDP---GL-R-PEDVMIVLTP
E6VM91_RHOPX/38-118-------------YIQITVF---DTR-------------TPEQ--KKALYR-RIAELLAESP---GL-R-PEDVFINVYD
B8EMJ0_METSB/38-119-------------VIQVTLN---AGR-------------TVEL--KRAFYK-AVADGLHERL---EI-R-REDVFISLIE
A7GPJ3_BACCN/39-123-------------YVSITCG---PGR-------------TINQ--KKRLYK-SISKAISNHL---SI-S-TADIFIILNE
C0VL22_9GAMM/64-140-------------IIEISMF---EGR-------------SIEA--KQKLIQ-TIFSNIQNLC---DI-S-PQDIEITIFE
A5CMA6_CLAM3/38-118-------------IIQIFTQ---AGR-------------STEE--KQEFFR-TLAASL.AEV---GV-A-GEDLVIGFVE
C3JW70_RHOER/39-119-------------IIQILQQ---.GR-------------SELQ--KTNVYR-ALANGLESAA---GL-R-PDDLIVSVSG
Q9L029_STRCO/38-117-------------FIQLSFN---R.R-------------GAEQ--KARLFR-AIVANLRLYA---DV-P-EEDVMLVAFE
E2P255_PASHA/36-112-------------VIEINLM---QGR-------------SEQL--KKRLIK-GLFSALHTKV---GI-V-PMDVEITIKE
F0P364_STAPE/38-118-------------VFTLITR---.PR-------------TQEQ--KTIFYR-KLVEMLHLKL---GI-R-KEDVLITLVE
A9IL59_BORPD/38-119-------------FIQITLN---TGR-------------TTDA--KKSLFK-AIVDGMQARL---NH-R-PEDVFIGLVE
Q9EV83_PSEPV/38-118-------------LLTVISR---.PR-------------SEEQ--KVCFYK-LLTGALERDC---GI-S-PDDVIVALVE
A9ISV8_BORPD/38-119-------------FIQITAN---ATR-------------SADQ--KKALYQ-CIAERLGANP---GV-R-PEDVFVNIVE
C8YX84_9GAMM/38-113-------------MMHLVMR---AGR-------------PDHA--KKAFYA-RVVESLARNP---GI-D-PGNVMITITE
B4WFG2_9SYNE/38-114-------------IIEIIMF---EGR-------------SVGA--KKRLTS-LLFERINQKL---EI-A-VEDIEIAIFD
A1K821_AZOSB/38-119-------------FIQITAN---NTR-------------TIEQ--KQALYR-RIQGLLSESP---GV-R-PEDVFINLIE
B0T974_CAUSK/38-120-------------FINIESS---.GR-------------DRQA--KEAFIK-RLSEKLAASP---GV-A-PSDVFVRLSV
D4YHW3_9LACT/38-119-------------IIQITMN---EGR-------------TTEV--KKALYK-TVADKLNSQL---AI-R-KEDVFINLVE
D9WAV5_9ACTO/38-118-------------MIQIFTQ---EGR-------------TTEV--KQHVFR-AIAEQL.EPL---GI-G-GEDVFVSIFE
D5UG10_CELFN/38-112-------------VVEVVCF---TGR-------------SSAA--VRALIA-AFFDDVAPAL---GL-A-ADELEVVVLE
A9C379_DELAS/38-119-------------LVQLTVS---NTR-------------SLEQ--KKALFS-RIAELLVESP---GL-R-PEDVFVNLVE
A9VV21_BACWK/39-123-------------HVSITCG---PGR-------------TINQ--KKSLYQ-SISKTISNHL---NI-S-TTDIFITLNE
D8MX59_ERWBE/38-118-------------MVRVFTS---.PR-------------SDEQ--KQFFMA-ELCRELKESC---GI-L-GSDVMISFIT
D1AMD1_SEBTE/38-122-------------YIDILCA---EGR-------------TTEQ--KNKLYL-SVSGQIADKT---NI-S-AEDIFITLKE
Q3KAR7_PSEPF/38-119-------------FIQLTIS---EGR-------------TVEM--KQRLFQ-TIARNLNQQL---AV-R-QEDVFINLVE
Q1I8I7_PSEE4/38-119-------------FIQLTIS---EGR-------------TVEQ--KKALFQ-AIAEGLKAEA---DV-R-PEDVFINLVE
A7Z8K4_BACA2/39-120-------------FIRFTLK---NSR-------------TTHQ--KQAFYQ-HLADRLHEKL---GV-R-KEDVFIVLSG
Q89DY8_BRAJA/38-118-------------LIQITVF---ASR-------------TPEQ--KKALYR-RIAELLGENP---GI-R-PEDVFVNVLD
D2BTM6_DICD5/38-119-------------LFHITAG---KPR-------------SREQ--KRGFYR-RLQQLLHTQL---AL-P-PDDVMVIIQF
Q6FAM7_ACIAD/38-114-------------IIEISMF---TGR-------------STQS--KKLLIK-KIYDYIEDKT---DI-S-QQDIEITIFE
E8XR93_RAHSY/38-122-------------LFHITAG---KPR-------------NGYQ--KQQLFH-HLAEKLHLTL---GI-S-QADVMVVVSF
D2S6L3_GEOOG/39-119-------------VLQVFQQ---.GR-------------SEEQ--KRALYA-GLAQRLEEAA---GL-S-PSDLVVSVAS
D2BWC8_DICD5/39-120-------------IVTVTTG---TSR-------------TVEQ--KRKLAE-LVTRYAVEKV---GV-S-QDDVTLIMQA
D5DA95_BACMD/38-118-------------IISVTSK---.QR-------------TEEQ--KQALYK-LIVKELGESC---GI-Q-PNDIMISIVE
Q65NT7_BACLD/38-118-------------YIHITMK---.ER-------------PIEK--KLALYQ-RIAERLQKNA---GI-R-QEDVMIIAAE
D7DPH6_METS0/38-113-------------MMHLVMR---AGR-------------SNKS--KQAFYK-KVTENLAANP---GI-P-AANVLITITE
Q7NSY2_CHRVO/38-119-------------LVAIQTG---RPR-------------SAQA--KAALYA-RMAALLAASP---GL-A-PADLMVVVSD
B2IF75_BEII9/38-119-------------MIQIFAN---NTR-------------TTEQ--KKALYA-RIAELLKDKP---GI-K-PENVLISLVE
B1LS78_METRJ/38-119-------------IINIVAG---NWR-------------DTAQ--KKALYR-AITDNLVADP---GL-R-PEDVLIVLSP
A4FIQ5_SACEN/38-118-------------MIQVFTQ---VGR-------------DTST--KQQVFE-AIASRL.GAL---GV-G-GHDVFVGIVE
A0NS28_9RHOB/49-130-------------IIQLTVS---DTR-------------SVEQ--KKALFA-RIARGLAREV---GI-R-SEDIFINLVE
D0RZI0_ACICA/36-118-------------LLYITSG---KPR-------------TAQQ--KSDLML-YVTAQLKQNF---DV-P-EQDVMFVIVQ
F0TAP2_METSL/38-114-------------IIEITLY---PGR-------------TEST--KKKLFK-EIVKNLSEDP---GI-E-AGDIITVLLE
A5EML5_BRASB/38-118-------------YIQITVF---DTR-------------TPEQ--KTALFR-RIAALLGDSP---GL-R-PEDVFVVILD
A2SJ61_METPP/38-119-------------FIQITLN---QGR-------------SIEL--KKAFYK-RVADDLHARL---GV-R-RQDVFINLIE
D7WQM9_9BACI/38-114-------------IIEISMF---EGR-------------TIQA--KKQLVK-LLFERINNQL---NI-S-PQDVEITIFE
A5GTW6_SYNR3/38-118-------------ILLQITS---SPR-------------SAEM--KTSFYK-LLAGEFAR.L---GF-R-PEDLFISITP
D8JU73_HYPDA/38-118-------------LIQVTTR---.PR-------------TREQ--KEQFYR-LIVEELQKSS---GI-A-PSDVMMNFVT
B9XKA7_9BACT/38-119-------------LIQVTST---VGD-------------NKES--KLAFFR-YIADELKSKL---SV-R-PDDIMINMVF
E0I4N7_9BACL/39-120-------------YIQITLK---SGR-------------TTEQ--KTSFYR-KLATDLSAAV---PI-R-PEDVFVVLVD
B4APB2_BACPU/39-121-------------YIQITCG---SGR-------------TEEQ--KQSLYK-EIADQLYCQL---NI-R-KENVFIMLIE
B2J5J2_NOSP7/38-114-------------VIEISMF---EGR-------------SVET--KKELIR-LLIKNINEKF---NI-P-ICDIEITIFE
Q28PN6_JANSC/38-118-------------IIDITLL---AGR-------------SDDQ--KEALYR-DVRQRL.AAI---GF-P-PDNSILYLTE
E5VQA7_9FIRM/38-118-------------VVRVTSK---.QR-------------PREK--KEKLYS-LLCERLNVNC---GI-P-PKDLLVSITE
F2Z288_9CORY/37-117-------------IIHVFTQ---AGR-------------TIET--KQRVFA-AITESL.API---GV-A-GSDVFIAITE
Q215U6_RHOPB/37-112-------------RVEIKLF---SGR-------------SIEA--KRALYR-AIVDNLAA.L---GV-P-ELETKIILVE
D0L5B9_GORB4/39-119-------------VIQIFQQ---.GR-------------TLDH--KRAAFR-ALADRLESET---GL-R-PADLVISVSE
Q1ZAF8_PHOPR/38-121-------------LFHVFAG---KPH-------------SHEQ--KRALYK-ALCEQLQKKT---VI-S-KEDIMVVLQF
Q393L4_BURS3/38-119-------------MIQITAN---NTR-------------TLEQ--KRALYR-AIADNLAQQP---GV-R-QQDVFISLVE
A9F6T6_SORC5/38-114-------------IIEISMI---SGR-------------SVET--KKKLVR-LLFDKIRDEV---GI-D-HQDIEICISE
A7IDV7_XANP2/38-118-------------YITITVF---NTR-------------TPEQ--KKALFR-RIADLLGESP---GI-R-PEDVFVVIAD
B3PZS7_RHIE6/38-116-------------YISITIG---RPR-------------TAEM--KATLYR-RLVDLLAQSP---GL-R-PEDVM...SH
Q11ST9_CYTH3/38-114-------------IIEINLF---EGR-------------SIEA--KKKLYQ-LLFSRFDAEL---GI-S-NMDLEITLFE
D1BU80_XYLCX/38-112-------------VVEIVAF---TGR-------------SPEA--KRALVR-AMYDDVAPAV---GL-D-ADDLEVVVIE
A6Q8U6_SULNB/38-114-------------IIEITMM---EGR-------------SKEA--KKKLIA-LLFKHIEEEL---GI-A-GNDLEIFIQE
A8IN35_AZOC5/50-131-------------LFHITTG---RAR-------------SPAV--KRAFYR-HLVANLAASP---GV-R-PEDVMVVLSA
B6R0J0_9RHOB/38-118-------------FIQITLN---.TR-------------SSEQ--KRALFR-RIVELLGETP---QI-R-PEDVFINLVE
C6D8V6_PECCP/38-119-------------LFHIFAG---KPR-------------TREQ--KRNFFR-MLSERLHGVL---NI-H-PDNVMVIIQF
F2LDE3_BURGS/38-120-------------FIQVTWN---AGR-------------TVEV--KKAFYR-AIADGIHAKV---GV-R-KEDVWISLVD
C5BKG7_TERTT/36-112-------------VIEINMM---AGR-------------TVDT--QKTLIK-TLFREIERDL---GL-A-PIDVEIVIKE

PF01361

Y2002_DICD3/2-62-------------FVNIRIT...KDG---------...VTAEQ--KKQLIA-GVTQLLVDTL---GK.N-PATTVVIIDE
YWHB_BACSU/2-61-------------YVTVKML...EGR---------....TDEQ--KRNLVE-KVTEAVKETT---GA.S-EEKIVVFIEE
Y574_LACLA/2-61-------------YVHVELF...EGR---------....TVEQ--KAIIAK-EITESISKHA---GA.P-TSAIHVIFND
Y3814_BACHD/2-61-------------IVTVKFL...EGR---------....SDEQ--KRALVE-RVTEAVAETI---QA.N-PEKIHVVLEE
Y270_CAMJE/2-62-------------LVNIKLA...KPS---------...LSKEQ--KAELIA-DITELLSTKY---NK.S-KERVVVVLED
4OT_PSEST/2-61-------------IAQIHIL...EGR---------....SDEQ--KETLIR-EVSEAISRSL---DA.P-LTSVRVIITE
Y924_HELPY/2-64-------------FINIKLVPENGGP---------....TNEQ--KQQLIE-GVSDLMVKVL---NK.N-KASIVVIIDE
Y921_STRR6/2-60-------------FVRIDLF...EGR---------....TLEQ--KKALAK-EVTEAVVRNT---GA.P-QSAVHVIIND
Y1725_XYLFA/2-61-------------HIIVKIA...EGR---------....SQPL--KQELAD-RLAATMMDVL---GL.D-SSAVSVAVED
YRDN_BACSU/2-61-------------LLRFDLI...EGR---------....DQSS--LKKLLD-VAHNVVVEAF---DV.P-QQDRYQIVHE
4OT_PSEUF/2-61-------------IAQLYII...EGR---------....TDEQ--KETLIR-QVSEAMANSL---DA.P-LERVRVLITE
PPTA_ECOLI/2-58-------------HIDIKCF...PRE---------...LDEQQ--KAALAA-DITDVIIRHL---NS.K-DSSISIALQQ
Y1363_STAAM/2-61-------------IVNVKLL...EGR---------....SDEQ--LKNLVS-EVTDAVEKTT---GA.N-RQAIHVVIEE
4OT_COMTE/2-61-------------FAQIYML...EGR---------....SEEQ--KKAVIE-KVTRALVEAV---GA.P-SANVRVWIHD
Q9EVV8_STRTR/2-61-------------FVKIDLF...EGR---------....SEEQ--KIELAR-EVTEVVSRVA---KA.P-KEAIHVFIND
O29588_ARCFU/2-60-------------VLIVYGP...KLD---------.....VGK--KREFVE-RLTSVAAEIY---GM.D-RSAITILIHE
O27643_METTH/2-60-------------VIQINCN...ELT---------.....REK--KRELVK-RITEVSSEIM---GL.P-ESTITVLIRE
Q9K3M3_STRCO/2-63-------------FVRIDAH...GGG---------...TDDDR--LDALGR-AVHDALVEAL---GIPP-DDRFQVLTAH
Q9L0G0_STRCO/2-63-------------FAHFKVP...AGT---------...LSAED--KKKIVE-RTTDLYAEIY---GERA-RPTTVVLVDE
Q9EV85_PSEPV/2-61-------------MISCDMR...YGR---------....TDEQ--KRALSA-GLLRVISEAT---GE.P-RENIFFVIRE
Q9L029_STRCO/2-61-------------LITVSLR...QGT---------....TPQY--RRLVSE-ALHKSMVDVL---KI.P-QDDQFHVFHE
Q9EV84_PSEPV/2-61-------------FIECHIA...TGL---------....SVAR--KQQLIR-DVIDVTNKSI---GS.D-PKIINVLLVE
Q98JE6_RHILO/2-63-------------FANIKLP...QAA---------...LSKAQ--KEDLIH-RTTAMFVDFF---GEGV-RPTTMVLVEE
Q984V7_RHILO/2-61-------------IINISVT...GKP---------....NAAL--SASIAR-EITEITATQL---RK.D-PTITAVVVSY
O85975_SPHAR/2-61-------------IIEVNLF...EGR---------....PPEA--KERLIK-ALTDAAIDAI---GA.P-RESVRVILRE
Q9A468_CAUCR/2-62-------------YVNIQVT...REG---------...VTREQ--KARLID-GVTTLLAEVL---GK.D-PNTTFVVIEE
Q98EB0_RHILO/2-65-------------FVNIRIV...KEV---------IAADPAGK--KADIAK-KVTAAIMEAT---GL.G-NDDVWVVFEE
Q9R9T3_PSEPU/2-61-------------IAQLYIL...EGR---------....SNEQ--KETLIR-EVSDAMSRSL---DA.P-IERVRVIITE

PF14832

B0XZS0_ASPFC/1-136.............FVALTIYH.LART.........MTSD..EQ..RQGFLK.RIDAFLTPMF...EP-K.GIDWEYFVTE
A1CC92_ASPCL/1-136.............FVALTIFH.LART.........MTSE..EQ..VQRFLS.RVDAVLTPAF...EP-K.GIDWEYFITE
E3RF02_PYRTT/1-154DEEKKKKKSHQRPFVRITIQH.LARQ.........LPND..TV..RDDFLK.KVDAVLKPYI...AD-R.GYDWEYTVEE
B8NVG2_ASPFN/1-142...........KPFVRIVVAH.IAIR.........LPDA.DES..YARVTA.SIDRVLKPHV...LD-K.GYDVEYHVDE
Q0SD71_RHOSR/1-153.............FIQIEVVH.IARTNEGAAALMGISVE..QI..LENYFA.MVSEVLKPYI...AD-R.GYELEFHVET
A9C0U3_DELAS/29-162.............FVRISVDH.IARQ.........IRDE..ET..KTRFLE.GVRRQLSPFI...AD-R.GLRWEMHVDE
A5ELU6_BRASB/1-136.............FVRIWVDH.IARS.........FPPDAKER..KAKWLS.WAEAALAPYI...KD-R.GYDWEIHIDE
A6SK63_BOTFB/1-138............PFIRISIDH.IAVH.........MEGP..KV..HAEWTS.KVDGALKPHI...ED-K.GYNWEYHIDE
B1MJZ2_MYCA9/1-136.............AVRIVVDH.IART.........LPDK..AA..RERTTR.RLGAALAPYL...NR-P.GLHWEFHVDE
B6HS40_PENCW/1-136.............FAAVTIYH.VARA.........FKSD..EA..KRRFLA.DVDGILNPVF...EP-K.GMDWEYFIAE
B6HI01_PENCW/1-140............PFIRIAIEH.IAVR.........IENE..DH.AYKRTTD.AIEKVLKPHV...AD-K.GYDWEFHIDE
Q0U6R6_PHANO/1-142...........KPFIRIAIEH.IAVR.........LPDE..DN.VYRETAN.AVDATLKPHI...AD-K.GYNLEFHIDE
Q0BSZ1_GRABC/1-135.............FVRVTIDH.IARS.........IDDP..EM..QHQFLV.GCSGVLEPYV...AG-R.GYRWELHVDD
Q0CF32_ASPTN/1-140............PFVRIMIDH.IAVR.........LEND..DS.MYKRTAD.AINNALKPHL...VD-K.GYDWEFHVDE
A2QYI6_ASPNC/521-660............PFIRIVADH.IAVR.........LENE..DH.VYKNTCY.AIEKALKPHI...AD-R.GYDWEFHVDE
E3Q5I4_COLGM/1-139............PFVRISIDH.IAVN.........LPND..DK.IYRETAD.GIDAVLKPHL...ED-K.GYRSEFHVNE
Q398P0_BURS3/1-135.............FVRIRVDH.IARQ.........IEDP..AE..QARFMQ.HVGQRLAPFI...GE-R.GLRWEIHIGE
D5WHW6_BURSC/1-134.............FVRIRLDH.FARH.........IADD.VEW..TASWLR.KANAAIAPFV...QD-R.GYHYELHVGE
D9VBZ9_9ACTO/1-137.............GARIVIDH.IART.........SAGP..EA..RRRTAK.WINGMLLPYL...EN-RPGVHWEFHADE
Q0U745_PHANO/1-144..........KKPFIRLTFSH.IARR.........FPPG..ESPVRTRFMK.LVHEALKPHI...AD-R.GYDWEVNGEE
E9F5N7_METAR/39-184.........QEPTFIHVRFTH.IARQ.........FPPGESEK..KDKFLD.RVTEILKPFT...ID-K.GWYLELTGEE
B6QU03_PENMQ/1-138.............KLAIEVLH.IARQ.........WDST..ETDRAVRLKN.GITEILKPYT...TD-K.GVQVEFCVVQ
Q0SD79_RHOSR/1-135.............FVRLQVEH.IARA.........IDGK..VM..QEFIMD.MLTETIRPWL...DG-R.GHDWEMSIGE
E9F263_METAR/1-138.............FVIIELAH.IARN.........WDGD..QK..RATVIKDSIDRVMRPFT...ID-K.GIHLEYAVLE
Q4P6H1_USTMA/1-145.........QGKPFVRVVSQH.LART.........VDGK..ER..RLSLIQ.RLEDRFRGVF...EA-K.NCEWEIHIEE
C7YJ99_NECH7/1-141............NKLMITLRSGTGRT.........AEQY..AG.ITTKLIS.FWNDSVEGVQATQKE-K.ELKDVFIMG.

PF08921

A3H1V4_VIBCL/1-106-------------MVEVLWF----GR-------------EQQT--QDQIAQ-VITDQIRQLL---.G-A-DSHLAVVFIP
A8FVM5_SHESH/1-109-------------QVEMLWF----PK-------------DPET--HHLVEK-VIREAVQKAY---.P-E-SLHIVVMFRQ
Q8EEJ0_SHEON/1-109-------------QIELLWF----PV-------------DPDI--HLKVEQ-TIRLAVTEAY---.P-E-LTQIAVMFLS
A6D726_9VIBR/1-109-------------FIEVLWF----DR-------------GQEV--KNSVAT-VITTQVRSAL---.G-K-EVDVAVIFSA
Q6F289_MESFL/1-104-------------YVEVDWL----KR-------------SEES--RVLLVQ-HLTNFFG...---.N-Q-GVNVSVKFTE
A6ATB3_VIBHA/1-109-------------FVEVLWF----DR-------------GQDT--QDEVAK-AITKQVRGIV---.G-E-DIDVAVIFSA
A4SQR6_AERS4/1-109-------------FVELVWF----ER-------------PQAM--QDAAAA-LITRHLKAVL---.G-E-QTYVVVQVLP
A8H4B7_SHEPA/1-109-------------QVEVLWF----PK-------------DPET--HHRAQT-VIREALLKVY---.P-G-LKHVIVMFRE
A9VL18_BACWK/1-107-------------LIEVKWF----ER-------------GQEI--RDRFAK-AITTYVMD..---.F-G-LPEVEVVFTV
Q188J0_CLOD6/1-108-------------FVEVAWF----DR-------------GQEV--QDIVAR-IITDSIRNN.---.L-D-VESMDLAFTV
B1KF64_SHEWM/1-109-------------QVEVLWF----PK-------------DPNT--HQMVES-AIREAIKIVY---.P-E-LQNLSVIFIA
Q39YS1_GEOMG/1-102-------------.LEIFIF----PR-------------DQKK--HDAIAA-TLAGILGR..---.Y-G-YDDVHIFFVL
A5TWA0_FUSNP/1-108-------------FVELYWF----AR-------------DEKI--KKEVAD-FLTKFIKKI.---.N-N-NKDCCIIFFT
Q1ZJL0_PHOAS/1-110-------------FVEVLWF----DR-------------GQET--QDKVAA-IITAAVRKTL---DD-K-DQDVAVIFTA
Q2SR33_MYCCT/1-99-------------YVTVQWM----SR-------------PDKE--Q.LLAD-FIIDYFK...---.N-Y-SQKVWVFFTD
A1S6E5_SHEAM/1-107-------------MVEVLWF----QR-------------NEST--QDDMEA-CIREHLLA..---.E-T-QLSVAVIFIG
Q6MPG9_BDEBA/5-112-------------FIEVLWF----AR-------------SQEV--QDECAS-IITRQIKSI.---.A-D-YEDVVIVFQV
A3QED2_SHELP/1-109-------------QVEVLWF----PK-------------DPEI--RHAVEQ-IIRQAVLAHY---.S-P-AKHISIMFMA
A4J4K9_DESRM/1-107-------------FVEIGWF----DR-------------GQSV--QDLVAK-EITNQIQR..---.A-G-FESVDIMFTT
A6W1J4_MARMS/1-109-------------FFDVLWF----DR-------------GDEV--KRKVAL-IIEELVRPLV---.D-S-GQDITVLFHD

PF01187

MIFH_BRUMA/2-115-------------VCVLKSI----GC-----------V.GPKV--NNSHAE-KLYKLLADEL---KI-P-KNRCYIEFVD
MIF_BOVIN/2-115-------------LCSLHSI----GK-----------I.GGAQ--NRSYSK-LLCGLLTERL---RI-S-PDRIYINFCD
DOPD_RAT/2-116-------------HLLISSI----GV-----------VGTAEQ--NRSHSS-SFFKFLTEEL---SL-D-QDRIIIRFFP
DOPD_HUMAN/2-116-------------QLSISSI----GV-----------VGTAED--NRSHSA-HFFEFLTKEL---AL-G-QDRILIRFFP
MIF_CHICK/2-115-------------LCSLYSI----GK-----------I.GGQQ--NKTYTK-LLCDMIAKHL---HV-S-ADRVYINYFD
MIF2_CAEEL/2-115-------------VISIKSI----GA-----------V.SAED--NIRNTA-AITEFCGKEL---GL-P-KDKVVITFHD

PF02962

HPCD_ECOLX/2-125-------------HMTLKIG---AGR-------------SLES--RQQAGE-MLFELIKTHFAALMESR-LLALSFEIEE
Q9RE14_KLEPN/2-125-------------HMTLKIG---AGR-------------SLES--RQDVGD-MLFTLIKAHFAALMESR-YLALSFELDE
Q9RYT1_DEIRA/2-126-------------HLRLQIG---AGR-------------SEEV--KKETGD-ALFAVLTDHFAAEFAQR-GLMLSAEISE

PF14552

D6JQ64_ACIG3/38-114TPK.ENWGIR--------------------
B7HN80_BACC7/39-123TAA.ENWSFG--------------------
D1BFT0_SANKS/38-113SPR.DSWGIR--------------------
D4E924_SEROD/38-119SQR.EDWSFA--------------------
E8Y1J8_RAHSY/38-118NTD.ADWSFG--------------------
F2K7Z3_PSEBN/38-119TAS.DEWSFG--------------------
D3EB59_GEOS4/38-114TPQ.HNWGIR--------------------
F2EZE5_PANAA/38-122TQP.EDWSFS--------------------
E3E492_PAEPS/38-118NND.DDWSFG--------------------
B9J9P6_AGRRK/38-119TTR.EDWSFA--------------------
E8VEI5_BACST/38-118NDN.ADWSFG--------------------
E1SCB2_PANVC/38-118NDK.GDWSFA--------------------
B5XPI5_KLEP3/38-118NQK.GDWSFG--------------------
Q8YNJ7_NOSS1/38-114IPK.QNWGIR--------------------
C3H1D6_BACTU/49-133TPM.ENWSFG--------------------
B7VTJ1_VIBSL/38-114QPS.HCWGFR--------------------
B4SSI5_STRM5/38-119TSE.EDWSFS--------------------
C7KKW6_ACEPA/38-118NSA.EHWSFG--------------------
E3ZHI6_LISIV/38-121VSL.ENWSFG--------------------
E0U1E6_BACPZ/38-119NQD.EDWSFG--------------------
A7HF13_ANADF/38-119VTK.ENWSFG--------------------
D0SN89_ACIJU/38-115IPL.ENWGIR--------------------
C3A4Q6_BACMY/39-123TAA.ENWSFG--------------------
Q2IWE1_RHOP2/38-119VAK.ENWSFG--------------------
B4ULN4_ANASK/38-119VAK.ENWSFG--------------------
C6CT61_PAESJ/39-119TEL.EDWTFG--------------------
B8IW24_METNO/38-118NTD.DDWSFG--------------------
B8N5I4_ASPFN/39-119NSK.ADWSFG--------------------
A4SIM9_AERS4/38-119NGS.EEWSFG--------------------
B8ELY1_METSB/38-118NTD.EDWSFG--------------------
C4F042_HAEIF/36-112QPA.HCWGFR--------------------
D8IRK4_HERSS/38-119GDK.GNWSFG--------------------
E0LSD4_9ENTR/38-119NST.EEWSFS--------------------
A1TZC6_MARAV/36-112QPP.HCWGFR--------------------
E1TGD7_BURSG/38-119VLK.ENWSFG--------------------
D3RFU8_KLEVT/38-119NQR.EDWSFS--------------------
E8XXC7_RAHSY/38-119VPK.ENWSFG--------------------
A7Z5L4_BACA2/38-118NGN.ADWSFG--------------------
C3AIG8_BACMY/39-123TSA.ENWSFG--------------------
C1F200_ACIC5/38-118NDL.ADWSFG--------------------
C5APP6_METEA/38-118NTD.EDWSFG--------------------
A3JZH5_9RHOB/38-118NRE.EDWSFA--------------------
C2CZD0_LACBR/38-118NSD.EDWSFG--------------------
Q21G56_SACD2/36-112QAP.YQWGFR--------------------
YOLI_BACSU/38-118NGD.ADWSFG--------------------
C7QGF3_CATAD/38-119TPP.ENFSFA--------------------
Q1N6A6_9GAMM/36-112QQP.YQWGFR--------------------
D7C3V5_STRBB/37-119NES.IDWSFG--------------------
D9UVM6_9ACTO/38-119NHE.VDWSFG--------------------
E3HV63_ACHXA/38-119VAK.ENWSFG--------------------
E0RDQ5_PAEP6/39-120TEL.EDWSFG--------------------
B6R495_9RHOB/38-118NNS.IDWSFS--------------------
B8HDC6_ARTCA/38-118NTA.GDWSFG--------------------
E2SUT1_9RALS/38-119VLP.ENWSFG--------------------
A8GBS4_SERP5/38-119TQL.DEWSFS--------------------
E8X4V4_ACISM/38-119VDR.DDWSFG--------------------
D8MPE1_ERWBE/38-119NSA.EEWSFS--------------------
Q12G69_POLSJ/38-119VAK.ENWSLG--------------------
Q1ZUX9_PHOAS/38-121NGP.EDWSFS--------------------
A1R659_ARTAT/38-118NSP.GDWSFG--------------------
A0AJN8_LISW6/38-121VPL.QNWSFG--------------------
B2FR97_STRMK/37-118VKK.ENWSFG--------------------
E6WK69_PANSA/38-119TSA.EEWSFS--------------------
Q5FTM0_GLUOX/38-118NTD.ADWSFG--------------------
D3P7K3_AZOS1/38-119SSF.EDWSFA--------------------
E6KXS2_9PAST/36-114QPA.HCWGFR--------------------
B1MEJ6_MYCA9/38-118NGP.QDWSFG--------------------
Q03TL7_LACBA/38-118NTK.ADWSFG--------------------
D3Q817_STANL/38-115SPT.ENWGYA--------------------
E6PQC8_9ZZZZ/10-91TDA.DEWSFG--------------------
D5WEQ4_BURSC/38-119VEK.ENWSFG--------------------
Q12CT9_POLSJ/38-113APR.ENWAIR--------------------
E6U1F8_BACCJ/38-114TPK.HNWGIR--------------------
E3E9I4_PAEPS/38-114TPK.QNWGIR--------------------
Q1IHI2_KORVE/38-119VAK.ENWSFG--------------------
E6UZN9_VARPE/38-119VMK.ENWSFG--------------------
D3UP74_LISSS/38-121VPL.ENWSFG--------------------
Q1MBY6_RHIL3/38-119STP.EDWSFG--------------------
D2B2C9_STRRD/38-113SPQ.VNWGIR--------------------
D1RZN5_SEROD/38-118NSK.GDWSFG--------------------
B1YJI0_EXIS2/38-118NDA.ADWSFG--------------------
Q9K3M3_STRCO/39-121NTS.ADWSLG--------------------
B8MDG5_TALSN/39-119NTP.ADWSFG--------------------
F2JUJ3_MARM1/38-122NHI.EDWSFS--------------------
A2P9R5_VIBCL/36-112QPA.HCWGFR--------------------
Q2BGH4_9GAMM/36-112QEP.HCWGFR--------------------
D5E1U6_BACMQ/39-123TPL.ENWSFG--------------------
C5A915_BURGB/38-119NAR.DEWSFG--------------------
E6VM91_RHOPX/38-118APG.VNWSVG--------------------
B8EMJ0_METSB/38-119VVK.ENWSFG--------------------
A7GPJ3_BACCN/39-123TSA.ENWSFG--------------------
C0VL22_9GAMM/64-140TPK.NHWGIR--------------------
A5CMA6_CLAM3/38-118NTA.ADWSFG--------------------
C3JW70_RHOER/39-119NSR.ADWSFG--------------------
Q9L029_STRCO/38-117TAR.ENW.WA--------------------
E2P255_PASHA/36-112QPE.HCWGFR--------------------
F0P364_STAPE/38-118NTD.ENWSFF--------------------
A9IL59_BORPD/38-119TNK.ENWSFG--------------------
Q9EV83_PSEPV/38-118NSD.ADWSFG--------------------
A9ISV8_BORPD/38-119VAP.ENWSLG--------------------
C8YX84_9GAMM/38-113NRD.IDWSFQ--------------------
B4WFG2_9SYNE/38-114LPK.HNWGIR--------------------
A1K821_AZOSB/38-119VEK.ENWSLG--------------------
B0T974_CAUSK/38-120NSVLDDFSFG--------------------
D4YHW3_9LACT/38-119VNK.ENWSFG--------------------
D9WAV5_9ACTO/38-118NGS.QDWSFG--------------------
D5UG10_CELFN/38-112SPP.THWGIR--------------------
A9C379_DELAS/38-119VDK.ENWSMG--------------------
A9VV21_BACWK/39-123TSV.ENWSFG--------------------
D8MX59_ERWBE/38-118NGK.GDWSFG--------------------
D1AMD1_SEBTE/38-122IPR.ENWSFG--------------------
Q3KAR7_PSEPF/38-119VKK.ENWSFG--------------------
Q1I8I7_PSEE4/38-119VRK.ENWSFG--------------------
A7Z8K4_BACA2/39-120NAA.EDWSFG--------------------
Q89DY8_BRAJA/38-118APG.ENWSVG--------------------
D2BTM6_DICD5/38-119TTP.DDWSFS--------------------
Q6FAM7_ACIAD/38-114TPK.ENWGIR--------------------
E8XR93_RAHSY/38-122TQP.EDWSFS--------------------
D2S6L3_GEOOG/39-119NTR.EDWSFG--------------------
D2BWC8_DICD5/39-120IPL.ESMSFG--------------------
D5DA95_BACMD/38-118NGN.ADWSFG--------------------
Q65NT7_BACLD/38-118NVK.ENWSFG--------------------
D7DPH6_METS0/38-113NHD.IDWSFS--------------------
Q7NSY2_CHRVO/38-119GEM.DNWSFS--------------------
B2IF75_BEII9/38-119VAK.ENWSFG--------------------
B1LS78_METRJ/38-119NAR.DEWSFG--------------------
A4FIQ5_SACEN/38-118NTA.ADWSFG--------------------
A0NS28_9RHOB/49-130TKL.ENWSFG--------------------
D0RZI0_ACICA/36-118NSA.EDWCFG--------------------
F0TAP2_METSL/38-114PPM.ENWLFK--------------------
A5EML5_BRASB/38-118AAK.ENWSVG--------------------
A2SJ61_METPP/38-119VAK.ENWSFG--------------------
D7WQM9_9BACI/38-114TPK.HNWGIR--------------------
A5GTW6_SYNR3/38-118SNP.EDWSFG--------------------
D8JU73_HYPDA/38-118CND.EDWSFG--------------------
B9XKA7_9BACT/38-119VDR.SDWSFG--------------------
E0I4N7_9BACL/39-120NEF.EDWTFG--------------------
B4APB2_BACPU/39-121TGL.ENWSFG--------------------
B2J5J2_NOSP7/38-114TPK.SNWGIR--------------------
Q28PN6_JANSC/38-118NGP.IDWSFS--------------------
E5VQA7_9FIRM/38-118NSD.ADWSFG--------------------
F2Z288_9CORY/37-117NAP.HDWSFG--------------------
Q215U6_RHOPB/37-112VPT.PNWGLR--------------------
D0L5B9_GORB4/39-119NTR.EDWSFG--------------------
Q1ZAF8_PHOPR/38-121NEA.EDWSFS--------------------
Q393L4_BURS3/38-119VLK.EDWSFG--------------------
A9F6T6_SORC5/38-114SPA.HDWGFR--------------------
A7IDV7_XANP2/38-118APK.ENWSVG--------------------
B3PZS7_RHIE6/38-116QHQ.RPGRLV--------------------
Q11ST9_CYTH3/38-114SPK.HNWGIR--------------------
D1BU80_XYLCX/38-112SPR.ENWGIR--------------------
A6Q8U6_SULNB/38-114APA.YHFGFR--------------------
A8IN35_AZOC5/50-131SQL.EDWSFA--------------------
B6R0J0_9RHOB/38-118VEK.ENWSLG--------------------
C6D8V6_PECCP/38-119NTA.DEWSFS--------------------
F2LDE3_BURGS/38-120VAR.EDWSFG--------------------
C5BKG7_TERTT/36-112QAP.HQWGFR--------------------

PF01361

Y2002_DICD3/2-62VET-DNWGIGGESVTER-------------
YWHB_BACSU/2-61MRK-DHYAVAGKRLSDM-------------
Y574_LACLA/2-61LPE-GMLYQGGEMKKKK-------------
Y3814_BACHD/2-61MRK-DHYGVAGKRISDQ-------------
Y270_CAMJE/2-62VEN-YDIGFGGESVEAI-------------
4OT_PSEST/2-61MPK-VHFGIGGESAKAI-------------
Y924_HELPY/2-64VDS-NNYGLGGESVHHL-------------
Y921_STRR6/2-60MPE-GTYFPQGEM.RTK-------------
Y1725_XYLFA/2-61VPM-QDWMQQVYGPDIE-------------
YRDN_BACSU/2-61HPE-NHMIIEDTGLGFN-------------
4OT_PSEUF/2-61MPK-NHFGIGGEPASKV-------------
PPTA_ECOLI/2-58IQP-ESWQA....IWDA-------------
Y1363_STAAM/2-61MKP-NHYGVAGVRKSDQ-------------
4OT_COMTE/2-61VPK-ENWGIAGVSAKEL-------------
Q9EVV8_STRTR/2-61MPE-GTYYPHGEMKKKN-------------
O29588_ARCFU/2-60PPA-ENVGVGGKLIADR-------------
O27643_METTH/2-60FPP-EMWGLEVHSSVTG-------------
Q9K3M3_STRCO/2-63DAA-RGTLRYDDYPGVR-------------
Q9L0G0_STRCO/2-63VPD-GGWGVAGNVLTAA-------------
Q9EV85_PSEPV/2-61GSG-INFVEHGEHLPDY-------------
Q9L029_STRCO/2-61VTD-DNFVMQPVVFGLR-------------
Q9EV84_PSEPV/2-61HAE-ANMSISGRIHGEA-------------
Q98JE6_RHILO/2-63VAD-GGYGRADEVFVIP-------------
Q984V7_RHILO/2-61IDP-QHWFAGGKSLAEH-------------
O85975_SPHAR/2-61MAP-AHFAVGGLSFAAK-------------
Q9A468_CAUCR/2-62VAL-ENWGVGGLPVEAY-------------
Q98EB0_RHILO/2-65VNA-RDWYVGKTDVETL-------------
Q9R9T3_PSEPU/2-61MPS-NHFGIAGKSAKAL-------------

PF14832

B0XZS0_ASPFC/1-136APR-DLWKINGLAPPAAGSEEEKVWVRENR
A1CC92_ASPCL/1-136TPR-HLWKINGLVPPPAGSEEEKVWAEENR
E3RF02_PYRTT/1-154LRR-DLWKVQGMVPPMPGTEAEKEWVALGE
B8NVG2_ASPFN/1-142TER-RLWKINGMIPPPWKSEAEQLWVRENR
Q0SD71_RHOSR/1-153APF-ETWKIDGMTPPPPESPAERRWFEQNR
A9C0U3_DELAS/29-162TPF-SLWSIQGLRPPVPGTPEGEKWRLDNR
A5ELU6_BRASB/1-136TPF-DLWQIQGIAPPPPHSDHEKLWVQENK
A6SK63_BOTFB/1-138TER-RLWKINGMYAPPFGSQAEKEWVAANK
B1MJZ2_MYCA9/1-136TSQ-ELWMINGLVPPPMNSAAEREWARTNT
B6HS40_PENCW/1-136ASR-DLWKMNGLVPPEPESEGEKKWAELNK
B6HI01_PENCW/1-140TER-RLWRINGMIPPPFGSEIGQLWATENR
Q0U6R6_PHANO/1-142TER-RLWKINGLFPPTFKSEEEKTWARENR
Q0BSZ1_GRABC/1-135TPF-DLWMINGLKPPHPGTPAELKWRSENR
Q0CF32_ASPTN/1-140TER-RLWRINGLIPPPFKSDDERKWAKENK
A2QYI6_ASPNC/521-660TER-RLWRVNGFVPPPFGSDAEKLWAKENK
E3Q5I4_COLGM/1-139TDK-RLWKTYGFYAPPFGSEDEKTWARENK
Q398P0_BURS3/1-135TPF-GLWTIEGLRPPRPGTPADLKWRTENR
D5WHW6_BURSC/1-134TPQ-QLWLIDGIRPPRPDTAAEKKWKLENR
D9VBZ9_9ACTO/1-137TSE-ELWMINGLTPPPGGSAEEKAWAKDNA
Q0U745_PHANO/1-144LER-EFVHINGLRIPPTDSEDEKRWFRDNE
E9F5N7_METAR/39-184GDR-SLLRVQGMRMPSPGSEDEKKWVAENA
B6QU03_PENMQ/1-138GPP-QLWRINGIDPPEGVDASNEELVERNR
Q0SD79_RHOSR/1-135MPA-ELWRVDGLTPPPFRSPAEKRWMKDNK
E9F263_METAR/1-138GPA-ALWRIDGIDPPEAFGPDEQEQAEANR
Q4P6H1_USTMA/1-145PPA-DLWHLNGLSYPAPGTEAEAQWKAADK
C7YJ99_NECH7/1-141.SY-DSAFERGFFLPMPGKFE..EWVTGNE

PF08921

A3H1V4_VIBCL/1-106LQR-TAYYLDGQH-----------------
A8FVM5_SHESH/1-109LEP-ETYYRNGQH-----------------
Q8EEJ0_SHEON/1-109LTP-SASYRGGQH-----------------
A6D726_9VIBR/1-109LEP-ANYYDNGQH-----------------
Q6F289_MESFL/1-104INN-DLYVNNEKR-----------------
A6ATB3_VIBHA/1-109LSP-KGYYDNGEH-----------------
A4SQR6_AERS4/1-109IVK-SHYYSNGQH-----------------
A8H4B7_SHEPA/1-109LEP-STYYKDGQH-----------------
A9VL18_BACWK/1-107FTE-SAYYINGKH-----------------
Q188J0_CLOD6/1-108FEK-EKYYENGEH-----------------
B1KF64_SHEWM/1-109LDP-STYFRNGEH-----------------
Q39YS1_GEOMG/1-102LSP-SLYYKEGIP-----------------
A5TWA0_FUSNP/1-108LTG-DSYCDNGEF-----------------
Q1ZJL0_PHOAS/1-110LTA-TAYYDNGEH-----------------
Q2SR33_MYCCT/1-99VNS-KLY....AH-----------------
A1S6E5_SHEAM/1-107LDK-RGYYRDGRH-----------------
Q6MPG9_BDEBA/5-112LAK-EAYYENGIH-----------------
A3QED2_SHELP/1-109LTP-QCYYRDGQH-----------------
A4J4K9_DESRM/1-107FTK-NKYYENGQH-----------------
A6W1J4_MARMS/1-109LQG-KDYYENGEH-----------------

PF01187

MIFH_BRUMA/2-115IEA-SSMAFNGSTFG---------------
MIF_BOVIN/2-115MNA-ANVGWNGSTFA---------------
DOPD_RAT/2-116LEP-WQIGKKGTVMT---------------
DOPD_HUMAN/2-116LES-WQIGKIGTVMT---------------
MIF_CHICK/2-115INA-ANVGWNGSTFA---------------
MIF2_CAEEL/2-115LPP-ATVGFNGTTVA---------------

PF02962

HPCD_ECOLX/2-125LHPTLNFKQNNVHALF--------------
Q9RE14_KLEPN/2-125LHPTLNYKQNNVHALF--------------
Q9RYT1_DEIRA/2-126FSEAGTWKKNNIHARY--------------

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window