Sequence alignment for CL0090

PF01152

Q7CX73_AGRT5/7-128------------TLYEA-IGGD-----------------AT.VRALTRRFYELMDTL-PEAARCRAIH.-----------
TRHBN_PARCA/2-117------------SLFEQ-LGGQ-----------------AA.VQAVTAQFYANIQAD-AT..VATFFN.-----------
TRHBN_NOSCO/3-118------------TLYDN-IGGQ-----------------PA.IEQVVDELHKRIATD-SL..LAPVFA.-----------
Q93SP0_BURPE/47-168------------TAFEL-VGGE-----------------AR.VRELVDRFYDLMDLE-PEFAGIRALHP-----------
Q9L379_RHIML/8-129------------TLYEA-IGGD-----------------AT.VRALTQRFYELMDSL-PEAARCRAVHP-----------
TRHBN_TETPY/6-121------------TIYEK-LGGE-----------------NA.MKAAVPLFYKKVLAD-ER..VKHFFK.-----------
Q946U7_ARATH/26-144------------NLFDK-LGL.-----------------.QTFINLSTNFYTRVYDD-EEEWFQSIFS.-----------
TRHN1_CHLMO/44-158------------SLFAK-LGGR-----------------EA.VEAAVDKFYNKIVAD-PT..VSTYFS.-----------
Q94FG6_HORVU/26-146------------NVFEA-LGGT-----------------PQPFVDLSTNFYTRVYED-EEEWFREIFS.-----------
TRHBN_MYCTU/14-129------------SIYDK-IGGH-----------------EA.IEVVVEDFYVRVLAD-DQ..LSAFFS.-----------
Q9X7B3_MYCLE/7-126------------SFYDA-IGGA-----------------ET.FKAIVSRFYAQVPED-E...ILRELYP-----------
Q8XXM3_RALSO/11-129------------LAFDL-LGGE-----------------AR.VRELADRFYDLMDLE-PAFAELRALHP-----------

PF11563

Q5B5X9_EMENI/37-216------LEARINYLKDF-LDFN...SSDMEALASGAKYIKTLIPAVVNLVYRKLLEY.DI--TARSFHTKDTASEAP...
A2QBB3_ASPNC/24-203------LEARIDYLQRF-LDFN...ADDIATLVRGAKYVKALAPTVVDKVYVKLLEF.DI--TARVFRTRNTAVEEE...
C4JH72_UNCRE/22-201------LEARIRYLHNF-LDFN...SNDIEALITGSKYIKTLIPAVVNIVYKKLLQY.DI--TARAFQTRSTSFEGS...
C4XIT4_DESMR/15-174------TRQDIRRRKEL-LGFT...EEDAQTLAELKLDIGLIVSSIVDEFYDDQVTK.PE--IERTIGD...........
E5W582_9BACI/29-184------QHAEFKKQLAM-VDLT...DEDLWVLSRLKPLVTEHIETIVTRFYQNLEHE.SS--LMEIIHD...........
D4AN62_ARTBC/20-213------LPSRVNYLKAF-LKFT...DEDGAAIQSAKGLIAPALPAILDTIYTNLIGF.DV--TAKSFVPPQPEQDKSTVS
E9E781_METAQ/19-198------LEARIQYLHSF-LDFS...SNDIEALISGAKYIKALVPAVVNIVYRKLLQY.DI--TARAFTTKNTTQGGE...
A7Z344_BACA2/28-184------QYADVQKQLKM-VRLG...NEELHVLEELQPLIKEHISTIVDSFYRNLDHE.KS--LMTIIND...........
E2CMR8_9RHOB/3-158------EQSSIEGRCRF-FKIA...DADAQTARESWPLIEKHLPGILGRFYAHLKTE.PH--LKDLVGD...........
B6BGM2_9PROT/15-171------TEFEITNRKLL-FNLG...DTDFEFLRKCKTFIEPRMDELVDAFYEMQTSV.PE--IALLIGD...........
E6U0Q9_BACCJ/24-180------KGTEMERQLKM-INLT...EKDLEVINAIQPFISKRINVIVDRFYKNLEIE.SS--LLDIIND...........
B6HCY7_PENCW/23-203------LEERIKYLHNF-LDFN...SADIEALLTGNKYIKQLIPAVVNLVYKKLLQY.DI--TSRAFHTRTTVDERE...
Q218B7_RHOPB/3-166------NTSTIAERLRF-NSID...QETIAALRAGKAFVLAELEPILDRFYQHIARF.PE--VSAHFKT...........
A9H610_GLUDA/3-169------KESQIVERLSF-MNLD...STAQQNIKNAKPILMKALPGALDTFYDQARTF.PH--TAQFFHN...........
B8G873_CHLAD/22-196------SLADFELLKQA-VMFG...PDDERYLRMAGEVLADQIDDVLDLWYGFVGSH.PH--LLYYFTDGQG........
D3FWD3_BACPE/27-184------NDKEIDMRMAY-MGFS...TQSTEYLQELQAFVDEHADALLEAILDHVYSF.PH--LKKIAET...........
B7GLD2_ANOFW/25-175------FHGRFIDTLSY-NHFT...TEDFAKLKQIDELIAPHKQEMVHLFYEGLKQVQPE--ATKTITE...........
A4Y0T1_PSEMY/34-186------DPHELSQRQRF-LNWS...QIDNERLARHAPRLERANRQFIDALYERLAQY.PA--PAAILDD...........
C4L4W7_EXISA/25-181------LPSELERQRQL-IRLE...REDLAYLRAYQQELRQLTPQLVDVFYEELEKI.DE--MKDLIRQ...........
A1C4D9_ASPCL/22-201------FPKRMAYIQAF-INFT...RDDITTFNKGARYLKAAIPGLTHRLYEKMLEF.DI--TARALRTRSTSSEVQ...
Q7NUX9_CHRVO/5-158------EMALLANMCRF-IGIR...TEHLAQLPRHADAGLARRELLGKELYWHLLKS.PG--EAERLQRH..........
E0SCN2_DICD3/9-166------NELLLAEWQEL-VNLT...SSDAHEL..LRDLCEEELRQLVSVFYDYMLQD.KK--ASLYLNT...........
E1IAY4_9CHLR/13-164------GAAVLDELIAL-MGLT...AEDARLLGALEATAAARGPQMADDFYGRLGAH.AQ--AVEFIAD...........
C7Z0G0_NECH7/17-196------LEARIDYLHKF-LDFD...DRDLEALAFGSKFVKDLIPAVVHIVYRKLLQF.DI--TARAFEIRDTTSEAP...
A9GCE3_SORC5/10-164------QETLFDEIKRY-VRFS...EQDERWLAVLRAHAEPHFPRIADEFYDRIREH.EG--AHDVFTG...........
Q2BAH3_9BACI/31-187------LSEEVLRQIDM-IGLQ...DSDLNYILSLQPYVKGNLPAIIEQFYKNLENE.KT--LTKIIND...........
F0XJU9_GROCL/20-199------LDARIQYLHSF-LDFS...STDIDHLVAGAKYIKVLIPAVTNIVYRKLLQY.DI--TARAFETRSTSFEGP...
Q5WC98_BACSK/26-182------DESDCQKQIGF-IDLH...ASDLEYIHLLYPLVNEHIAPITEAFYEKLLEQ.PH--LRQLVTT...........
Q9KFH4_BACHD/32-188------AESELSAQLRM-IHLT...LDDLKRMKALQPLVEENMEVLADAFYSNIIKQ.PN--LNEIIET...........
B9JTP3_AGRVS/26-192------QAGSLRDRLNF-AGLD...QDACSLLRRHRVGLETDVETGLHAFFRKLQTA.PD--AARQFTG...........
D2QY57_PIRSD/6-164------IHSRYRDLKRY-VGFT...DEDAERISAARPTLALHIPALVADFYAELQRH.PD--AVKVITG...........
A9CYE4_9RHIZ/13-180------AADGLRARLDL-TALD...TEGCERLREIRPMIEAEARMALKGFFERLQNT.PE--IASLFSS...........
B1YHV6_EXIS2/30-187------SDPSLTGRLEY-MGYT...EEHLQTLKAMAPVVNSILDEVLEQVLDHLLLH.PE--MVQIAQT...........
B9JUN1_AGRVS/7-170------DNGELHKRMAF-LKLT...ASDLQVVAGLQPIIAHSIGPTLDVFYQTAKQH.PE--AAKFFSS...........
E1FPN0_LOALO/43-200------PRPSISSQGR.-.KVS...ALGLSQRQIVKECMDKAKDDIAERIYRRITEKRDD--FRKFVEAL..........
Q3IUQ9_NATPD/29-196------DADEIEWRKEF-TRFD...EDDAETLAEHAGTFERIADDLVEDFYDHLQSH.PE--TVDVIDS...........
C5G9L3_AJEDR/20-214------LKSRLSYVKGF-LHFT...EKDGAFIQAAKEIIAPAVPAVLDAVYTRLLSF.DI--TAKSFVPRQPEQDTNEPA
A2QT04_ASPNC/23-202------LEARVRYLQQF-IGFT...ADDVIALNRGSKYIKALAPTLVDRVYSKLLEA.DI--TARVFQTRSTTSELD...
C7ZI09_NECH7/13-198------LEARIDYLHKF-LDWD...DRDIEALAYGAQHIQNLIPAVVHIIYHKLSEF.DI--TARAFEVRNTSSESP...
A0RLK6_BACAH/33-189------TNSELKVQMDM-LHIS...KEDLQIVKVLQPFIYEEIDWITEKFYANITKQ.PN--LITIIER...........
E6QCH0_9ZZZZ/6-160------KDANLKAFCHI-GGLC...KEDQEIMTRVGPGIVPHVPLLTDRFYEILQED.QQ--TAPYIDG...........
B1HNN8_LYSSC/36-192------NHPNLQKQLQL-LNLT...IEDLAIIKQLQPLANDLIPAMVEQFYAAISLS.QD--LIDIINR...........
B1YG08_EXIS2/27-183------AGSAFAQQLQL-IDLT...VEDLQIVRLIRHDVAEWMPQMVDAFYAELVRV.PE--LKQLIER...........
C0S330_PARBP/20-213------LKSRIAYAKSF-LQFT...EEDGALIQSAKDIVAPAVPAILEAVYTKLLSY.DI--TAKSFVPRQPEQAATEP.
D8F6T6_9DELT/21-177------VMHSIESILRR-YDFT...DQDEVLLKKMAELFMPIHDRFADDFYRYLQED.DY--TAGYFRT...........
A0KND7_AERHH/15-171------TEFEIAHRKEL-LLLD...ERDFALLASYRPKIEPHIDALVDKFYTLQTGI.TE--IALLIGD...........
A6U611_SINMW/13-179------QAASLLERLRF-AGLD...EDACALLRDHRQALSPRIELALRALSHRLQTH.PD--AARHFDS...........
B9LL08_CHLSY/21-195------SLEEWELLKQT-VLWT...AEDEQYLRMAGEVLGDQVDAILDLWYGFVASH.AH--LVYYFTGSDG........
D8PPS9_SCHCM/66-254------INARMVYLKDF-VNFT...RHDEDAIRHVGPLINDLIPEVVDALYSKLFEF.DI--TKQVFMQRNDGFDGPI..
B3QU69_CHLT3/11-161------DEAILEELLAM-TRMT...EEEKKVLGEMRSQAESIVGEMINAFYDRLLSH.EN--TSEYLSD...........
B2IB39_BEII9/3-168------DSSALQERLDF-MEIE...AATKASLNALWPQVESAIGPILTRFYDKISRT.PA--TSRFFTD...........
Q3JC52_NITOC/22-196------SLEDFDLLKKT-VLFT...EEDEKYLRLAGEVLGDQVEEVLDLWYGFVGSH.PH--LVRYFSDLQG........
D2R7K0_PIRSD/13-194------VAYRFGYLAEF-MNVT...ADDLATVAAAGPHLAPVIPALVDAVYEKLAQY.DA--TWRHFVPRNAGYDGPT..
Q2Y8W7_NITMU/15-174------DKDRIRQALSL-LGLAADHKEEAAAINLLTEFIAERVDKIINSCLAVIAGS.DD--FELIERNI..........
A0NQE6_9RHOB/4-159------QDYDFQTRLKF-AQID...QATIETLRKLWPVIEPVLDDVLEGFYEHIKTQ.PN--LAALVGT...........
F2F0J0_SOLSS/31-187------SMPELAQQMNL-IGLA...EENLRHIKSYQPAIAAGVSEITDVFYENVLAV.PS--LKKIIEE...........
A7NNZ1_ROSCS/12-163------NEATLGELVQL-MNLS...ADEAAILKSLQDKAHQQAPAMREDFYERLLSH.PQ--TAEYFSN...........
F2F399_SOLSS/32-188------TYPNLHKQIEL-LKLT...KEDLAVIKQLEPFAQQVVPDMVEKFYGAISLS.PE--LVDIIGS...........
C0ZJ13_BREBN/21-178------MSDQLTGKIHF-LQMN...QTDLDRLKQIEPLLTEHLEAITERHYHMLCQY.SH--LMQIIET...........
B8GZ88_CAUCN/7-171------QDYAIGERTAF-MGID...DKARSALRDLRPVIRAEIGKALDNFYGKVRAT.PE--TRKFFSD...........
E8PQN4_THESS/9-162------AREALEQMPAE-TRLR...PEDTQVILQHKDVLLSWSRELLQTFFDTLFAH.PP--TRRIFRE...........
B3PPJ5_RHIE6/10-176------QAGSLRDRLRF-AGLD...ADQCELVRRNRPALEAHLKAGLRDIFHRFQSF.PD--ASRNFES...........
B0ULQ7_METS4/3-159------SDADLDGRLTF-LEID...AATAAMLPRLWPAIAPELPRIMARFYDKMLRT.PH--LAGMIGT...........
C6WYR1_METML/18-175------SADEVQSRKDF-LEFS...ERDSQLLKELGTLLAPLEGVFADLLSEHLDAH.PA--IAASHIH...........
B9J942_AGRRK/14-180------QAGSLRDRLRF-AGLA...AEQCEIVRRNRPMLETHLKAGLRDLFHRFQTF.PD--AARNFAS...........
C0ZKX8_BREBN/35-191------GKSTLAKQLAM-INLT...EEELSIVKALQPLIIQNIEAIIDYFYASIENE.PL--LMKIVDQ...........
F0L5Z4_AGRSH/14-180------AGASLAGRLRF-AGLD...ETQSDFLRNYRSMLEPYVKAGLRDVMNRFQSM.PD--CSPSFES...........
A9CJK8_AGRT5/7-170------TDRQLDERLNF-LGLG...HGERQNLSDMKGVITGSLDASLDRFYTKVRAV.PE--TAKFFSS...........
C4KYX4_EXISA/28-185------SDSSLNGRTHY-MGYT...TSQVKRLQDMAPLVESVLDDVLENVLDHLMLQ.PE--MVQIANA...........
B2W0B6_PYRTR/24-203------LESRIQYLHSF-LDFS...SRDIEALSSGAKIIRTLIPAVVNIVYKKLLQY.DI--TARAFTTRSTSYSGR...
Q2B756_9BACI/36-190------FDQDLKLQIEV-MGLT...KEDLAILRAVRPIAEKHISAV....YNKLLTYEQE--DVRKITD...........
E3EZY8_KETVY/10-171------AAADMENRLPF-IALD...SAAQQRLRSLAGPIGAAMGPALDDFYARVAQT.PA--LRHHFPT...........
Q1AU74_RUBXD/22-196------SLEELDLLRQT-VLFT...GEDERYLRMAGEVLEGRLDELLDVWYGFVADH.SH--LVYYFSSPEG........
D4G784_BACNA/30-186------KHADVKKQLKM-VRLG...DAELYVLEQLQPLIQENIVYIVDAFYKNLDHE.SS--LMDIIND...........
A4U4W9_9PROT/44-195------MTERVTQYLDL-FQVD...DAAQRLIADNCGKVVASVETMVNRASDWVQRT.PP--FGEKMNS...........
A8IPP6_AZOC5/62-225------TQESLSQRLNF-IGMD...KALQASLREARDLVVAAMPKILDGFYDHLMTY.PD--MARMFPT...........
Q1GI20_SILST/15-172------EASQHNNTLSW-FDIT...PADQERVRSLAPIADHVGEEIIADFYAHILRF.ED--AAQQFAD...........
D5QTN2_METTR/7-172------QPMTMEQRLAF-IDMT...DEARAALRCLEPVLLRALGPALDAFYEKVRAD.SK--LRAFFGD...........
D0Z3L2_LISDA/18-174------NEHDIEQRKIS-LSFV...EQDEVNLQQCLKWLEPLIPQVVQEFYQHQVSI.PE--IALIIGD...........
B2AU65_PODAN/21-200------LEARVKYLHSF-LDFG...VSDIEALKSGSKYIQALIPAVVNIVYKKLLQY.DI--TARAFTTRSTAFEGP...
Q0UTR0_PHANO/18-193------LESRIEYLHSF-LDFS...SRDIEALTHGAKYIQALIPAVVNIVYKKLLQY.DI--TARAFTTHTTASSLP...
A2R286_ASPNC/23-202------FSKRMDFLRLF-LDFT...DDDIIVFNKGAKFLKAALPVLTHRLYAKMLDF.DI--TARALRVRSTESEAQ...
A9EVT1_SORC5/5-161------LEREVEDRRAF-FQIT...DEDLARIAALRPHAEKRTERIVDAFYELLLDF.GP--TRELFRD...........
B3PZF3_RHIE6/6-169------TDSALKQRLDF-IELD...EAARKSMRDLRPVISELVGGALDKFYAKIART.PA--VSSFFTD...........
B8N2G0_ASPFN/23-202------FGKRMEYIKTF-LDFT...DDDVIIFNKGSKYLKTVIPELTHRLYEKMLEF.DI--TARALRTRSTTSEAQ...
C9PHR9_VIBFU/9-167------PGNAIRRWASY-LAID...QQTVDALREYYWIMERNIDEVLAFVYDHLGSC.PE--TAQFYQN...........
C4JKA6_UNCRE/20-213------VASRVAYLKAF-LKFT...DEDGAALNAAKPVIAPAIPAVLDTIYTNLISF.DV--TAKAFVPRQPEQDEHDP.
D2VCV6_NAEGR/13-197------LPYRFAYVAKF-VGFG...EEDVKYIHESAAVLAPLVPTVVDLVYKKLFSF.DV--TKKTFMVRNDKFQGKME.
Q9YFF4_AERPE/20-195------TDLEFDLLKKT-VMLG...EKDVMYLKKACDVLKDQVDEILDLWYGWVASN.EH--LIYYFSNPDT........
A3UD76_9RHOB/19-184------IRADLGSRLEF-LDFS...ESDRESLRRLKPFIEQILPGVLDQFYADVLDT.PA--TAAFFPT...........
Q467X0_METBF/21-195------NLEDLKLLKDS-VMFT...EEDEKYLKKAGEVLEDQVEEILDTWYGFVGSH.PH--LLYYFTSPDG........
B4VTT9_9CYAN/5-160------AHAFMETMAKR-ISFT...DEDKAILKANADWGKDIAPEMADHFYAYLGRD.PE--MSEILNA...........
F0SHW9_PLABD/6-164------DYQRFLDLKSY-VGWT...DDDNACSDELLTLLSDEIGPILDDFYTEIKKH.RA--AWRVITG...........
B9R0Q8_9RHOB/2-157------QNQTLKGRLAF-FRFT...EEDRTLARSIWPTLSSHLPRIMDGFYDHVKTV.PH--LATMIGD...........
A8FBP1_BACP2/29-185------DNTDIAKQIKM-IDLT...QNDLLILNQLNSIVQEDIAHIVDKFYKNLEVE.SS--LMHIIQD...........
E1IA86_9CHLR/11-162------DEATLTELVAL-MNLS...PEEIAVMKDMLPEAQAAAPGMTKTFYERLFAH.DA--TAEYLKN...........
B3G4N6_9BILA/14-197------LRYRFTYVSKF-VNFT...TDDIAALNKFAKVANPFIHSVSDTIYQKLLAY.DI--TRNHFVDHDDDSKSGS..
A8P1M8_COPC7/13-202------FAYRIQYLRDF-IEFT...SEDAAALHAARPVVAPLVPLVVDTVYEKLLSF.SV--TAKAFVPRQTGYSGET..
A1CRU6_ASPCL/32-212------LEARINYLRDF-LDFN...SSDIEALTTGSKYIKALIPAVVNIVYKKLLEQ.DI--TARAFITKDTADETT...
A4WIC7_PYRAR/17-191------SDADFESLKKT-VMWG...EEDEKYRKMACEALKGQVEDILDLWYGWVGSN.QH--LIYYFGDKSG........
B8GYU4_CAUCN/48-212------ANAKLDQRMAF-MRFD...ERSRAHLRAIKPVIDAEIGAALGQFYSQVRLF.PD--TRVKFRD...........
A6SIY0_BOTFB/18-197------LETRIHYLHSF-LDFS...SRDIEALIYGSKYIKQLIPAVVNIVYRKLLQY.DI--TSRAFTTRSTSYEGP...
Q47S02_THEFY/23-197------GLEDLNKLKTT-VMFT...SADEEALRMAGDVLEDQVEDVLDVWYGFVADH.PH--LLAYFSTPDG........
A3I971_9BACI/25-181------NRQLMVKQIEM-LNVT...KQDLQYLKAFQPYVMDNVDHIVNRFYNMIGTE.QH--LVNIISH...........

PF00042

Q19601_CAEEL/105-215------ERILLEQSWRK.TRK.--------------....TGADHIGSKIFFMVLTAQPD--IKAIFG.---------L.
GLB1B_ANATR/17-122------QKDLLRLSWGV.LSV.--------------.....DMEGTGLMLMANLFKTSSA--ARTKFAR---------L.
HBP1_CASGL/7-116------QEALLKQSWEV.LKQ.--------------.....NIPAHSLRLFALIIEAAPE--SKYVFS.---------FL
GLB1_PARCH/17-123------QKKIVRKTWHQ.LMR.--------------.....NKTSFVTDLFIRIFAYDPA--AQNKFPQ---------M.
MYG_GALGA/3-108------DWDKVNSVWSA.MEA.--------------.....NITAVGQNILLRLFEQYPE--SQSYFPK---------L.
HBAT_HORSE/7-107------DRATVRALWKK.MGS.--------------.....NVGVYATEALERMFLGFPS--TTTYFLH---------L.
HBA1_PLEWA/7-107------DKHNVKAIWDH.VKG.--------------.....HEEAIGAEALYRMFCCMPT--TRIYFP.---------A.
HBB0_MOUSE/8-112------EKAAITSIWDK.V...--------------.....DLEKVGGETLGRLLIVYPW--TQRFFDK---------F.
HBA1_XENBO/7-107------DKKHIKAIMPS.IAA.--------------.....HGDKFGGEALYRMFLVNPK--TKTYFPT---------F.
GLB_PAREP/8-117------QDILLKELGPH.V.DT--------------...PAHIVETGLGAYHALFTAHPQ--YIIHFSR---------L.
HBB1_CYGMA/8-112------ELTIINDIFSH.L...--------------.....DYDDIGPKALSRCLIVYPW--TQRHFSG---------F.
MYG_CYPCA/3-108------DAELVLKCWGG.VEA.--------------.....DFEGTGGEVLTRLFKQHPE--TQKLFPK---------F.
HBB2_XENLA/8-112------EKAAITSVWQK.V...--------------.....NVEHDGHDALGRLLIVYPW--TQRYFSN---------F.
HBAZ_CAPHI/7-107------ERTIILSLWSK.IST.--------------.....QADVIGTETLERLFSCYPQ--AKTYFPH---------F.
HBF1_URECA/7-113------QIKAIQDHWFLNIKG.--------------.....CLQAAADSIFFKYLTAYPG--DLAFFHK---------F.
HBB1_XENBO/7-111------DRQLINSTWGK.V...--------------.....CAKTIGKEALGRLLWTYPW--TQRYFSS---------F.
LGB1_LUPLU/8-116------QVALVKSSFEE.FNA.--------------.....NIPKNTHRFFTLVLEIAPG--AKDLFS.---------FL
MYG_HETPO/3-108------EWEHVNKVWAV.VEP.--------------.....DIPAVGLAILLRLFKEHKE--TKDLFPK---------F.
HBAD_LIOMI/6-106------DRRLLQASVGK.LGC.--------------.....RLEDIGADALNRLLITFPQ--SKTYFSH---------F.
HMP_ECOLI/6-103------TIATVKATIPL.LVE.--------------.....TGPKLTAHFYDRMFTHNPE--LKEIFN.---------M.
Q18311_CAEEL/32-140------TKKLVIQEWPR.VLA.--------------.....QCPELFTEIWHKSATRSTS--IKLAFG.---------I.
GLB73_CHITH/23-129------EASLVQSSWKA.VSH.--------------.........NEVDILAAVFAAYPD--IQAKFPQ---------F.
HBB_LITCT/1-105------GGSDVSAFLAK.V...--------------.....DKRAVGGEALARLLIVYPW--TQRYFST---------F.
HBBN_AMMLE/2-106------BKALITGFWSK.V...--------------.....KVBZVGAZALGRLLVVYPW--TZRFFZH---------F.
HBAM_LITCT/6-102------EKSAVASLWEK.IAP.--------------.....QTNKLGAESMERLFKNHPE--TKSFFSR---------F.
HBA3_PLEWA/7-107------EKALVVGLCGK.ISG.--------------.....HCDALGGEALDRLFASFGQ--TRTYFSH---------F.
HBAD_PASMO/6-106------DKKLIQQIWGK.LGG.--------------.....AEEEIGADALWRMFHSYPS--TKTYFPH---------F.
HBB_HETPO/7-106------ELHEITTTWKS.I...--------------.....DKHSLGAKALARMFIVYPW--TTRYFGN---------L.
Q9ZAX1_MYCBO/42-136------DALRVLQNAFK.L...--------------.....DDPELVRRFYAHWFALDAS--VRDLFP.---------P.
HBA_LEPPA/7-108------DEVLIKEAWGL.L.H.--------------.....QIPNAGGEALARMFSCYPG--TKSYFPH---------FG
GLB8_CHITH/9-115------QLALFKSSWNT.VKH.--------------.........NEVDILYAVFKANPD--IQAKFPQ---------F.
GLB2_LUMTE/8-114------EGLKVKSEWGR.AYGS--------------...GHDREAFSQAIWRATFAQVPE--SRSLFKR---------VH
Q20638_CAEEL/74-184------EKELLRRTWSD.EFD.--------------.....NLYELGSAIYCYIFDHNPN--CKQLFP.---------F.
HBB_ALLMI/7-111------ERKFIVDLWAK.V...--------------.....DVAQCGADALSRMLIVYPW--KRRYFEH---------F.
HBA_CATCL/6-107------DKADVKIAWAK.ISP.--------------.....RADEIGAEALGRMLTVYPQ--TKTYFAH---------W.
HBA_SQUAC/6-107------DKTAIKHLTGS.LRT.--------------.....NAEAWGAESLARMFATTPS--TKTYFSK---------F.
GLB2_TYLHE/9-115------QRLKVKQQWAK.AYGV--------------...GHERVELGIALWKSMFAQDND--ARDLFKR---------VH
GLB1_GLYDI/6-111------QRQVIAATWKD.IAGA--------------....DNGAGVGKDCLIKFLSAHPQ--MAAVFG.---------F.
GLB10_CHITH/11-117------EVEQVQATWKA.VSH.--------------.........DEVEILYTVFKAHPD--IMAKFPK---------F.
HBB_LEPPA/7-111------EKQYIVSVFSK.I...--------------.....DVDHVGANTLERVLIVFPW--TKRYFNS---------F.
GLB1_TYLHE/7-110------QRIKVKQQWAQ.VYSV--------------...GESRTDFAIDVFNNFFRTNPD--RS.LFNR---------VN
HBA1_TORMA/6-107------NKKAIKNLLQK.IHS.--------------.....QTEVLGAEALARLFECHPQ--TKSYFPK---------F.
GLB6_CHITH/22-128------QADLVKKTWST.VKF.--------------.........NEVDILYAVFKAYPD--IMAKFPQ---------F.
GLB_BUSCA/6-116------QKTALKESWKV.LGAD--------------...GPTMMKNGSLLFGLLFKTYPD--TKKHFKH---------F.
GLBH_CAEEL/10-119------DLC.VKSLEGR.MVGT--------------E..AQNI.ENGNAFYRYFFTNFPD--LRVYFKG---------A.
GLB2_NIPBR/16-114------PISKAQQ......AQ.--------------.........VGKDFYKFFFTNHPD--LRKYFKG---------A.
GLBH_TRICO/30-132------DVVPLGSTPEK.L...--------------........ENGREFYKYFFTNHQD--LRKYFKG---------A.
GLB_PSEDC/21-134------TRELCMKSLEH.AKVG--------------T..SKEAKQDGIDLYKHMFEHYPA--MKKYFKH---------R.
GLB_CERRH/6-116------SKSALASSWKT.LAKD--------------...AATIQNNGATLFSLLFKQFPD--TRNYFTH---------F.
GLB2_CHITH/22-128------EASLVRGSWAQ.VKH.--------------.........SEVDILYYIFKANPD--IMAKFPQ---------F.
GLB_TUBTU/6-112------QRFKVKHQWAE.AFGT--------------...SHHRLDFGLKLWNSIFRDAPE--IRGLFKR---------VD
GLB3_LAMSP/7-113------QRLKVKRQWAE.AYGS--------------...GNDREEFGHFIWTHVFKDAPS--ARDLFKR---------VR
GLB_ASCSU/21-134------TRELCMKSLEH.AKVD--------------T..SNEARQDGIDLYKHMFENYPP--LRKYFKN---------R.
GLB1_CALSO/5-105------DIKNVQDTWGK.LYD.--------------....QWDAVHASKFYNKLFKDSED--ISEAFVK---------A.
GLB2_CALSO/5-108------DIAAVQTSWRR.CYCS--------------...WDNE..DGLKFYQTLFDSNSK--IRHAFES---------A.
MYG_ALLMI/7-113------EWKHVLDIWTK.VES.--------------.....KLPEHGHEVIIRLLQEHPE--TQERFEK---------F.
Q21978_CAEEL/165-283------SCEVVADSWRL.VESR--------------SSAAETSACFGLFVFQRVFSKIPM--LRPLFG.---------L.
HBB_SQUAC/7-107------EKALVNAVWTK.T...--------------.....DHQAVVAKALERLFVVYPW--TKTYFVK---------FN
GLB3_TYLHE/8-117------DRHEVLDNWKG.IWSA--------------E.FTGRRVAIGQAIFQELFALDPN--AKGVFGR---------VN
GLBT_CHITH/13-116------QVAAVKGDWEK.IKG.--------------.........SGVEILYFFLNKFPG--NFPMFKK---------L.
GLB3_CHITH/20-120------QISTVQASFDK.VKG.--------------.........DPVGILYAVFKADPS--IMAKFTQ---------F.
GLB1_CHITH/21-126------QIAAAKASWNT.VKN.--------------.........NQVDILYAVFKANPD--IQTAFSQ---------F.
LGB1_MEDSA/7-112------QEALVNSSWEA.FKQ.--------------.....NLPRYSVFFYTVVLEKAPA--AKGLFS.---------F.
GLBC_NIPBR/21-135------DVK..KHTVES.MKAV--------------P.VGRDKAQNGIDFYKFFFTHHKD--LRKFFKG---------A.
HBA1_IGUIG/6-106------DKNHIRAIWGH.VDN.--------------.....NPEAFGVEALTRLFLAYPA--TKTYFAH---------F.
HBA1_BOSMU/6-106------DKGNVKAAWGK.VGG.--------------.....HAAEYGAEALERMFLSFPT--TKTYFPH---------F.
GLB_APLJU/6-113------DAGLLAQSWAP.VFA.--------------.....NSDANGASFLVALFTQFPE--SANFFND---------F.
HBA_HETPO/13-114------DRAELAALSKV.LAQ.--------------.....NAEAFGAEALARMFTVYAA--TKSYFKD---------Y.
BAHG_VITST/6-103------TINIIKATVPV.LKE.--------------.....HGVTITTTFYKNLFAKHPE--VRPLFD.---------M.
GLB4_TYLHE/8-117------DRREVQALWRS.IWSA--------------E.DTGRRTLIGRLLFEELFEIDGA--TKGLFKR---------VN
GLB4_LUMTE/11-120------DRREIRHIWDD.VWSS--------------S.FTDRRVAIVRAVFDDLFKHYPT--SKALFER---------VK
HBP2_CASGL/13-122------QEALVVKSWSA.MKP.--------------.....NAGELGLKFFLKIFEIAPS--AQKLFS.---------FL
GLBP1_GLYDI/7-115------QVAALKASWPE.VSAG--------------....DGGAQLGLEMFTKYFHENPQ--MMFIFG.---------YS

PF00502

PHEA1_SYNPW/6-164TTVVTAADAAGRFPSQNDLEAVQGNIQRAAARLEAAEKLAAGLDAVTKEAGDACFNKYPY--LKQ.PGE-----------
PHAA2_FREDI/5-161TKMILNADAEVRYLTPGELDQINIFVKSSQRRLQLVEALTQSRATIVKQAGKDIFQRFPR--LVAPGGN-----------
PHAC_SYNP6/5-161SQVILKADDELRYPSGGELKNITDFFKTGEQRLRIAQVLSDSEKKIVDQASRKLWQRRPD--FIAPGGN-----------
PHAA_AGLNE/5-161TKSIVNADAEARYLSPGELDRIKSFVLSGQRRLNIAQILTDNRENIVKQGGQQLFQKRTD--IVSPGGN-----------
PHCA_AGLNE/6-162TEAIACADSQGRFLSNGELQSINGRYQRATASLEAAKSLNNNAQRLITGAAQAVYTKFPF--VTQMPGP-----------
APCF_AGLNE/6-167TNILNKYDLTGKYLDNNALTQITTYLNTALQRLEVVEIIQSQSSKIIKEAAARMYSEQPE--LLRPGGN-----------
PHEA_FREDI/6-164TTVIAAADAAGRFPSTSDLESVQGSIQRAAARLEAAEKLANNIDAVATEAYNACIKKYPY--LNN.SGE-----------
PHAC_FREDI/5-161SQVILQADDELRYPSSGELKSIQAFMQTGVKRTRIASTLAENEKKIVQEATKQLWQKRPD--FISPGGN-----------
PHEA2_SYNPY/6-165TTVVGAADSASRFPSASDMESVQGSIQRAAARLEAAEKLSANYDAIAQRAVDAVYAQYPN--GAT.GRQ-----------
PHBB_MASLA/6-165TSLIKNYDVAGRYFDRNAIESLKSYFESGTQRVQAAKAINANAAAIVKQTGSKLFDEQPE--LIRPGGN-----------
PHCA1_FREDI/6-162TEAVAAADSQGRFLSSTEIQTAFGRFRQASASLAAAKALTEKASSLASGAANAVYSKFPY--TTSQNGP-----------
PH6B_CHRSP/6-177SRVVTGADSKAAYVGGADLQALKKFVSEGNKRLDAVNAIVSNASCIVSDAVSGMICENPS--LISPSGE-----------
PHEA_NOSS1/6-162TEAISAADVRGSYLSNTEMQAVFGRFNRARAGLAAAQAFSNNGKKWAEAAANHVYQKFPY--TTQMSGP-----------
PHEA_AGLNE/6-163TTTISARDAAGRFPSRSDLESVQGNIQRSAARLEAAEKISAGHEGVVKEAGDACFAKYTY--LKT.SGE-----------
PHEB2_SYNPY/6-178SRKAVSADSSGAFIGGGELASLKSFIADGNKRLDAVNALSSNAACIVSDAVAGICCENTG--LTAPNGG-----------
PHEB_NOSS1/6-172SKVVEQADRKGNYLSGDEINALSALVADSNKRLDIVNRLTSNASSIVANAYRALVAERPQ--IFNAGGA-----------
PHAC_CYAPA/5-161TQILLNADDELRYPTSGELETIKSFLKTGNKRISIINNIAQNEKKIIEQASKQLWQVHPE--YISPGGN-----------
APCF_CYAPA/6-165TSLIATYDVTGKYFDDNAVDTLNAYFSTASARIESVKIINANVSTIIKTAASALFDEQPE--LIAPGGN-----------
PHEB1_SYNPW/6-184SRSVVSADAKTAAVGAGDIAALRQYVAEGNKRLDAVNAITSNASCIVSDAVTGMICENTG--LIQAGGN-----------
PHCB1_FREDI/6-172AKVVSQADARGEYLSGSQIDALSALVADGNKRMDVVNRITGNSSTIVANAARSLFAEQPQ--LIAPGGN-----------
PHCB_SYNP2/6-172TRVVSQADARGEFISSDKLEALKKVVAEGTKRSDAVSRMTNNASSIVTNAARQLFADQPQ--LIAPGGN-----------
PHAB_AGLNE/6-161TSVINTADVQGKYLDDSSLNKLKGYFATGELRVRAAATIAANAANIIKESVAKALLYS.D--ITRPGGN-----------

PF01152

Q7CX73_AGRT5/7-128-----------PADL--SGSEAKFYDYLTGY------LGGP-----PVYVEKHGH-PMLRRR------------HFVA..
TRHBN_PARCA/2-117-----------GIDM--PNQTNKTAAFLCAA------LGGP-----NAWTGRN..-..LKEV------------HANM..
TRHBN_NOSCO/3-118-----------GTDM--VKQRNHLVAFLAQI------FEGP-----KQY...GGR-P.MDKT------------HAGL..
Q93SP0_BURPE/47-168-----------.PTL--EGSRDKLFWFLCGW------LGGP-----DHYIERFGH-PRLRAR------------HLPF..
Q9L379_RHIML/8-129-----------.PDL--TGSEEKFYEYLTGW------LGGP-----PIYVQKRGH-PMLRRR------------HFIA..
TRHBN_TETPY/6-121-----------NTDM--DHQTKQQTDFLTML------LGGP-----NHYKGKN..-..MTEA------------HKGM..
Q946U7_ARATH/26-144-----------NSNK--EDAIQNQYEFFVQR------MGGP-----PLYSQRKGH-PALIGR------------HRPF..
TRHN1_CHLMO/44-158-----------NTDM--KVQRSKQFAFLAYA------LGGA-----SEWKGKD..-..MRTA------------HKDLVP
Q94FG6_HORVU/26-146-----------GSKK--EDAIQNQYEFLVQR------MGGP-----PLFSQRRGH-PALIGR------------HRPF..
TRHBN_MYCTU/14-129-----------GTNM--SRLKGKQVEFFAAA------LGGP-----EPYT...GA-P.MKQV------------HQG..R
Q9X7B3_MYCLE/7-126-----------ADDL--AGAEERLRMFLEQY------WGGP-----RTYSSQRGH-PRLRMR------------HAPF..
Q8XXM3_RALSO/11-129-----------.PSL--DGSRDKLFWFLCGW------LGGP-----SHYIERFGH-PRLRAR------------HLPF..

PF11563

Q5B5X9_EMENI/37-216...IEDFYNEDSPPI--MRRKMFLRWYLTKI......VTDP...MQMDFWRYLNK.VGLMHTAQE......RIHPLNIEY
A2QBB3_ASPNC/24-203...PDDYPTLNSPAV--QRRRQFLRWYMTKL......CSDP...TKPEFWRYLNQ.VGRMHYGKE......RLHSLNVEY
C4JH72_UNCRE/22-201...LDEQPDENSPQI--LHRKMFLRGYLNRL......CSDP...SKMEFWEYLDK.VGMMHVGRG......REHPLHIEF
C4XIT4_DESMR/15-174...........SGTL--GRLKHHMSNYILDM......FSGT...YDDVYVLSRLR.IGLVHD............RIGVPP
E5W582_9BACI/29-184...........NSSV--DRLKKTLTIHIQEM......FSGV...IDEAFLEKRIR.IAHVHL............RIGLLP
D4AN62_ARTBC/20-213ATTSVADLSLTHPNI--LHRKDFLKSYLVKL......VSNSDWSDDSKFWEYLDK.VGVMHTGKPGFKHREKRPELRVEV
E9E781_METAQ/19-198...VGETLHEDSPQI--VHRKMFLRAYLNKL......CSDP...SKMEFWEYLDK.VGMMHVGLG......RKHPLHIEY
A7Z344_BACA2/28-184...........HSTV--ERLKKTLRRHIHEM......FAGT...IDDEFIEKRQR.IASIHL............RIGLEP
E2CMR8_9RHOB/3-158.............QQ--ARLVAAQTTHWRSL......FLNG...INTAYFEAARN.IGKAHI............RVGLDP
B6BGM2_9PROT/15-171...........ADTL--FKLKNAQRKYLLDL......FSGL...YDLEYVNNRLR.IGLVHK............RIGVEP
E6U0Q9_BACCJ/24-180...........NSSI--DRLKVTLKQHITEM......FDGL...IDEQYYSKRVR.IAHIHV............KIGLQT
B6HCY7_PENCW/23-203..PEEEYLHEETPKI--QRRKMFLRWYLTRL......CQDP...TTMDFWRYLNK.VGMMHSGQV......RMSPLNIEY
Q218B7_RHOPB/3-166...........PERM--VHARKMQIKHWGVI......LDGK...FDEAYEASVTK.VGEVHN............KLGLEP
A9H610_GLUDA/3-169...........ANLI--ASAKNRQLGHWDYI......SSGE...FNQDYVKAVTT.IGQTHA............RIGLEP
B8G873_CHLAD/22-196........HAQNEYL--AAVRRRFGQWILDT......CRRP...YDQVWLDYAYE.IGLRHHRHKKNQTDHVQAVPHIHF
D3FWD3_BACPE/27-184...........HSTR--ERLKGVFLYYLKNV......VEGD...VSLEDIRKKQK.VGSVHN............NSDLPI
B7GLD2_ANOFW/25-175...............--....ARIEAYLNAF......FTME...RNRAYVDESLR.FFHLLR............KEKVNV
A4Y0T1_PSEMY/34-186...........PATT--ARLKHSQCDYYRRL......WHSP...LDQAYVLERLR.IGWVHQ............HVGVDL
C4L4W7_EXISA/25-181...........HSSS--DKLKLTLSNHIMEM......FEGK...LNEAYIDRRLA.IAKRHY............LIGLKG
A1C4D9_ASPCL/22-201...VDDYFTIDSPHV--QRRKIFWKWYLTRF......FSDP...SQIEYWQYLEK.VGTMHTGKI......LLHPLTIEY
Q7NUX9_CHRVO/5-158..........HGCDQ--DELAAMLLAEWDAL......LSAP...LDSAVAAALVE.QGELYC............RLGVSL
E0SCN2_DICD3/9-166...........QQVA--NQLNESMYHWLRSV......LGSAT.ESLSALLERQQQ.VGVIHA............RIGIPT
E1IAY4_9CHLR/13-164............KPM--AGLHKTIIEWFTQL......FCGK...YDAQYAARRLR.IGEVHV............RIGLPV
C7Z0G0_NECH7/17-196...LQSVLDDNSPEL--QERKNFLNSYLTKI......CSDQ...SKMAFWEYLDN.VGAMHVGLR......RSKPLRVEY
A9GCE3_SORC5/10-164...........EEQV--ERLKRSLVRWMTRI......CTGP...YDGAYFDESAK.IGRIHV............RVGLPQ
Q2BAH3_9BACI/31-187...........NSSV--ERLKNTLSAHIYEM......FSGK...IDTEFIQQRSV.IAHVHV............KIGLQP
F0XJU9_GROCL/20-199...LDAVPAEDSPQI--LHRKMFLRAYLARL......CSDP...SQMTFWEYLDK.VGMMHVGLG......RAHPLHVEY
Q5WC98_BACSK/26-182...........HSSI--DALKQTLKQHILEM......FEGK...VDAAFFAKRKR.IAQTHV............RIGLKT
Q9KFH4_BACHD/32-188...........HSSV--ERLKETLKQHILEM......FNGE...IDQAFLQKRLQ.IAQAHV............RIGLQT
B9JTP3_AGRVS/26-192...........ERQI--DRLHDLYVSHWDVM......TDAR...FDALYAERVKV.LADSQS............RMGLDP
D2QY57_PIRSD/6-164..........GPQQV--ARLQKTLHNWIEQF......LTGP...YDNHYVDARVN.VGLRHV............EIGLDQ
A9CYE4_9RHIZ/13-180...........ARQV--DRLEDLEVAHWSIL......SDGR...FDTLYVDRSVI.LGEVRQ............RIGLDA
B1YHV6_EXIS2/30-187...........SSTR--ERLKKVFADYFGSL......LTGN...MDDKFLAMRTR.MGKTHN............RNFVPV
B9JUN1_AGRVS/7-170...........DSHI--EHAKQKQIKHWSHL......LSGH...LDGAYVASATT.IGRTHA............KLGLDP
E1FPN0_LOALO/43-200..........PEEQR--CELASSLRNYLKNV......VNQL...TDRAAVQRISEDFGARHVQ.........YRSFGFRP
Q3IUQ9_NATPD/29-196..........STKSV--EMLKETQREYLLNL......ADGD...YGQSYFDRRAR.VGKIHD............MLDLGP
C5G9L3_AJEDR/20-214AAGSVAELALDHPNI--VHRKDFLKNYLIRL......VSNKDWSDESSFWGYLDK.VGIMHTGQAGFKHREKRPKLRVEV
A2QT04_ASPNC/23-202...VDEYPEFKSPYM--QCRRMFLRWYITRI......CSDP...TKIEFWAYLDK.VGRMHRGKD......RMISFDVEY
C7ZI09_NECH7/13-198...SKDELSSDSSLL--MERQNFLNSYLTKMSQLSKGSSDQ...SKMAFWEYLDS.VGAMHVGLQ......KSRELRIDY
A0RLK6_BACAH/33-189...........YSSI--PKLKQTLKTHIKEL......FSGD...MHEDFIEQRVK.IAKRHV............QIGLHR
E6QCH0_9ZZZZ/6-160.............RI--DVLKKTHIAWLQDL......FSGD...YDEAFIRRQEK.IGEVHV............KVRVPP
B1HNN8_LYSSC/36-192...........TSHI--DRLKITLHKHLSDI......FESH...INDAYIAERKA.IAEAHV............RIGLQS
B1YG08_EXIS2/27-183...........HSTL--ERLKGTLAKHILQM......FDGQ...VTPDYINVRKR.IADRHV............RIGLQN
C0S330_PARBP/20-213AEASISELSLDHPNI--VHRKDFLKNYLVRL......VSNKNWADDSPFWDYLDK.VSVIHTGKAGFKHREKRPKLRVEL
D8F6T6_9DELT/21-177...........DAAV--NRRKETILQWLNEI......LTSK...YDNRLLIKLVR.IGKIHV............KIGLDG
A0KND7_AERHH/15-171...........ADTL--TRLRAAQRRYILDL......FSGL...YDLEYVNNRLR.IGLVHK............RIGVEP
A6U611_SINMW/13-179...........DRQV--DRLHDLQSSHWNVL......TDAR...FDGLYAERVKV.LADTES............RMGLDP
B9LL08_CHLSY/21-195........QPIADYL--SRVRQRFGQWILDT......CRRP...YDQDWLNYQME.IALRHYRTKKNQTDGVQSVPMIPL
D8PPS9_SCHCM/66-254.PTKLDDLTLDSAQL--VYRKVFMKNWCRRL......LSSD..FSSPKTFTWMDK.VGVMHTGVKSFKHRTHVSPLHVPY
B3QU69_CHLT3/11-161.............KI--ERMRETLKGWFLEL......FTGD...YNDKYVKSRLQ.IGKVHV............RIGLPV
B2IB39_BEII9/3-168...........KSHM--GHARQRQLDHWKVL......FNAE...FGADYERAVLA.IGRTHA............RLGLEP
Q3JC52_NITOC/22-196........EPDSSYL--AAVRKRFAQWILDT......CNRT...YDQDWLNYQHE.IGLRHYHTKKNKTDNVQSVPIISY
D2R7K0_PIRSD/13-194.ATSVDNLRADDPQI--AFRKTHLARYLRAL......VERT...YDAKMVSYLDM.VGKMHTPLA......GSSELNVPL
Q2Y8W7_NITMU/15-174.........GTEAFR--QKWKYRLRSFGKNF.............ATPGYFEERLA.LAAAFA............HANIPL
A0NQE6_9RHOB/4-159.............HQ--PRLVSAQKGHWKKL......FTSG...FDQGYQQSINQ.IGHVHC............RIGLEP
F2F0J0_SOLSS/31-187...........RTKI--DRLKKTLSSYIISM......FDGV...FNEETIEAKRK.LARMHF............KIGLDP
A7NNZ1_ROSCS/12-163............VNM--NHMYSMLQNWFVEL......FCGV...YDEAYARRRIK.IGDTHV............RIGLPV
F2F399_SOLSS/32-188...........SARM--DRLKGTLTKHLEAM......FNCN...INSHYIEERQT.IAHVHV............KIGLQS
C0ZJ13_BREBN/21-178...........HTTV--DRLAVSFRHYLQSL......PHAK...LDDAYVAGRKK.IGEVHS............KIGLAP
B8GZ88_CAUCN/7-171...........DRHM--NAASSRQQAHWGVI......AEGQ...FSDDYVQAVRA.IGQTHA............RIGLEP
E8PQN4_THESS/9-162............GER--PDRETTFLAWWERT......VEGP...LDEEYFAWMAK.VGLAHV............VRGVES
B3PPJ5_RHIE6/10-176...........ERQV--ERLHDLQSSHWDVL......TDAR...FDSLYAERVKV.LSDTES............KMGLDP
B0ULQ7_METS4/3-159.............QQ--TRLVAAQSAHWEQL......FSGR...FDAGYVDSIRR.IGRVHH............KIGLEP
C6WYR1_METML/18-175...........PDQL--SQLKQKQRGYFKQI......FTGD...YGPGYIKSRLR.VGVTYQ............QLGLEP
B9J942_AGRRK/14-180...........ESQL--ERLQDLQSSHWDVL......TDAR...FDSLYAERVKV.LSDSES............KMGLDP
C0ZKX8_BREBN/35-191...........NSTI--ERLKLTLKRHICEM......FSGR...IDSAYIEQRSR.IAVIHM............RIGLEP
F0L5Z4_AGRSH/14-180...........ENQL--DRLHDLQSSHWSVL......TDAR...FDGLYAERVKV.LSDNAG............RMGLDP
A9CJK8_AGRT5/7-170...........EAHI--HHAKSMQLKHWSRI......ASGT...FNEDYTNAVTA.IGRTHA............RLGLEP
C4KYX4_EXISA/28-185...........SSTR--ERLKKVFADYFRSL......LTGN...IDDKFLAMRKR.MGQTHH............HFAVPV
B2W0B6_PYRTR/24-203...VDAQLSEDSPQI--LHRKMFLRGYLNKL......CSDA...SKMEFWEYLDK.VGMMHTGQG......RVHPLHVEY
Q2B756_9BACI/36-190...........ISKI--GVTTEMSQQYILSL......FNGI...VDGEFVERRRT.AAKAYV............QIGVQI
E3EZY8_KETVY/10-171...........QDRM--NSAKTRQESHWKRI......AQGD...FGPDYVAAVRR.IGAIHA............DIGLEP
Q1AU74_RUBXD/22-196........EPIQEYL--ERVRERFKRWVLDA......CRRP...YDQEWLDYQQE.IALRHTREKKNRTDGVEAPEEVSL
D4G784_BACNA/30-186...........HSSV--DRLKQTLKRHIQEM......FAGV...IDDEFIEKRNR.IASIHL............RIGLLP
A4U4W9_9PROT/44-195............EAG--ATLKSALVEHWSRL......YRAE...FTADYIATAQQ.LGFMLA............YLDLGA
A8IPP6_AZOC5/62-225...........AAVR--AHAKAMQIKHWGVI......LDGR...FDAAYVESVTR.IGQTHA............RLGLEP
Q1GI20_SILST/15-172...........DTQI--ERVKRGQKKYFQEL......INAE...LDESYAEERKR.IGGIHE............RAGITP
D5QTN2_METTR/7-172...........ERQM--ASAKGAQQRHWAQI......AKAN...FGPEYERMAQN.VGRAHA............RIGLEP
D0Z3L2_LISDA/18-174...........KDTL--KRLHYSMSQYITEL......FSGS...YDMDYVAKRLQ.IGRIHQ............RIGVTP
B2AU65_PODAN/21-200...MDDTPDEDSPQI--LHRKMFLRAYLKKL......CSDP...AQMEFWEYLDK.VGMMHTGIG......RTHPLHIEY
Q0UTR0_PHANO/18-193...IPDSLSESAPII--QHRKLFLRAYLTKL......CSDP...TQLEFWSYLDS.VGKMHNT..........QALRVEY
A2R286_ASPNC/23-202...VDEYFTLDGPHV--QRRKIFWKWYLTRL......FSDP...SRLEYWEYLDK.VGKMHTGKI......LMHPLKIEY
A9EVT1_SORC5/5-161...........GDAL--RRVKRLQREYFLGL......FTGK...LDRAYVEHRLH.VGAAHA............RIGVEP
B3PZF3_RHIE6/6-169...........KSQV--AHAKKRQQDHWANL......AGGS...FDESYVDGVTA.VGRTHA............RIGLEP
B8N2G0_ASPFN/23-202...IEDLFTIDSPQV--QRRKIFWKWYLTRL......CSDP...GQPSYWEYLRK.VGEMHTGKV......LMHPLTIEY
C9PHR9_VIBFU/9-167...........EQSI--VRARGHLRDHLMLY.....VFRGH...FGVNYYNATIR.IGQTHQ............RLGIDF
C4JKA6_UNCRE/20-213AAATVEDLTLTHPNI--LHRKDFLKLYLVKL......VSNTDWSDNSKFWDYLDK.VGLMHTGEPGFKHRSKRPQLRVEL
D2VCV6_NAEGR/13-197.DTLDELSDTSSEQI--KFRKDMLSKYLVKL......VTAD..YSDPALVKYLDW.VGKIHTTKA......GNKDIVIDY
Q9YFF4_AERPE/20-195.......GEPIKEYL--ERVRARFGAWILDT......TCRD...YNREWLDYQYE.VGLRHHRSKKGVTDGVRTVPHIPL
A3UD76_9RHOB/19-184...........DAIR--RHAQQKQFEHWMEI......CSAR...FAQDYVTSVSR.IGMTHA............RLELEQ
Q467X0_METBF/21-195........TPNEEYL--AAVRKRFSKWILDT......CNRN...YDQAWLDYQYE.IGLRHHRTKKNRTDNVESVPNINY
B4VTT9_9CYAN/5-160..........KEGRM--HRLRETFTQWFYEM......FTGID.DWGNAYADRRWR.IGLVHV............QIGIGP
F0SHW9_PLABD/6-164..........GDAQV--TRLKSSLARWLQGT......LQAD...HDQNYVAERRM.IGYRHV............DIGLDH
B9R0Q8_9RHOB/2-157.............QE--ARLISAQLAHWERM......FNEG...PTEAYLERSIR.IGLAHV............RIGLDP
A8FBP1_BACP2/29-185...........NSSV--ERLKKTLRIHISEM......FAGV...VDEAYVAKRIK.IAQVHL............RIGLQP
E1IA86_9CHLR/11-162............VSM--DRLHGMVQTWFAEL......FSGQ...YDNAYAQRRLT.IGHVHV............KIGLPV
B3G4N6_9BILA/14-197.PVDASHLTLESEQM--LFRIHSIRKYLCRI......LRQP..LWNDAFLEYLSN.VGKIHTNML......GKRSLNVDY
A8P1M8_COPC7/13-202.PTSLNDLSQSHPQI--KFRKDFLARYLVKL......VTMD..YDKMSTWEYLDK.VGLMHTGEAGFSYRQNKPSLRVEY
A1CRU6_ASPCL/32-212..HVDDWYTENSPQI--QNRKMFLRWYLIKL......CSDP...TQMEFWRYLNK.VGVMHSGQE......RRVPLNIEY
A4WIC7_PYRAR/17-191........RPIPQYL--EAVRKRFGLWIIDT......LCKP...LDRQWLNYMYE.IGLRHHRTKKGKTDGVDTVEHIPL
B8GYU4_CAUCN/48-212...........DGHM--AGAERAQAAHWRRI......AEAG...YGESYVRDVER.IGRSHA............DADIAP
A6SIY0_BOTFB/18-197...LDEMPDEDSPQI--LHRKMFLRGYLHKL......CSDP...SQMEFWEYLDK.VGMMHVGRG......RKHPLHVEY
Q47S02_THEFY/23-197........HPIQEYL--DRVRERFGQWILDT......CRRP...YNQEWLDYQQE.IALRHTPEKKNVTDNANSVDNIPL
A3I971_9BACI/25-181...........HSSV--EKLKITLRQHIIEM......FNGT...IDEEFYQRRVK.IAKVHV............HIGLRT

PF00042

Q19601_CAEEL/105-215.EKIPTGRLKYDPRF--RQHALVYTKTLDFV------IRNL...DYPGKLEVYFENLGKRHV------------AMQG.R
GLB1B_ANATR/17-122GDVS...AGKDNSKL--RGHSITLMYALQNF------IDAL...DNVDRLKCVVEKFAVNHI------------NRQ...
HBP1_CASGL/7-116KD..SNEIPENNPKL--KAHAAVIFKTICES------ATELRQKGHAVWDNNTLKRLGSIHL------------KNK...
GLB1_PARCH/17-123AGMS.ASQLRSSRQM--QAHAIRVSSIMSEY------IEEL...DSD.ILPELLATLARTHD------------LNK...
MYG_GALGA/3-108KN.KSLGELKDTADI--KAQADTVLKALGNI------VKK......KGNHSQPVKALAATHI------------TTH...
HBAT_HORSE/7-107.DLS.....LGSTQV--KAHGQKVADALTLA------VEHL.....E.DLPRALSALRHRHV------------REL...
HBA1_PLEWA/7-107KDLS.....ERSSYL--HSHGKKVVGALTNA------VAHI.....D.DIDTAFSKLSDKHA------------EEL...
HBB0_MOUSE/8-112GNLSSAQAIMGNPRI--KAHGKKVLTSLGLA------VKNM.....D.NLKETFAHLSELHC------------DKL...
HBA1_XENBO/7-107.DFH.....HNSKQI--SAHGKKVVDALNEA------SNHL.....D.NIAGSLSKLSDLHA------------YDL...
GLB_PAREP/8-117EG.HTIENVMQSEGI--KHYARTLTEAIVHM------LKEI...SNDAEVKKIAAQYGKDHT------------SRK...
HBB1_CYGMA/8-112GNLYNAEAIIGNANV--AAHGIKVLHGLDRG------LKNM.....D.NIVDAYAELSTLHS------------EKL...
MYG_CYPCA/3-108VG.IASNELAGNAAV--KAHGATVLKKLGEL------LKA......RGDHAAILKPLATTHA------------NTH...
HBB2_XENLA/8-112GNLSNSAAVAGNAKV--QAHGKKVLSAVGNA------ISHI.....D.SVKSSLQQLSKIHA------------TEL...
HBAZ_CAPHI/7-107.DLH.....SGSAQL--RAHGSKVVAAVGDA------VKSI.....D.NVTSALSKLSELHA------------YVL...
HBF1_URECA/7-113SS.VPLYGLRSNPAY--KAQTLTVINYLDKV------VDAL.....GGNAGALMKAKVPSHD------------AMG...
HBB1_XENBO/7-111GNLNSADAVFHNEAV--AAHGEKVVTSIGEA------IKHM.....D.DIKGYYAQLSKYHS------------ETL...
LGB1_LUPLU/8-116KGSS..EVPQNNPDL--QAHAGKVFKLTYEA------AIQLQVNGAV.ASDATLKSLGSVHV------------SKG...
MYG_HETPO/3-108KE.IPVQQLGNNEDL--RKHGVTVLRALGNI------LKQ......KGKHSTNVKELADTHI------------NKH...
HBAD_LIOMI/6-106.NLS.....PGSKDI--IHQGEKVGKALDSA------LKHL.....D.DIRGTLSQLSDLHA------------YNL...
HMP_ECOLI/6-103..........SNQRN--GDQREALFNAIAAY------ASNI...ENLPALLPAVEKIAQKHT------------SFQ...
Q18311_CAEEL/32-140AE.N..ESPMQNAAF--LGLSSTIQAFFYKL------IITYE.L.NDDQVREACEQLGARHV------------DFIS.R
GLB73_CHITH/23-129AG.KDLASIKDTGAF--ATHATRIVSFLSEV------IALSGNESNASAVNSLVSKLGDDHK------------ARG...
HBB_LITCT/1-105GNLGSADAISHNSKV--LAHGQRVLDSIEEG------LKHP.....Z.BLKAYYAKLSERHS------------GEL...
HBBN_AMMLE/2-106GBLSSABAVMBBAKV--KAHGKKVLBSFSBG------LKHL.....B.BLKGAFASLSZLHC------------BKL...
HBAM_LITCT/6-102.DIS.....PGSQDL--LTHGGKIFGALGEA------IKSL..........DNLQKYQDLHT------------NKL...
HBA3_PLEWA/7-107.DLS.....PGSADV--KRHGGKVLSAIGEA------AKHI.....D.SMDQALSKLSDLHA------------YNL...
HBAD_PASMO/6-106.DLS.....QGSDQI--RGHGKKVVAALSNA------IKNL.....D.NLSQALSELSNLHA------------YNL...
HBB_HETPO/7-106KEFT.....ACSYGV--KEHAKKVTGALGVA------VTHL.....G.DVKSQFTDLSKKHA------------EEL...
Q9ZAX1_MYCBO/42-136.........DMGAQR--AAFGQALHWVYGEL------VAQ...R..AEEPVAFLAQLGRDHR------------KYG...
HBA_LEPPA/7-108HDFS.....ANNEKV--KHHGKKVVDAIGQG------VQHL.....H.DLSSCLHTLSEKHA------------REL...
GLB8_CHITH/9-115AG.KDLDSIKDSADF--AVHSGRIVGFFSEV------IGLIGNPENRPALKTLIDGLASSHK------------ARG...
GLB2_LUMTE/8-114GDDT......SHPAF--IAHAERVLGGLDIA------ISTL...DQPATLKEELDHLQVQHE------------GRK...
Q20638_CAEEL/74-184ISKYQGDEWKESKEF--RSQALKFVQTLAQV------VKNIYHMERTESFLYMVGQKHVKFA------------DRG...
HBB_ALLMI/7-111GKMCNAHDILHNSKV--QEHGKKVLASFGEA------VKHL.....D.NIKGHFANLSKLHC------------EKF...
HBA_CATCL/6-107ADLS.....PGSGPV--KHGKKVIMGAIGDA------VTKF.....D.DLLGGLASLSELHA------------SKL...
HBA_SQUAC/6-107TDFS.....ANGKRV--KAHGGKVLNAVADA------TDHL.....D.NVAGHLDPLAVLHG------------TTL...
GLB2_TYLHE/9-115GEDV......HSPAF--EAHMARVFNGLDRV------ISSL...TDEPVLNAQLEHLRQQHI------------KLG...
GLB1_GLYDI/6-111SG.......ASDPGV--AALGAKVLAQIGVA------VSHL...GDEGKMVAQMKAVGVRHK------------GYGN.K
GLB10_CHITH/11-117AG.KDLEAIKDTADF--AVHASRIIGFFGEY------VTLLGSSGNQAAIRTLLHDLGVFHK------------TRG...
HBB_LEPPA/7-111GDLSSPGAIKHNNKV--SAHGRKVLAAIIEC------TRHF.....G.NIKGHLANLSHLHS------------EKL...
GLB1_TYLHE/7-110GDNV......YSPEF--KAHMVRVFAGFDIL------ISVL...DDKPVLDQALAHYAAFHK------------QFG...
HBA1_TORMA/6-107SGFS.....ANDKRV--KHHGALVLKALVDT------NKHL.....D.DLPHHLNKLAEKHG------------KGL...
GLB6_CHITH/22-128AG.KDLDSIKDSAAF--ATHATRIVSFLSEV------ISLAGSDANIPAIQNLAKELATSHK------------PRG...
GLB_BUSCA/6-116.DDATFAAMDTTGVG--KAHGVAVFSGLGSM------ICSI...DDDDCVBGLAKKLSRNHL------------ARG...
GLBH_CAEEL/10-119.EKYTADDVKKSERF--DKQGQRILLACHLL------ANVY...TNEEVFKGYVRETINRHR------------IYK...
GLB2_NIPBR/16-114.ENFTADDVQKSDRF--EKLGSGLLLSVHIL------ANTF...DNEDVFRAFCRETIDRHV------------GRG...
GLBH_TRICO/30-132.ETFTADDIAKSDRF--KKLGNQLLLSVHLA------ADTY...DNEMIFRAFVRDTIDRHV------------DRG...
GLB_PSEDC/21-134.ENYTPADVQKDPFF--IKQGQNILLACHVL------CATY...DDRETFDAYVGELMARHE------------RDHV..
GLB_CERRH/6-116GNMS.DAEMKTTGVG--KAHSMAVFAGIGSM------IDSM...DDADCMNGLALKLSRNHI------------QRK...
GLB2_CHITH/22-128AG.KDLETLKGTGQF--ATHAGRIVGFVSEI------VALMGNSANMPAMETLIKDMAANHK------------ARG...
GLB_TUBTU/6-112GD.N.....AYSAEF--EAHAERVLGGLDMT------ISLL...DDQAAFDAQLAHLKSQHA------------ERN...
GLB3_LAMSP/7-113GDNI......HTPAF--RAHATRVLGGLDMC------IALL...DDEGVLNTQLAHLASQHS------------SRG...
GLB_ASCSU/21-134.EEYTAEDVQNDPFF--AKQGQKILLACHVL------CATY...DDRETFNAYTRELLDRHA------------RDHV..
GLB1_CALSO/5-105.......GTGSGIAM--KRQALVFGAILQEF------VANL...NDPTALTLKIKGLCATHK------------TRG...
GLB2_CALSO/5-108.......GATNDTEM--EKQANLFGLMMTQF------IDNL...DDTTALNYKISGLMATHK------------TRN...
MYG_ALLMI/7-113KHMKTADEMKSSEKM--KQHGNTVFTALGNI------LKQ......KGNHAEVLKPLAKSHA------------LEH...
Q21978_CAEEL/165-283SESDDVFDLPDNHPV--RRHARLFTSILHIS------VKNV..DELEAQVAPTVFKYGERHY------------RPDITP
HBB_SQUAC/7-107GKFH.....ASDSTV--QTHAGKVVSALTVA------YNHI.....D.DVKPHFVELSKKHY------------EEL...
GLB3_TYLHE/8-117VD.K.....PSEADW--KAHVIRVINGLDLA------VNLL...EDPKALQEELKHLARQHR------------ERS...
GLBT_CHITH/13-116GN..DLAAAKGTAEF--KDQADKIIAFLQGV------IEKLG.S.DMGGAKALLNQLGTSHK------------AMG...
GLB3_CHITH/20-120AG.KDLESIKGTAPF--EIHANRIVGFFSKI------IGEL......PNIEADVNTFVASHK------------PRG...
GLB1_CHITH/21-126AG.KDLDSIKGTPDF--SKHAGRVVGLFSEV------MDLLGNDANTPTILAKAKDFGKSHK------------SRA...
LGB1_MEDSA/7-112..LKNSAEVQDSPQL--QAHAEKVFGLVRDS------AVQL..R.ATGGVVLGDATLGAIHV------------RKG...
GLBC_NIPBR/21-135.ENFGADDVQKSKRF--EKQGTALLLAVHVL------ANVY...DNQAVFHGFVRELMNRHE------------KRGVDP
HBA1_IGUIG/6-106.DLN.....PGSAQI--KAHGKKVVDALTQA------VNNL.....D.DIPDALAKLADLHA------------EKL...
HBA1_BOSMU/6-106.DLS.....QGSAQV--KGHGAKVAAALTKA------VEHL.....D.DLPGALSELSDLHA------------HKL...
GLB_APLJU/6-113KG.KSLADIQASPKL--RDVSSRIFARLNEF------VSNA...ADAGKMGSMLQQFATEHA------------GFG...
HBA_HETPO/13-114KDFT.....AAAPSI--KAHGAKVVTALAKA------CDHL.....D.DLKTHLHKLATFHG------------SEL...
BAHG_VITST/6-103......GRQESLEQP--KALAMTVLAAAQNI------ENL......P.AILPAVKKIAVKHC------------QAG...
GLB4_TYLHE/8-117VDDT......HSPEE--FAHVLRVVNGLDTL------IGVL..GDSD.TLNSLIDHLAEQHK------------ARA...
GLB4_LUMTE/11-120IDEP......ESGEF--KSHLVRVANGLDLL------INLL...DDTLVLQSHLGHLADQHI------------QRK...
HBP2_CASGL/13-122KD..SNVPLERNPKL--KSHAMSVFLMTCES------AVQLRKAGKVTVRESSLKKLGASHF------------KHG...
GLBP1_GLYDI/7-115GR.T..EALKHSSKL--QHHGKVIIDQIGKA------VAEM...DNAKQMAGTLHALGVRHK------------GFG...

PF00502

PHEA1_SYNPW/6-164--------AGENQTK.VDKCYRDLGHYLRLI------NYCLVVGGTGPLDEWGIAGAREVYR------------TLGLPT
PHAA2_FREDI/5-161--------AYGENMT..ATCLRDMDYYLRLI------TYSVAAGDTTPIQEIGIVGVRQMYR------------SLGTPI
PHAC_SYNP6/5-161--------AYGQRQR..AQCLRDYGWYLRLI------TYGVLAGDKEPIESIGLLGAREMYN------------SLGVPL
PHAA_AGLNE/5-161--------AYGEEMT..ATCLRDLDYYLRLV------TYGIVAGDVTPIEEIGLVGVKEMYN------------SLGTPI
PHCA_AGLNE/6-162--------TYASRAIGKAKCARDIGYYLRMT------TYCLVVGATGPMDEYLVAGLEEINR------------SFELSP
APCF_AGLNE/6-167--------SYTTRKY..AMCLRDIEYYLRYA------TYAIIAGNNDILNERVLDGLKDTYN------------SLNVPI
PHEA_FREDI/6-164--------ANSTDTF.KAKCARDIKHYLRLI------QYSLVVGGTGPLDEWGIAGQREVYR------------ALGLPT
PHAC_FREDI/5-161--------AYGERQ..RSLCIRDFGWYLRLI------TYGVLAGDKEPIEKIGLIGVREMYN------------SLGVPV
PHEA2_SYNPY/6-165--------PRQCATEGKEKCKRDFVHYLRLI------NYCLVTGGTGPLDELAINGQKEVYK------------ALSIDA
PHBB_MASLA/6-165--------AYTTRRY..AACLRDLDYYLRYA------TYAIVAGSMDVLDERVLQGLRETYN------------SLGVPI
PHCA1_FREDI/6-162--------NFASTQTGKDKCVRDIGYYLRMV------TYCLVVGGTGPLDDYLIGGIAEINR------------TFDLSP
PH6B_CHRSP/6-177--------CYTNRRM..AACLRDAEIILRYV------SYSLLSGDSSVLEDRCLSGLKETYA------------SLGVPA
PHEA_NOSS1/6-162--------QYASTPEGKSKCVRDIDHYLRTI------SYCCVVGGTGPLDEYVVSGLSELNS------------ALGLSP
PHEA_AGLNE/6-163--------AGDSQDK.VNKCYRDIDHYMRLI------NYSLVVGGTGPLDEWGIAGAREVYR------------ALNLPA
PHEB2_SYNPY/6-178--------VYTNRKM..AACLRDGEIVLRYV------SYALLAGDASVLQDRCLNGLRETYA------------ALGVPT
PHEB_NOSS1/6-172--------CFHNRNQ..AACIRDLGFILRYV------TYSVLAGDGSVMDDRCLNGLRETYQ------------ALGTPG
PHAC_CYAPA/5-161--------AYGARQ..RSLCLRDYGWYLRLV------TYGILAGDQRPIEKIGIIGVREMYN------------SLGVPV
APCF_CYAPA/6-165--------ANTTRRY..AACLRDIDYYLRYA------TYAIISADVDVLDERVLDGLKETYN------------SLGVSI
PHEB1_SYNPW/6-184--------CYPNRRM..AACLRDGEIILRYI------SYALLAGDASVLDDRCLNGLKETYI------------ALGVPA
PHCB1_FREDI/6-172--------AYTSRRM..AACLRDMEIILRYV------TYAIFAGDASVLDDRCLNGLKETYL------------ALGTPG
PHCB_SYNP2/6-172--------AYTNRRM..AACLRDMEIILRYV------TYATFTGDASVLNDRCLNGLRETYV------------ALGVPG
PHAB_AGLNE/6-161--------MYTTRRF..AACIRDLDYYLRLA------TYGMLAGDPSILDERVLDGLKETYN------------SLGVPI

PF01152

Q7CX73_AGRT5/7-128PIGPAERDEWLLC--FRRAMDETI----------------------ENAKLREIIWAPVERLAFHMQNQ
TRHBN_PARCA/2-117GVSNAQFTTVIGH--LRSALTGAG----------------------VAAALVEQTVAVAETVRGDVVTV
TRHBN_NOSCO/3-118NLQQPHFDAIAKH--LGERMAVRG----------------------VSAENTKAALDRVTNMKGAILNK
Q93SP0_BURPE/47-168PIASSERDQWLRC--IAWAMQDVG----------------------LDEPLRERLMHSFHDTADWMRNR
Q9L379_RHIML/8-129GIGPAERDEWLFC--FTRALEETV----------------------SHPKLREIILEPITRLAHHMQNK
TRHBN_TETPY/6-121NLQNLHFDAIIEN--LAATLKELG----------------------VTDAVINEAAKVIEHTRKDMLGK
Q946U7_ARATH/26-144PVTHQAAERWLEH--MQNALDDSV----------------------..DIDQDSKIKMMKFFRHTAFFL
TRHN1_CHLMO/44-158HLSDVHFQAVARH--LSDTL...T----------------------ELGVPPEDITDAMAVVASTRTEV
Q94FG6_HORVU/26-146PVTHRAAERWLHH--MQQALETT.----------------------.QSINPDTKTKMMNFFRHTAYFL
TRHBN_MYCTU/14-129GITMHHFSLVAGH--LADALTAAG----------------------VPSETITEILGVIAPLAVDVTSG
Q9X7B3_MYCLE/7-126RITAIERDAWLRC--MHTAVASID----------------------SHTLDNEHRRELLDYLEMAAHSL
Q8XXM3_RALSO/11-129EIGTRERDQWMRC--MALAMQDLG----------------------...IDDALQMRLMQAFWQTADWM

PF11563

Q5B5X9_EMENI/37-216IHMGACLGYIQDL--FTEALLSHP..........TLSIARKTAMIRAISKIIWIQNDLIARWRMRDGEE
A2QBB3_ASPNC/24-203IHIGACLGFIQDI--VMEAVLTYE..........KLTLPFRIALVRALGKVIWIQNDLFARWRLHDGEE
C4JH72_UNCRE/22-201VHIGANLGFIQNV--LTEALLSHP..........RLPLSRKIALVTAIGKVIWVQNDLFAKWYVRDGDE
C4XIT4_DESMR/15-174MLYISSIRTLFQI--LRERLTSKLS........ANKQCSTCHGILGALEKIILFDLTLVMDTYIHALVK
E5W582_9BACI/29-184KWYLGAFQDLLLS--MLKIFENAL............SDEEYRRSVKAVTKILNIEQQIVLEAFEDEHAR
D4AN62_ARTBC/20-213MHMSLLLGFVEDI--VLQATMGAE..........ELDIQTKTNVIRAFNKLIWIQNDLFQKHYVSK.LE
E9E781_METAQ/19-198VHLGTCLGFIQDI--MTEAILSHP..........RLHMYRKIALVKALNKVIWIQNDFMAKWHVREADE
A7Z344_BACA2/28-184KWYMGAFQDLLLS--MMNIYEATI...........PDLHELLKAIKATTKILNLEQQLVLEAFQTEYNC
E2CMR8_9RHOB/3-158TWYIGGYSFIMSE--LSDIITKHH..........RFSARKAARTLEVVTKYAMLDMDIAISTYHEDSVA
B6BGM2_9PROT/15-171KLYLSAINTLKKI--LTTMIREEI...........KDSVELIATLGALDKLFLFDITLVFETYIRSLVS
E6U0Q9_BACCJ/24-180KWYMSAFQDLLLS--LMELVDEII...........EDKTECLYIIKAITKVINLEQQLVLEAYEIETKR
B6HCY7_PENCW/23-203IHLGACLGYIQDI--WIEAMLSHP..........HLSLRRKIALVRAVNKILWIQNDLFARYHSSDGEE
Q218B7_RHOPB/3-166RWYIGGYNALISG--LMEAVALRMPTG....RFDRRALQKKTALQQAIIKASMLDMDYAIAVYIEAGRR
A9H610_GLUDA/3-169RWYIGGYALVLES--LIAAIVEARWPRG.ILGAGRSSARQVTAELSAVVKATMLDMDFAISVYLDALET
B8G873_CHLAD/22-196RYMVAFMYPITAT--IKPFLAKKG...........HSPEEVEAMYQAWFKSVVMQVALWSAPYVASEDF
D3FWD3_BACPE/27-184AWFLATYQVFLQL--IIPQLVSNF..........FKEPDKLTNYILALTGRFNFDSQLIVEEYLQSKMR
B7GLD2_ANOFW/25-175GKLIVAFNQFNFF--VLTTLLAKV..........ALAPKRCLTLMEALQRAINIEQQLLVEVYTETLME
A4Y0T1_PSEMY/34-186KWYLGAYRMYLDG--MLEALLEPS...............PASDCFASLIKKVFFDIGLALDSYGAAQRK
C4L4W7_EXISA/25-181KWYMAAFQKIFET--LVLAIQHEQ...........LDADSKMKLMMAVSKIFNFEQQIVLEMFDDEADV
A1C4D9_ASPCL/22-201IHMNACLGYLKEL--LLETIFLHE..........EMTVAFKFALVRSLSKILCIQNDLIARCHIRDGEE
Q7NUX9_CHRVO/5-158GWLQGLYERCQPH--LLGGLEQAA................GTEAARLLRKRILLDQMLKTHGYQQALKR
E0SCN2_DICD3/9-166DLVARGARKLKNE--LFRLLDRKR..........NLDAALINQAVCFSSLVIDTAIEAMTTAYSPGYKS
E1IAY4_9CHLR/13-164RYPLAMLDVILPH--GVAIAETSS...............NPEAARRAFFKVLALDAAIFNQAYEDNQLA
C7Z0G0_NECH7/17-196IHISATLCVIQHV--LTESILSHS..........VLPMSRRVAMVKALSKVIWIQNDLFAKWCVRDGEE
A9GCE3_SORC5/10-164RYMFTAMTLIRLA--FHEIAQGAL.............GAEVIPVRAAVSKVLDLELAIMLETYRDDFLA
Q2BAH3_9BACI/31-187KWYMCAFQDLYLS--LCSMIIDTI...........SEKGPCTGAMLAVSKIISLEQQIVLEAYEQEISR
F0XJU9_GROCL/20-199IHIGATLSLIQDV--LTEAVLSHP..........RLSMGRKMGLVKALGKVIWIQNDLFAKWYVRDGEE
Q5WC98_BACSK/26-182KWYIGAFHNLQLE--LQRMIVKHF...........KSGNEQFLAFCAVGKFINFEQQLVLEAYEEEERR
Q9KFH4_BACHD/32-188KWYVSAFQQLTDS--LIQLLEQHL...........QSPSDIVLATRSLLKLLNLEQQLVLEAYENENKR
B9JTP3_AGRVS/26-192RWQIAGHAVVLEG--LVSSVFADLANRG.FMPSSRKRAAELQALVSALIRLVMVDVEIAVSLRFNELRL
D2QY57_PIRSD/6-164VYAAVAVARLRSG--MIAAISSDA..........KLSPAQLSLTVQSINKLLDLDLAIISDVYEAEYVR
A9CYE4_9RHIZ/13-180GWSIGGHALVLER--VIRRLVEESRTGIFKHFSKRADRNLLADRLVDVVKAALIDIDMQVSHRLREQSR
B1YHV6_EXIS2/30-187TWFIASYAAFNTL--LIPKIVEHF..........QHEPAQLTNAILALNHAMNLDAQIVTSQYVDARLH
B9JUN1_AGRVS/7-170RWYIDGYGLILSG--LVTGVLEAEMRG....TLFGSRLKGAIPKISALIRATMLDMDFAISTYGEALSE
E1FPN0_LOALO/43-200DFFAITADAVTTE--CVLL...............DAAIHSASEALFAWSTLTTFMFSFVRDGYYSEQRR
Q3IUQ9_NATPD/29-196KAYLGAYTIYYEG--IADAIADDIKSEF.DGDEAAAAVDEAFDRMSSVLKAMNLDQQVAMDTYIHSYSE
C5G9L3_AJEDR/20-214MHMSLLLAFVEEM--VLQAILGAE..........GVDLQTKTGMITAFNKLVWIQNDLFQRHYVAKKPE
A2QT04_ASPNC/23-202IHIGACLGYIQDV--LIEGVMGCE..........KMSLPFRVALVRALGKVIWIQNDLFARWRVRDGAE
C7ZI09_NECH7/13-198IHISLTLSLIQSV--MSQAILDHS..........SIPISRRAAIVKSFSKVIWIQNDLFARWYVRDGEE
A0RLK6_BACAH/33-189KWYTAAYQELFRS--IMKILKTKI...........TTIDDFSYSINVINKLFTLEQELVIAAYESEYER
E6QCH0_9ZZZZ/6-160LFVAASMSFLRAA--LPPVIAENV...........PDQHDMGKAVAALLRLLDLCQYLIDRKYNDALMD
B1HNN8_LYSSC/36-192KWYIASFQSLTST--FTNFVNEVD...........ISKNDAIRAINAFCKIINFEQQLVIEAYEKEEDR
B1YG08_EXIS2/27-183KWYIAAFQKVLNV--LSRQIEDST...........LPESEQVRIVRSAGKLFNLEQQIVLTMYEEMVDA
C0S330_PARBP/20-213MHMSLLLGFVEDL--MLKTTLAAD..........GLDLRTKTSVLAAFNKLMWIQNDLFLRHYVAEKPE
D8F6T6_9DELT/21-177HYVNAAMGFIRRY--FQEHLNQVV...........SEPAKREIMIETLDKALDISLDIMTSSYREAELK
A0KND7_AERHH/15-171KLYLAAINTLKGL--LIEDIFTQI...........DHEPDRITMLTALDKLFLFDITLVFETYIRSLVS
A6U611_SINMW/13-179RWQIASHAVVLEH--LIMGAIEDAWPKS.IISLGKARKKELRDLVAALVRTAFVDTEIAVSLRFNALRQ
B9LL08_CHLSY/21-195RYMIAFIYPITAT--IREFLARKG...........HSAAEVDRMHQAWFKSIVLQVTLWSYPYTREGDF
D8PPS9_SCHCM/66-254RDCALTLGWVGTV--LQTATLQLPE........DKLSMKEKIDAVGAINKILWIQNDLFARHYID...E
B3QU69_CHLT3/11-161RYPLAMMDVIMEY--GQKAALQSS...............QPEIASSAFRKLAALDIAIFNQAYESTQLK
B2IB39_BEII9/3-168RWYIGAYALIGEG--LVETLIEQQWPKL..LPSAHKQAAKVSSSLASVWKALLLDIELSISAYLEAIET
Q3JC52_NITOC/22-196RYLITFIYPITAT--IKPFLEKKG...........HSAEEVEKMHQAWFKSLLLQVTLWTNPYLRQEDY
D2R7K0_PIRSD/13-194VQMNALLGFVADA--LIATIFSLG...........LDRETEIKTQRAFQKLLWVQNDLINRHYQTASTW
Q2Y8W7_NITMU/15-174GALQLPSFLIQQS--LIDNLLDKS..........DFNADKTRILLCTILKLTALDLYIAAEGYHLPELN
A0NQE6_9RHOB/4-159RWYIAGYLYVLRH--LHAHLTRKY..........RRSFQNLTVLLNDVTAAVFLDMDLAISTYEEELLL
F2F0J0_SOLSS/31-187KWYMGTFQKLQET--MIMLISKDI...........ADVAGREIIQLNVSKLINLEMQVVLEEYEKENLN
A7NNZ1_ROSCS/12-163RYPLAMLDVAMAH--AETVARAHA...............QPDAAATAVRKVLALDVAVFNQAYEDRQIQ
F2F399_SOLSS/32-188KWYIASFQSLMTT--FIDFISKIE...........MSNVDMAKAVDAFSKLINFEQQLVIEAYEKEEQR
C0ZJ13_BREBN/21-178EWYTGSYLRVYEY--LIPAIVNTY..........SKRPQELSSVLLALMRIITLDSQIVLQSYQEDNDY
B8GZ88_CAUCN/7-171RWYIGGYAVVGDH--LVRAVIDSMWPR...GLLAKGGSDRAGEAVAALMKAIFLDMDFAISIYLETLEN
E8PQN4_THESS/9-162PMMLAMASFVASF--VDKQAQSLS.............LPGAEALAGAFYRLSTTLGAVITHAYVRYRTL
B3PPJ5_RHIE6/10-176RWHVAGHGVMLEH--VLSGLAAEIAGRP.LLPSAKRRSREISELMTAIIRIVMVDVEIAVSLRFNALRA
B0ULQ7_METS4/3-159RWYIGGYAFVLNA--LVQVLVERA.........GLLGRGGLPARIAALNKAVMLDMDFAISVYQDVLLE
C6WYR1_METML/18-175RWHLSAYSKYLSW--VLPEVMRLV..........DNDAERFLAYSTAITKIAMFDSELSISAYFHADHE
B9J942_AGRRK/14-180RWHVAGHGVVLEH--ILAGIVEEMGGRA.VLPGTKRRARELSELVKAAVRLVMVDVEIAVSLRFNELRL
C0ZKX8_BREBN/35-191KWYLSAFQNMLVS--LIDLLQKNI...........ADKDEFVQAITAVTKILSIEQQIVLEEYENEHEK
F0L5Z4_AGRSH/14-180RWQIASHAVVLEH--LLGGLVTEHAPRS.ILPGNRKKSRELAEAVKNVVRLVMVDTEIAVSLRFNELRL
A9CJK8_AGRT5/7-170RWYIGGYALMLDG--IVKAVIESELKG....LFMEKKAKKVKDALSATIKAALLDMDYSISVYLDVLAT
C4KYX4_EXISA/28-185VWFLATYSAFNTL--LIPKVVETY..........QHDPAVLSESLLALSHAMNLDAQIVTEQYVNARLD
B2W0B6_PYRTR/24-203VHVGVTLSFIQDI--MTEAVLSHP..........RLKMERKIGLVKALSKVLWIQNDLFAKWYVKDGEE
Q2B756_9BACI/36-190HWYMSIYQLLMKN--ILEIVLQEL..........ELSSKDQSRVTFAMAKIFNLEIQLCISIMQQTMEA
E3EZY8_KETVY/10-171RWYIGGYGLVLDR--IIRDIVTTRRT......WTGKDRARLAADLSAVVRAALVDIDLSITCYIDKLDE
Q1AU74_RUBXD/22-196RYMISFIYPITAT--VRPFLEEGG...........RPAEDVEKMHQAWFKAVVLHVTLWSQPYAREGSF
D4G784_BACNA/30-186KWYMGAFQELILS--MIDIYEASI...........TNQQELLKAIKATTKILNLEQQLVLEAFQSEYNQ
A4U4W9_9PROT/44-195SWYQAMAANAASQ--ALAMLRDQR...............HFDTLAGVLTRASQLDVSLVTHDYFEAAKQ
A8IPP6_AZOC5/62-225RWYIAGYALLLSG--LVAAIETGFKAG....RFDRTAPERKARLIEAVITAALLDMDFAISVYLDAGIK
Q1GI20_SILST/15-172TLYVGSYAYYLQR--LSQSILENG..........KEDPHKLFGLVLSMMKIAHYDMALALETYVEAREK
D5QTN2_METTR/7-172SLYINAYAVVVDR--LIRAAIEESAPHS..MFAGKNRNNRLAQSLTGLVKAVLVDMDLSISVYLETLSE
D0Z3L2_LISDA/18-174KLYLSGINRLQHL--LEDIIRDYS...........EDELQTNQILSSLKKLMYFDNQLVFDTYISTLQS
B2AU65_PODAN/21-200IHIGAGLAVIQDV--LTEAILSHP..........RLHIQRKIAIVKALGKVIWIQNDLFTKWYVHDGEE
Q0UTR0_PHANO/18-193IHIGATLSFIQDV--LTEAILEHP..........RMSMQRKVGLVKALSKVIWIQNDLFAKWYVRDGEE
A2R286_ASPNC/23-202MHMNTCLGYVKEL--AYETISGHP..........EMSYPFKFALIRALNKIMTIQNDLISRCYIREGQE
A9EVT1_SORC5/5-161TWYLGAYRRYMHL--LLEAFSDDI...........GDPAEVVRAFTSVQKLVYFDVSLALDAYFSTTFD
B3PZF3_RHIE6/6-169RWYIGGYALVMSE--LVKGIMEKQWPS....VFARQQGRQLAEKLSAVIKSAMLDMDYSISVYLETLEA
B8N2G0_ASPFN/23-202IHMNACLGYVKQL--LFETISLHP..........DMSVKFKFALIRSMSKVFCIQNDLISKCYINEGQE
C9PHR9_VIBFU/9-167KVYSGAYCIVMSQ--LARVVYQSL..........APNIDNIHRYMSALNRAIFLDLGLATAVYYDTACF
C4JKA6_UNCRE/20-213MHCSALLGFVEDI--VLNAVMGAQ..........DVDLPTKTKIIRAFNKLLWIQNDLFLKQYTPEPWS
D2VCV6_NAEGR/13-197IHINALFGYVSDV--LLGTIAMCP..........QLNEEQRAKTVQAFNKLLWIQNDLFAKYYVDDDSR
Q9YFF4_AERPE/20-195RYLIAFIYPITAT--IKPFLAKKG...........GSPEDIEGMYNAWFKSVVLQVAIWSHPYTKENDW
A3UD76_9RHOB/19-184RWYFAAYQKVISG--VLCALNRLRLKEA..GLMRRGVIERLDADIQALTKAAFLDMDLCLSTIEADMRN
Q467X0_METBF/21-195RYLVAFIYPITAT--IKPFLARKG...........HTSEEVEKMHQAWFKATVLQVALWSYPYVKQGDF
B4VTT9_9CYAN/5-160QHVVPAMAIVVNA--VGQKLKEAD...............KNEELRDALSLICMIDLAFIEQAYIEVTSA
F0SHW9_PLABD/6-164VYVNAAFSRVRLR--LNETLSQQG..........QLSLERRMELHSSLGKRLDLDLAIMSAAYQAEYQS
B9R0Q8_9RHOB/2-157SWYIGGYSFALTQ--ISDVLLTKR..........MMTAAKRSKVMAVITKLVMLDMDIAISTYHEKMVA
A8FBP1_BACP2/29-185KWYMAAFQDLLLS--IMDLFAQHI...........QDFKEYQTAVKATTKILNLEQQLVLDTFQNEYSK
E1IA86_9CHLR/11-162RYPLAMLDVVMPF--GEQVAAKHA...............NPTLAAQAFRKVLALDVAIFNQAYEDNQLK
B3G4N6_9BILA/14-197IHINALFGYLEHS--FMDAVLAND..........EIDDAMKKDMIIAISKLFWIQNDFFTMNYIIASQN
A8P1M8_COPC7/13-202IQCAILLGYVEDI--LVNAVLTHP..........DLDDATKLVVMRAFNKLIWIQNDLFARHYISEEKA
A1CRU6_ASPCL/32-212IHIGVMLGFIQDI--FTEALMSHP..........TLSLQRKVALVRAIGKIIWIQNDLFARYRVRDGEE
A4WIC7_PYRAR/17-191RYMIAFIAPIGLT--IKPILEKSG...........HPPEAVERMWAAWVKLVVLQVAIWSYPYAKTGEW
B8GYU4_CAUCN/48-212QWYIGGYAVVVEE--VMRALVAKRAKG...LFNSAKSDAELADGLSALIKAAFLDMDLSVSTYIDVLLE
A6SIY0_BOTFB/18-197VHIGVCLGFVQDI--IFEAVLSHP..........KLRMEKKIAIVKAIGKVLWIQNDLFAKWYVRDGDE
Q47S02_THEFY/23-197RYVIAFIYPVTAT--LRPFLAKKG...........HSADQVEAMYQAWFKSVTMQIALWSQPYTRDGYW
A3I971_9BACI/25-181QWYICAFQDLSLS--FIDLVEQHI...........DHPRDQFNTIRAISKICNFEQQLVLEAYENTVEQ

PF00042

Q19601_CAEEL/105-215GFEPGYWETFAEC--MT----------------------------------------------------
GLB1B_ANATR/17-122.ISADEFGEIVGP--LR----------------------------------------------------
HBP1_CASGL/7-116.ITDPHFEVMKGA--LL----------------------------------------------------
GLB1_PARCH/17-123.VGPAHYDLFAKV--LM----------------------------------------------------
MYG_GALGA/3-108KIPPHYFTKITTI--AV----------------------------------------------------
HBAT_HORSE/7-107RVDPASFQLLGHC--LL----------------------------------------------------
HBA1_PLEWA/7-107MVDPANFPKLAHN--IL----------------------------------------------------
HBB0_MOUSE/8-112HADPENFKLLGNM--LV----------------------------------------------------
HBA1_XENBO/7-107RVDPGNFPLLAHN--IL----------------------------------------------------
GLB_PAREP/8-117.VTKDEFMSGEPI--FT----------------------------------------------------
HBB1_CYGMA/8-112HVDPDNFKLLSDC--IT----------------------------------------------------
MYG_CYPCA/3-108KIALNNFRLITEV--LV----------------------------------------------------
HBB2_XENLA/8-112FVDPENFKRFGGV--LV----------------------------------------------------
HBAZ_CAPHI/7-107RVDPVNFKFLSHC--LL----------------------------------------------------
HBF1_URECA/7-113.ITPKHFGQLLKL--VG----------------------------------------------------
HBB1_XENBO/7-111HVDPCNFKRFGGC--LS----------------------------------------------------
LGB1_LUPLU/8-116.VVDAHFPVVKEA--IL----------------------------------------------------
MYG_HETPO/3-108KIPPKNFVLITNI--AV----------------------------------------------------
HBAD_LIOMI/6-106RVDPVNFQLLSKC--IH----------------------------------------------------
HMP_ECOLI/6-103.IKPEQYNIVGEH--LL----------------------------------------------------
Q18311_CAEEL/32-140GFNSHFWDIFLVC--MA----------------------------------------------------
GLB73_CHITH/23-129.VSAAQFGEFRTA--LV----------------------------------------------------
HBB_LITCT/1-105HVDPANFYRLGNV--LI----------------------------------------------------
HBBN_AMMLE/2-106HVBPZBFRLLGBV--LV----------------------------------------------------
HBAM_LITCT/6-102KLSSDHMKLLSAA--II----------------------------------------------------
HBA3_PLEWA/7-107RVDPGNFQLLSHC--IQ----------------------------------------------------
HBAD_PASMO/6-106RVDPVNFKFLSQC--LQ----------------------------------------------------
HBB_HETPO/7-106HVDVESFKLLAKC--FV----------------------------------------------------
Q9ZAX1_MYCBO/42-136.VLPTQYDTLRRA--LY----------------------------------------------------
HBA_LEPPA/7-108MVDPCNFQYLIEA--IM----------------------------------------------------
GLB8_CHITH/9-115.IEKAQFEEFRAS--LV----------------------------------------------------
GLB2_LUMTE/8-114.IPDNYFDAFKTA--IL----------------------------------------------------
Q20638_CAEEL/74-184.FKHEYWDIFQDA--ME----------------------------------------------------
HBB_ALLMI/7-111HVDPENFKLLGDI--II----------------------------------------------------
HBA_CATCL/6-107RVDPSNFKILANC--IT----------------------------------------------------
HBA_SQUAC/6-107CVDPHNFPLLTQC--IL----------------------------------------------------
GLB2_TYLHE/9-115.ITGHMFNLMRTG--LA----------------------------------------------------
GLB1_GLYDI/6-111HIKAQYFEPLGAS--LL----------------------------------------------------
GLB10_CHITH/11-117.ITKAQFGEFRET--MT----------------------------------------------------
HBB_LEPPA/7-111HVDPHNFRVLGQC--LR----------------------------------------------------
GLB1_TYLHE/7-110.TIP..FKAFGQT--MF----------------------------------------------------
HBA1_TORMA/6-107LVDPHNFKLFSDC--IA----------------------------------------------------
GLB6_CHITH/22-128.VSKDQFTEFRTA--LF----------------------------------------------------
GLB_BUSCA/6-116.VSAADFKLLEAV--FK----------------------------------------------------
GLBH_CAEEL/10-119.MDPALWMAFFTV--FT----------------------------------------------------
GLB2_NIPBR/16-114.LDPALWKAFWSV--WV----------------------------------------------------
GLBH_TRICO/30-132.LDPKLWKEFWSI--YQ----------------------------------------------------
GLB_PSEDC/21-134KIPNDVWNHFWEH--FI----------------------------------------------------
GLB_CERRH/6-116.IGASRFGEMRQV--FP----------------------------------------------------
GLB2_CHITH/22-128.IPKAQFNEFRAS--LV----------------------------------------------------
GLB_TUBTU/6-112.IKADYYGVFVNE--LL----------------------------------------------------
GLB3_LAMSP/7-113.VSAAQYDVVEHS--VM----------------------------------------------------
GLB_ASCSU/21-134HMPPEVWTDFWKL--FE----------------------------------------------------
GLB1_CALSO/5-105.ITN..MELFAFA--LA----------------------------------------------------
GLB2_CALSO/5-108VVDPALFAIALNE--LV----------------------------------------------------
MYG_ALLMI/7-113KIPVKYLEFISEI--IV----------------------------------------------------
Q21978_CAEEL/165-283HMTEENVRVFCAQ--IV----------------------------------------------------
HBB_SQUAC/7-107HVDPENFKLLANC--LE----------------------------------------------------
GLB3_TYLHE/8-117GVKAVYFDEMEKA--LL----------------------------------------------------
GLBT_CHITH/13-116.ITKDQFDQFRQA--LT----------------------------------------------------
GLB3_CHITH/20-120.VTHDQLNNFRAG--FV----------------------------------------------------
GLB1_CHITH/21-126..SPAQLDNFRKS--LV----------------------------------------------------
LGB1_MEDSA/7-112.VVDPHFVVVKEA--LL----------------------------------------------------
GLBC_NIPBR/21-135KLWKIFFDDVWVP--FL----------------------------------------------------
HBA1_IGUIG/6-106RVDPVNFGLLGHC--IL----------------------------------------------------
HBA1_BOSMU/6-106RVDPVNFKLLSHS--LL----------------------------------------------------
GLB_APLJU/6-113.VGSAQFQNVRSM--FP----------------------------------------------------
HBA_HETPO/13-114KVDPANFQYLSYC--LE----------------------------------------------------
BAHG_VITST/6-103.VAAAHYPIVGQE--LL----------------------------------------------------
GLB4_TYLHE/8-117GFKTVYFKEFGKA--LN----------------------------------------------------
GLB4_LUMTE/11-120GVTKEYFRGIGEA--FA----------------------------------------------------
HBP2_CASGL/13-122.VADEHFEVTKFA--LL----------------------------------------------------
GLBP1_GLYDI/7-115DIRAEFFPALGMC--LL----------------------------------------------------

PF00502

PHEA1_SYNPW/6-164GPYVEALTYTRDRACAPRDMS......................PQALNEFKSYLDYVINALS-------
PHAA2_FREDI/5-161DAVAESVRAMKNI..TTSMLS......................GEDASEVGTYFDYLITNLQ-------
PHAC_SYNP6/5-161PGMAEAIRTLKEA..SLALLS......................SADATVAAPYFDFLIQGME-------
PHAA_AGLNE/5-161SGVAEGVRCMKAI..ACSLLS......................GEDSAEAGFYFDYTLGAMQ-------
PHCA_AGLNE/6-162SWYIEALEYIKNT....HGLS......................GQAANEANTYLDYAINILS-------
APCF_AGLNE/6-167APTVRSIQIMEEI..IHNEISK..QDLK...............IIKKSIISEPFDHMIQNLS-------
PHEA_FREDI/6-164APYVEALSFARNRGCAPRDMS......................AQALTEYNALLDYAINSLS-------
PHAC_FREDI/5-161PGMVEAIASLKKA..ALDLLS......................AEDAAEASPYFDYIIQAMS-------
PHEA2_SYNPY/6-165GTYVAGFSNMRNDGCSPRDMS......................AQALTAYNTLLDYVINSLG-------
PHBB_MASLA/6-165GPTVRGIQIMKEI..VKEQLG....AAG...............IPNTSFVDEPFDYMTRELG-------
PHCA1_FREDI/6-162SWYVEALKYIKAN....HGLS......................GDPAVEANSYIDYAINALS-------
PH6B_CHRSP/6-177AGNARAVGIMKAT..VVAFINNTSNQKKLL.......TPSGDCSALASEAAGYFDKVTSALA-------
PHEA_NOSS1/6-162SWYVAALEFVRDN....HGLN......................GDVAGEANIYLNYAINALS-------
PHEA_AGLNE/6-163SAYIAAFAYTRDRVCVPRDMS......................AQAAVEFIGALDYVNSLS.-------
PHEB2_SYNPY/6-178GSAARAVAIMKAA..SAALITNTNSQPKKAA......VTQGDCSSLAGEAGSYFDAVISAIS-------
PHEB_NOSS1/6-172DAVASGIQKMKDA..AIAIANDSKGITK............GDCSQLIAELASYFDRAASAVV-------
PHAC_CYAPA/5-161IGMVDSITALKNS..TLSVLS......................PEDSEEVKPYFDYIIQAMA-------
APCF_CYAPA/6-165APTVRAIELLKNT..SKELIK....AAG...............ISAVDFIDEPFDYMGKVLA-------
PHEB1_SYNPW/6-184QSAARAVAIMKAS..ATAHIGETNTQANGGAKFRKMETTQGDCSALVAEAASYFDRVISAIA-------
PHCB1_FREDI/6-172SSVAVGVQKMKDA..ALAIAGDTNGITR............GDCASLMAEVASYFDKAASAVA-------
PHCB_SYNP2/6-172ASVAAGVRAMGKA..AVAIVMDPAGVTS............GDCSSLQQEIELYFETAAKAVE-------
PHAB_AGLNE/6-161GATIQAIQAMKEV..TSGLLG......................VDAGQEMALYFDYICSGLS-------

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window