Sequence alignment for CL0093

PF12770

A0LJ53_SYNFM/581-921--------------------------------RRRAGELHDL---------------LI..P.AKAREL-----------
A0LQE8_SYNFM/635-947--------------------------------RPASRKLFTA---------------VLG.P.ISRD..-----------
A0YK41_LYNSP/3523-3818--------------------------------LPYAQQFYQW---------------LIA.P.LQAE..-----------
A0YW51_LYNSP/1488-1787--------------------------------KVSGKKLYDW---------------LIL.P.LKAE..-----------
A0YZ16_LYNSP/128-434--------------------------------LKPAQQLYQW---------------IIQ.P.FETT..-----------
A1BCK0_CHLPD/513-826--------------------------------EETGETLYRE---------------LWE.PVLDLL..-----------
A1BEL3_CHLPD/43-361--------------------------------KPIGSALWSA---------------LGDGVELQQA..-----------
A1BEL6_CHLPD/46-364--------------------------------QALGSALWQV---------------LDADEKLQHA..-----------
A3WDM2_9SPHN/678-1006--------------------------------VERARELYLT---------------LFG.P.VEAE..-----------
A4HBL7_LEIBR/1053-1432--------------------------------QEPLRVLYQA---------------CIH.P.......-----------
A8L4T6_FRASN/741-1051--------------------------------EKASRWLGRA---------------VMD.PVLRLL..-----------
A8YIK9_MICAE/645-974--------------------------------KESARQLDET---------------LMQ.P.IRQL..-----------
A9WBC0_CHLAA/673-929--------------------------------RVLLQRLYRT---------------LIE.P.......-----------
A9WER9_CHLAA/54-394--------------------------------TRYGQELFRR---------------LFP.TRLSHQFR-----------
A9WF91_CHLAA/60-360--------------------------------VAYGTALGTM---------------LLSDPDLLAQFQ-----------
B0C874_ACAM1/207-507--------------------------------LESAQQLYQW---------------MVQ.P.LAAE..-----------
B2IXC0_NOSP7/1396-1691--------------------------------LRPSQQLYRW---------------IIA.P.LEAD..-----------
B2IZZ4_NOSP7/695-973--------------------------------QEVAKTLAEM---------------LAF.PKLLEG..-----------
B2JAK0_NOSP7/526-830--------------------------------DIELNKLYKI---------------LL..PQVIQEGL-----------
B2JAM9_NOSP7/866-1190--------------------------------EKVATKLSQM---------------LLQ.P.VAQE..-----------
B3QB04_RHOPT/774-1131--------------------------------LKLSYELYTL---------------LLQ.P.VESG..-----------
B4JKU3_DROGR/1402-1700--------------------------------PACLHTLYNL---------------LLA.P.......-----------
B4VHH6_9CYAN/1150-1443--------------------------------LKPAQQLYQW---------------LIA.P.IASE..-----------
B4VJ14_9CYAN/646-949--------------------------------QQSARALDKV---------------IMA.P.IREK..-----------
B4VJ30_9CYAN/3784-4081--------------------------------LEPAQQLYEW---------------LIA.P.LEAE..-----------
B4VLG1_9CYAN/97-405--------------------------------VALGQELYNA---------------LFQ.GSLRDSWM-----------
B4VLY5_9CYAN/1558-1850--------------------------------LAPAQQLYQW---------------IIA.P.IEDQ..-----------
B4VPE9_9CYAN/1179-1471--------------------------------LPSAQQLYQW---------------LIA.P.LEEE..-----------
B4VQD3_9CYAN/1443-1735--------------------------------ITPGQQLYQW---------------LVA.P.LEEN..-----------
B4VQK8_9CYAN/1658-1953--------------------------------LDGAKQLYQW---------------LVA.P.LETE..-----------
B4VTQ2_9CYAN/1746-2036--------------------------------LAPGKQLYDW---------------LIT.P.LEAD..-----------
B4VXN8_9CYAN/1368-1663--------------------------------LDSAQQLYQW---------------LIE.P.LADD..-----------
B4VXQ8_9CYAN/1752-2046--------------------------------LAPAQQLYNW---------------MIA.P.LESE..-----------
B4VYA5_9CYAN/647-942--------------------------------LPAAQQLYQW---------------LIA.P.LESD..-----------
B4WMI9_9SYNE/695-1035--------------------------------SAIARQLDEK---------------LIA.P.LRPF..-----------
B6C3H2_9GAMM/45-361--------------------------------QHLLRRVGKE---------------LLA.P.VAEH..-----------
B8G8X7_CHLAD/58-398--------------------------------SRYGQELFSR---------------LFP.GRLATSFN-----------
B8GD94_CHLAD/102-415--------------------------------RRVGRRLFRA---------------LTHDPRGAEALK-----------
C3Z401_BRAFL/1278-1602--------------------------------KPPLRALYDL---------------LIS.P.......-----------
F0SR63_PLABD/137-574--------------------------------QLSIERIKTV---------------VWD.P.......-----------
P72963_SYNY3/155-456--------------------------------REASQQLYQW---------------IIA.P.YAET..-----------
P73032_SYNY3/1449-1747--------------------------------QGQASQLYDW---------------FIK.P.IKLI..-----------
P74108_SYNY3/591-904--------------------------------INQGAQLYSQ---------------LIPDPTVIAG..-----------
Q01RE6_SOLUE/865-1136--------------------------------QVVATRLHEQ---------------LVR.P.FGKE..-----------
Q024J7_SOLUE/541-814--------------------------------IPAGDRLYQL---------------LIQ.P.LRAW..-----------
Q025F1_SOLUE/607-877--------------------------------RTAAAALYRK---------------LLG.PAAAEL..-----------
Q028B5_SOLUE/667-935--------------------------------QKLAVSLYRE---------------LLE.P.AAEQ..-----------
Q02DA1_SOLUE/510-786--------------------------------QRDARQLYDW---------------LIA.P.LAER..-----------
Q10YT7_TRIEI/1003-1309--------------------------------KDTARELDQK---------------LMQ.P.VRQL..-----------
Q10YU6_TRIEI/544-838--------------------------------KFQSNQLYNW---------------LIK.P.FEGYLE-----------
Q112V9_TRIEI/62-390--------------------------------TKVGEALFEA---------------LFD.AQLREYFL-----------
Q113D1_TRIEI/130-430--------------------------------NSQAKKIRGW---------------LLK...LQEK..-----------
Q113U8_TRIEI/3002-3297--------------------------------LSPAKKLYDW---------------FIT.P.ISAE..-----------
Q115J8_TRIEI/1466-1777--------------------------------EKLGEILHIK---------------EILQPILESE..-----------
Q117G6_TRIEI/881-1206--------------------------------KKTARELDEK---------------LMQ.P.VRQL..-----------
Q119J2_TRIEI/1474-1770--------------------------------LSNAKKLYKW---------------LIA.P.ISQE..-----------
Q16H64_AEDAE/1315-1614--------------------------------PSCLHVLYNL---------------LLA.P.......-----------
Q2G6U6_NOVAD/692-1020--------------------------------LDKSRALYKT---------------LFG.A.VEDL..-----------
Q2S6G2_SALRD/540-844--------------------------------LRPLRALHDH---------------LYA.P.VAAH..-----------
Q2W535_MAGSA/875-1218--------------------------------LDVGQQVHKL---------------IWQ.P.LERA..-----------
Q38C46_TRYB2/1044-1397--------------------------------VEPLKTLYNI---------------FIE.P.......-----------
Q3AQG5_CHLCH/44-362--------------------------------QAIGSILWRL---------------LDADEALANA..-----------
Q4C5K3_CROWT/405-717--------------------------------PEKLGYFWET---------------LLL.PQVLEK..-----------
Q4S217_TETNG/1205-1537--------------------------------KPPLRALYDL---------------LIA.P.......-----------
Q55594_SYNY3/165-457--------------------------------RATGKKLYDW---------------LIA.P.VANE..-----------
Q5LLA3_SILPO/680-970--------------------------------RIFGELLFET---------------LLP.QEVRRLYD-----------
Q64CV3_9ARCH/59-374--------------------------------RQIGKQLFTL---------------LNGDRQTLLR..-----------
Q7NCT1_GLOVI/600-923--------------------------------HKLARLLHQK---------------LLA.P.LGSQ..-----------
Q7NF67_GLOVI/550-854--------------------------------KAAARRLDRA---------------LME.P.VRAK..-----------
Q7NFD7_GLOVI/666-979--------------------------------RKLARTIDER---------------TMR.P.VRTR..-----------
Q7NIF7_GLOVI/691-997--------------------------------RALARQLDSL---------------LMQ.P.LRAR..-----------
Q7NJE3_GLOVI/660-988--------------------------------DKLARQLHQK---------------LLA.P.LQGN..-----------
Q7NLR0_GLOVI/653-961--------------------------------KPLARRLDQQ---------------LIA.P.IRRK..-----------
Q7NVB0_CHRVO/67-386--------------------------------QDTARALADL---------------FGQVPGLTAD..-----------
Q82I85_STRAW/1175-1481--------------------------------ERLCGWAWYA---------------AMR.P.......-----------
Q82L10_STRAW/969-1256--------------------------------TGTLAWLWDV---------------LAE.PVLDA...-----------
Q8DGG5_THEEB/541-835--------------------------------QRAAQALTEQ---------------VIT.P.IRPW..-----------
Q8DH74_THEEB/570-891--------------------------------KPSLKAAYGR---------------LLA.P.LEPF..-----------
Q8DHI1_THEEB/67-394--------------------------------GASGNQITNI---------------GTQQPNLLKE..-----------
Q8DIE5_THEEB/1127-1420--------------------------------LPAAQQLYQW---------------LIA.P.LRPQ..-----------
Q8YZU5_NOSS1/56-340--------------------------------TKDAENIYDA---------------IIS.P.IEKY..-----------
TTC28_HUMAN/1390-1713--------------------------------KPPLRALYDL---------------LIA.P.......-----------

PF03568

Q75EJ0_ASHGO/1148-1552--------------------------------VDICKYNGDL....----------.LLSK..VVST-------------
ESPL1_HUMAN/1716-2069--------------------------------LQPGTVGNTL....----------.LLTR..LEKD-------------
BIMB_EMENI/1605-2004--------------------------------LSLSADRAEF....----------.VVSR..LHRG-------------
Q6V3V9_DROVI/167-544--------------------------------IAGANGDIYV....----------.SLLRHCRSPE-------------
Q6ZHH8_ORYSJ/451-870--------------------------------LLPSYFPAWM....----------.MLSR..FDST-------------
Q6FTE1_CANGA/1147-1548--------------------------------IDICKLTNTL....----------.IIRR..ISNL-------------
Q8SRL6_ENCCU/365-731--------------------------------GEYFESVFYLNRGV----------ELSCKCRLDFV-------------
Q7RB01_PLAYO/620-1007--------------------------------EKHIKITKTV....----------.QNSK......-------------
ESPL1_MOUSE/1712-2065--------------------------------LQPGTLSNTL....----------.LLTR..LEKD-------------
Q6NR96_XENLA/1471-1824--------------------------------SQTRMPGDTI....----------.LLTR..LVRG-------------
ESP1_YEAST/1171-1571--------------------------------IDFCPITGNL....----------.LLSK..LEPR-------------
Q6CQQ7_KLULA/1114-1517--------------------------------IDICQLTGDL....----------.LITR..FDTV-------------
Q23491_CAEEL/745-1104--------------------------------QIVMADDKTI....----------.YLVK..LHAD-------------
Q6CCJ0_YARLI/1206-1588--------------------------------LAICPTSGDL....----------.IVCQ..YACN-------------
O82745_ARATH/1299-1653--------------------------------HIRSPVCAWV....----------.LISR..LNPE-------------
CUT1_SCHPO/1379-1770--------------------------------ITINNSGEDL....----------.FISK..IRKG-------------
Q9VRN6_DROME/169-538--------------------------------IIASDGAIYL....----------.TLLRHCRSSQ-------------
Q6V3V6_DROWI/170-538--------------------------------IASSKGSIYL....----------.AMLRHCRSPE-------------

PF01364

KGP83_PORGN/244-595MLVV....A..GAKF.................KEALKPWLTWKAQK......GFYLDVHYTDEAEVGT............
D1JG83_9ARCH/891-1295FAYT....K..IPKL.................SLTAAQIAA...........ARKAPVIDINKNPEEII...........
A2U064_9FLAO/401-768YLVI....T..NSDL.................ANEAQRLVDYHQTN.....SNLVGKVVLLDEIYNEFS...........
Q7MTE2_PORGI/239-573MIVI....V..AKKY.................EGDIKDFVDWKNQR......GLRTEVKVAEDIASPV............
D3HWT0_9BACT/400-777MVII....IPTSQKL.................LAQAQRLKAFHEAH.....DSLSVRIVPADELFNEFS...........
Q5S3Q9_9FLAO/543-910YLIV....T..PRIL.................KSQADRLADFHRNY.....SKLNVKVVTLDAIYNEFS...........
A9DMD5_9FLAO/555-923YIII....T..PDAF.................VSQAERLADFHRNN.....SGMIVKVVTLASIYNEFN...........
B0VGA8_CLOAI/228-563ILLIYGNNT..DPIF.................TAKLNEFVAWKRQK......GYDVNFVSTAETGGA.............
B7B5I7_9PORP/382-753MIII....A..QPNF.................TTQAERLAEAHRTK.....DNLTVRVVTPESIYNEFS...........
B8FFM0_DESAA/254-600FVIV....T..TGDL.................KDAFKNFIDIRNL.......DHTVKLALLNDIKKEF............
A3U7G6_CROAH/540-908YLML....V..DNTL.................ISEANRLAQYRRDR.....DGLNVKVVQLQTIYNEFS...........
D2QSX9_SPILD/414-786LLIV....T..PAAW.................RDQADRLAQFRRDH.....DQLSVLVVTTQQALNEFG...........
A3HW99_9BACT/398-769YILV....G..HHALEIP..........ADQFQNPLQSYAEHRAS.PL..GGGYKTLTIFMEEIYDQYG...........
B0VHP2_CLOAI/234-563ILVI....K..HSMF.................DATIQPWVDWKRQL......GFTVDVVDVTTAGS..............
A8ZUB1_DESOH/278-656YVLI....T..SQAIIDD...........VSIDPSVADFIAHRQAQ......GLTTAVVSIDSVLADDN...........
B0VIM2_CLOAI/182-528MLII....T..HSQL.................TNYQQDYIAWKKSI......GFDVYTANKSDIGS..............
Q2Z0E1_9BACT/643-1013YVMI....A..YDGF.................YDEALRLKNHRESAA...GGGYDVRLVRLSDVYSEFS...........
B3QXR8_CHLT3/734-1131YIII....T..SDEFINSS........NFEKTSNPVRQYKEYRESYLKAIGETGNVLVVTTQAVYDEFN...........
C2MCN4_9PORP/405-781YLMI....T..TEAL.................RPAAERLASYHREH.....SGLRVQVVTQQELFDEYN...........
A4A325_9PLAN/24-399TLVV....C..PEPL.................VPALRPWLDFRAAQ......GRQIGLITETA.................
A7NR84_ROSCS/499-867VLYI....A..PAPF.................HAALTPLVDLRRAQ......GYSVAVVDVQHLYDGWS...........
Q11Q36_CYTH3/558-932MIIV....T..HPDF.................QSQAQRLANFRTTN.....DGLRVYVCTTEQIYNEFG...........
Q7MX16_PORGI/272-637YLVI....Y..DDMFNVN...........QQPHDEIKRLCEHRAFY.....NGFDVAAVSIKDVLNSFPS..........
A0B5K7_METTP/796-1154FSHT....K..VPKL.................SLASMQVAA...........AKRAIVMDVAKDPQYVD...........
D0MH89_RHOM4/586-975LAII....T..ADTF.................RVYAEQLAEHRRD......QGLRVVVATVEQIYNEFS...........
A8UH97_9FLAO/539-910YIIL....A..PSQF.................ISQAERLAQINRDQ.....YNLNVKVVDLQTVYNEFS...........
B8KYL6_9GAMM/364-704YLMI....V..HSTL.................RTSLEPLAEFHRNR......GRTVVVADVEAIFDQFN...........
B8FIK5_DESAA/1139-1542YLII....T..TQAL.................AAAFETLEVHRTSV.....SGMACAVETVEDIEVNYP...........
Q11US7_CYTH3/392-767YFII....Y..PEVF.................NSSALSYDQYRSS.NA..GGNYDVERCSFEKLCNLYS...........
C6W101_DYAFD/326-680YLII....T..HPLMRTP...........VNGLDVVAEYAQYRAS.EA..GGGYHTSAAYSYELFDQFN...........
A5FJM8_FLAJ1/544-914YVIV....T..PRSL.................SSQAERLANFHRTN.....SNLNVKVISLENIYQEFS...........
Q7UG73_RHOBA/51-444VVVV....A..SPEF.................DETLEPWIQMRSEE......GLRVAIAR....................
A3J247_9FLAO/540-919YLII....T..PDFL.................STQAERLADFHRNN.....SGLSVRVVTLEKIYHEFA...........
A9WIM0_CHLAA/500-869AIYI....A..PRAL.................IGELEPLLARRQAQ......GWSPLAIAVEDVYAGWS...........
B0VHE7_CLOAI/227-554MLVIYGNYT..DTNY.................LSKINEFVTWKKQR......GFIVNAVSTGVTGI..............
C6VT06_DYAFD/394-758YIII....T..TDEL.................RDGAAAFAEYRSSPA...GGSFKPLIVNIRDIYDQFN...........
C6X3N8_FLAB3/546-921YLMI....T..VPEM.................MSQAQRLAAFYQDK.....FN..VAVVDVNKIYNEFS...........
A0LQH1_SYNFM/790-1132YIVI....T..SPEL.................SGAASSLADYRRRS.....KGLTTLVVTTEQIYDAFS...........
A1ZVJ9_9BACT/406-774LVII....V..PEVF.................LSEAERLAAFRRTN.....DGLSVTVVKLSQVYNEFS...........
B0VHF1_CLOAI/214-595YLIV....A..DAEK.................ITQWTPLKTFQEIR......GKTVLIKSMSEIIAEN............
B0VIE7_CLOAI/193-598LLVI....T..TPEL.................YTALDWLVTFRQSQ......GVDVSFCDI.AIALASG...........
C6W3P4_DYAFD/414-806YMIV....S..SESL.................IEAADSIALYRSAETA..GRKFKTGIFKIRDIYNQFN...........
B2RGP6_PORG3/408-787LIIV....S..TQAL.................LPEADRLATYRREK.....NGLKVLVVLQEQVFNEFS...........
D2QJ99_SPILD/409-770YVII....T..HEALMTPLTD.....SLTGRVTNAIQSYAAYRAS.VA..GGTHDTLTITMQQLIDQYN...........
A9B5Q8_HERA2/466-850TIYL....A..PKQW.................HSLVQPLINRRQQQ......GWQPLLVDVQAIYDRWS...........
D2QFF3_SPILD/397-745YVII....T..HASL.................RQSAATYAGYRSS.AA..GGSYKPFIVESDSLYDQFN...........
B0VH03_CLOAI/589-939NIIV....A..PAEF.................LQQAQELANKYREI.....YQISSKVILVDDIYNQFN...........
D2R2P5_PIRSD/21-411TVVV....C..PREF.................VAALDPLLAHRYAQ......GHRFAYVANTG.................
C6W0Z3_DYAFD/393-758LLII....T..PAEW.................VGEANRLAGFRNSN.....DGLDVLVVTTDQVYNEYA...........
A3XQP5_LEEBM/552-929YLMI....T..PNEL.................RAQAERLAQHNRTY.....RNLNVKVVTLDAIYNEFS...........
C9RIY0_FIBSS/581-957YLII....T..PDVF.................LAQAESLAVFRSSEKS..ASQLVTAVVSAENIYRHYT...........
Q2PY26_9BACT/412-780YVIV....A..PEHM.................LIEAERLAQFHRD......RGLTVQAVDVQHVYNEFS...........
Q26FX7_FLABB/537-909YLII....A..PDFL.................ENEAQRLANYHITS.....SNLNTKVVTLTDIYNEFS...........
B0VJT2_CLOAI/236-566YLIIYGNNS..DINF.................TSALNEYVLWKKQK......GADVMVASTAANEAGN............
C6BTD6_DESAD/56-402NVIV....C..TADF.................MRAARYFSYLHREF.....EGVKSVIVKVPSTNGTAE...........
D2QE53_SPILD/328-1007YLII....T..DDRRWTFQNGKPVAGNALPLDSAGKTATSHFLRLAEWKAKRGIDAKVVTVSEIVQGGSSTGLKWGDFTD
A2BK55_HYPBU/159-551MIII....VPDDTLV.................EMYAEDIAKLHREM......GLNVRIVTTSYIYENYPEAELPSDVCRP
B0VHP1_CLOAI/283-636YVII....L..PDNF.................IAPMQPFIDWKKQE......GYNVIVAPTSITGT..............
Q1Q1Y4_9BACT/620-970YIII....T..HEDF.................YDNALALASHRIDD......GLRVVTVKVGDIYDEFN...........
C7PNY3_CHIPD/396-764MLIV....T..TPSL.................RTAASKLAAWHGTH.....DGLNVRVVTVNEIYNEFA...........
Q6LFY5_PHOPR/224-617YLII....T..ADRF.................QQTVEPLAAWKRKK......GYQVHVATITEVGN..............
B3QVL4_CHLT3/688-1063YIII....Y..ATDY.................KSDAERLLAHRSSTSIWGSHALSGIAVDAQQVYNEFS...........
A9B187_HERA2/552-907YLLISYNPA.NSSSW.................SDALQPLITQRASQ......GLKPLLIDVQQIYDQFG...........
B3C566_9BACE/537-910MIII....SPDRKDL.................MTQAERLAQAHREK.....DGLSVLVLAAPQIYNEFS...........
B0VJY1_CLOAI/655-1014VIVI....A..PWQFT...............SVEGTLQLKSLWESE......GHTVKIVDVQDIYDEFN...........
B8G4Y1_CHLAD/584-1054FLII....A..PQSVI...............QAGALADFVDFKRRL......GFEVEVVSIEQAGQGASPN........D
A1ZEG7_9BACT/410-775YLII....T..HASLRQA..........TGGVSDPVQAYAAYRAS.TE..GGGFDTLTVNVKLLYNQFN...........
B0VF22_CLOAI/223-583MIII....T..NNDR.................ISWFSEYSAWRSAK......GVSNSIYSMEDIVSAY............
A0LKV0_SYNFM/924-1265YCIV....T..HGLF.................TDGARRIAEQKRNE......GYNPAIVDVEVLYNRYS...........
A8ZTD5_DESOH/257-648LLII....S..PPEL.................VAAADRLANWKRAQ......GILTEVRTTGQTGT..............
A9B8S0_HERA2/477-840VIIA.......PRAF.................LPALDPLR............TPTTVLVAREDLDAAWA...........
C3JBB2_9PORP/421-799LIIL....S..PEAF.................LSEAERLAEFHRSV.....DGMQVLVVGETALFNEFN...........
C9SW40_VERA1/279-917YLII....T..DDVTWDPVAIA..PGVSRPGLIKEFERLAEAKRAR......GISTRVVSITDIVAGRWGN.........
C9LI59_9BACT/509-899MVII....IPQSGKL.................LAQAERLAEAHKKQ......GLRVKVVRADQLYNEYS...........
B5ICF9_ACIB4/214-642NIII....T..SPQL.................KAAAQRLADFHNST......GVTSWVVTTTWIAKNYQPAP......NP
Y048_ARCFU/22-377EIIL....T..SEKL.................INSAYQLQEIHEKV......GIQSDIVTVEQIWDSYSPVE......DP
A3I371_9BACT/360-725LLII....T..TDEF.................SFAANKLKS.HKTN.....LGINTEVVFLKDIYNSFS...........

PF11713

A0AED2_YEREN/2138-2301--------------------------------------------------------------------------------
A0KHZ7_AERHH/3609-3767--------------------------------------------------------------------------------
A1EPL5_VIBCL/3469-3627--------------------------------------------------------------------------------
A2PYQ6_CLOPF/575-753--------------------------------------------------------------------------------
A3UPN6_VIBSP/3781-3944--------------------------------------------------------------------------------
A4TI66_YERPP/771-929--------------------------------------------------------------------------------
A4TI66_YERPP/1083-1262--------------------------------------------------------------------------------
A5KV80_9GAMM/1072-1230--------------------------------------------------------------------------------
A5L6I6_9GAMM/693-849--------------------------------------------------------------------------------
A5L6I6_9GAMM/1529-1710--------------------------------------------------------------------------------
A5L6I6_9GAMM/1908-2074--------------------------------------------------------------------------------
TOXA_CLODI/576-757--------------------------------------------------------------------------------
TOXB_CLODI/574-755--------------------------------------------------------------------------------
Q2KX68_BORA1/2483-2627--------------------------------------------------------------------------------
Q2SAY5_HAHCH/1-160--------------------------------------------------------------------------------
Q46149_CLONO/581-762--------------------------------------------------------------------------------
Q46342_CLOSO/574-755--------------------------------------------------------------------------------
Q7N1Z0_PHOLL/2456-2614--------------------------------------------------------------------------------
Q7N726_PHOLL/2997-3151--------------------------------------------------------------------------------
Q7VV06_BORPE/2551-2702--------------------------------------------------------------------------------
Q7VV06_BORPE/2959-3112--------------------------------------------------------------------------------
Q7VV06_BORPE/3397-3549--------------------------------------------------------------------------------
Q7VV06_BORPE/3808-3959--------------------------------------------------------------------------------

PF13900

B4E0H0_HUMAN/45-92--------------------------------------------------------------------------------
Q7Z4P3_HUMAN/54-101--------------------------------------------------------------------------------
Q6ZTF6_HUMAN/58-105--------------------------------------------------------------------------------
B9NCR3_POPTR/128-175--------------------------------------------------------------------------------
CN165_HUMAN/57-104--------------------------------------------------------------------------------
Q9P195_HUMAN/6-53--------------------------------------------------------------------------------
B3KRW9_HUMAN/44-91--------------------------------------------------------------------------------
Q6ZS53_HUMAN/79-126--------------------------------------------------------------------------------
Q6ZNG3_HUMAN/65-112--------------------------------------------------------------------------------
B7Z559_HUMAN/16-63--------------------------------------------------------------------------------
Q9BGW3_MACFA/24-71--------------------------------------------------------------------------------
Q6ZNU7_HUMAN/32-79--------------------------------------------------------------------------------
B9NCR2_POPTR/11-60--------------------------------------------------------------------------------
Q6ZNZ6_HUMAN/6-53--------------------------------------------------------------------------------
Q8N287_HUMAN/31-78--------------------------------------------------------------------------------
Q95KE1_MACFA/88-135--------------------------------------------------------------------------------
Q9UI48_HUMAN/14-61--------------------------------------------------------------------------------
Q9H5D5_HUMAN/64-111--------------------------------------------------------------------------------
Q9NR08_HUMAN/145-192--------------------------------------------------------------------------------
Q6ZSG7_HUMAN/16-63--------------------------------------------------------------------------------
B9NF68_POPTR/42-89--------------------------------------------------------------------------------
Q9P147_HUMAN/36-83--------------------------------------------------------------------------------
Q6ZQR8_HUMAN/34-81--------------------------------------------------------------------------------
C9JL81_HUMAN/280-327--------------------------------------------------------------------------------
Q96ID7_HUMAN/6-53--------------------------------------------------------------------------------
Q5T5H1_HUMAN/139-186--------------------------------------------------------------------------------
B7Z2Z5_HUMAN/303-350--------------------------------------------------------------------------------
C9JQS0_HUMAN/70-117--------------------------------------------------------------------------------
Q4R5J6_MACFA/21-68--------------------------------------------------------------------------------
Q9NX85_HUMAN/34-81--------------------------------------------------------------------------------
B4XZE4_HUMAN/24-71--------------------------------------------------------------------------------
Q6STG2_HUMAN/10-57--------------------------------------------------------------------------------
Q96LS9_HUMAN/23-70--------------------------------------------------------------------------------
Q6ZTX9_HUMAN/54-102--------------------------------------------------------------------------------
Q9P191_HUMAN/17-60--------------------------------------------------------------------------------

PF00656

Q7Q803_ANOGA/54-306-------------------------------------GVAAV--------------------------------------
Q7QGM9_ANOGA/35-227-------------------------------------AYVLV--------------------------------------
Q7PV92_ANOGA/14-237-------------------------------------GIALI--------------------------------------
Q70VV0_PICAB/3-415-------------------------------------KKAVL--------------------------------------
CASP4_MOUSE/132-369-------------------------------------RKALI--------------------------------------
CASP5_HUMAN/193-430-------------------------------------RLALI--------------------------------------
MCA1_KLULA/138-430-------------------------------------RKALL--------------------------------------
MCA9_ARATH/10-321-------------------------------------RLAVL--------------------------------------
MCA1_ARATH/80-362-------------------------------------KRAVI--------------------------------------
MCA1_DEBHA/146-437-------------------------------------KKALL--------------------------------------
MCA7_ARATH/3-401-------------------------------------KRALL--------------------------------------
Q7Q1E0_ANOGA/62-291-------------------------------------GMALI--------------------------------------
Q89XE4_BRAJA/58-278-------------------------------------RLALV--------------------------------------
Q6N5Q1_RHOPA/33-253-------------------------------------RIALV--------------------------------------
Q9ZSP8_HEVBR/3-415-------------------------------------KKAVL--------------------------------------
Q89FZ4_BRAJA/32-256-------------------------------------RLALV--------------------------------------
Q6QN97_PIG/259-484-------------------------------------GICLI--------------------------------------
Q7Q4X6_ANOGA/73-309-------------------------------------GLALI--------------------------------------
Q6E5N8_ICTPU/119-362-------------------------------------GFCVI--------------------------------------
Q6AKF4_DESPS/28-248-------------------------------------RIALI--------------------------------------
O42284_CHICK/42-279-------------------------------------RRALL--------------------------------------
Q7QKT2_ANOGA/35-260-------------------------------------GIAVV--------------------------------------
Q6N0T4_RHOPA/30-251-------------------------------------RVALV--------------------------------------
Q9NHF9_DROME/56-302-------------------------------------GIALI--------------------------------------
Q89HT8_BRAJA/51-272-------------------------------------RVALV--------------------------------------
Q87Z21_PSESM/2-225-------------------------------------KKALV--------------------------------------
CASP1_PIG/163-400-------------------------------------RLALI--------------------------------------
CASP3_XENLA/56-280-------------------------------------GMCLI--------------------------------------
Q9I8J3_DANRE/238-473-------------------------------------GYCLI--------------------------------------
Q9GV88_HYDVU/84-316-------------------------------------GTLTI--------------------------------------
MCA4_ARATH/3-416-------------------------------------KKAVL--------------------------------------
CASP2_RAT/200-445-------------------------------------GLALV--------------------------------------
Q9IB64_XENLA/261-494-------------------------------------GWCVV--------------------------------------
MCA2_ARATH/116-414-------------------------------------KRAVI--------------------------------------
Q9Y1U6_PRIPA/173-413-------------------------------------GYALI--------------------------------------
CASPD_BOVIN/136-373-------------------------------------RLALI--------------------------------------
CASPE_MOUSE/22-256-------------------------------------RLALT--------------------------------------
MCA1_ASHGO/154-449-------------------------------------RKALL--------------------------------------
PCP_DICDI/188-405-------------------------------------RISFI--------------------------------------
Q8ITP2_BRAFL/151-396-------------------------------------GLCLV--------------------------------------
Q7WDK3_BORBR/552-800-------------------------------------H.AMI--------------------------------------
Q98UI8_DANRE/48-280-------------------------------------GHCII--------------------------------------
ICE_DROME/94-328-------------------------------------GMALI--------------------------------------
Q7PZJ9_ANOGA/20-250-------------------------------------GIAVV--------------------------------------
Q9NBW3_DROME/38-248-------------------------------------PAVYI--------------------------------------
MCA5_ARATH/3-408-------------------------------------KKAVL--------------------------------------
O88550_RAT/68-301-------------------------------------GKCII--------------------------------------
Q9DDJ2_DANRE/174-400-------------------------------------GLALL--------------------------------------
Q985X8_RHILO/35-256-------------------------------------RLAFV--------------------------------------
CASP1_SPOFR/61-293-------------------------------------GMAII--------------------------------------
CASP1_FELCA/161-406-------------------------------------RLALI--------------------------------------
Q9IB66_XENLA/58-298-------------------------------------GLALI--------------------------------------
CFLAR_HUMAN/252-477-------------------------------------GICLI--------------------------------------
CASP1_MOUSE/162-398-------------------------------------RLALI--------------------------------------
CASP2_CHICK/171-416-------------------------------------GLALI--------------------------------------
CASP1_DROME/79-313-------------------------------------GVALI--------------------------------------
Q9DDL2_DANRE/323-560-------------------------------------KVALL--------------------------------------
MCA1_SCHPO/130-422-------------------------------------RKALL--------------------------------------
Q8JIS8_ORYLA/58-285-------------------------------------GICLI--------------------------------------
Q89IK1_BRAJA/30-253-------------------------------------RVALV--------------------------------------
O93415_CHICK/57-299-------------------------------------GVALI--------------------------------------
Q89MV1_BRAJA/176-400-------------------------------------RIALV--------------------------------------
Q8IEW1_9TRYP/63-322-------------------------------------K.ALF--------------------------------------
Q98IJ9_RHILO/30-261-------------------------------------RVALV--------------------------------------
Q9TZP5_CAEEL/26-261-------------------------------------CRAII--------------------------------------
Q7RFI8_PLAYO/964-1364-------------------------------------KKAVV--------------------------------------
MCA1_YARLI/168-458-------------------------------------KKALL--------------------------------------
MCA1_CANGA/98-389-------------------------------------RKALL--------------------------------------
Q8I6Y2_GEOCY/158-414-------------------------------------GMALI--------------------------------------
Q98IJ6_RHILO/11-238-------------------------------------RIALV--------------------------------------
CASP1_HUMAN/163-400-------------------------------------RLALI--------------------------------------
Q9I9L7_DANRE/145-379-------------------------------------RLALL--------------------------------------
Q8YS65_NOSS1/4-245-------------------------------------NWAIA--------------------------------------
Q8ITP3_BRAFL/87-323-------------------------------------GQAII--------------------------------------
Q98G71_RHILO/26-252-------------------------------------RVALV--------------------------------------
Q74F93_GEOSL/6-270-------------------------------------ALALG--------------------------------------
CFLAR_MOUSE/257-481-------------------------------------GICLI--------------------------------------
MCA6_ARATH/3-366-------------------------------------KKALL--------------------------------------
Q8T8E8_9TRYP/84-341-------------------------------------R.ALF--------------------------------------
CAS1A_XENLA/144-382-------------------------------------GLALI--------------------------------------
CED3_CAEEL/243-494-------------------------------------GMCLI--------------------------------------
Q53839_STRCH/9-268-------------------------------------SRVVL--------------------------------------
Q6DCI2_XENLA/78-314-------------------------------------GRCII--------------------------------------
B5VS82_YEAS6/157-450-------------------------------------RKALI--------------------------------------
Q6N329_RHOPA/73-298-------------------------------------RVALV--------------------------------------
Q6NTR7_XENLA/280-494-------------------------------------GFCLI--------------------------------------
Q7NPG1_GLOVI/7-278-------------------------------------K.ALI--------------------------------------
CASP8_HUMAN/234-476-------------------------------------GYCLI--------------------------------------
Q98CE0_RHILO/5-238-------------------------------------RVALV--------------------------------------
Q82I86_STRAW/5-276-------------------------------------H.ALL--------------------------------------
CASP1_CANFA/163-400-------------------------------------RLALI--------------------------------------
Q9I8S9_ONCMY/57-297-------------------------------------GLALI--------------------------------------
CASP9_HUMAN/161-413-------------------------------------GHCLI--------------------------------------
CASP6_MOUSE/28-270-------------------------------------GVALI--------------------------------------
Q8T8E6_9TRYP/84-343-------------------------------------R.ALF--------------------------------------
Q6NBN5_RHOPA/57-277-------------------------------------RLALV--------------------------------------
Q9IB63_XENLA/144-396-------------------------------------GFCLI--------------------------------------
Q89XG2_BRAJA/27-248-------------------------------------RYALV--------------------------------------
Q90WU1_CHICK/237-479-------------------------------------GVCLI--------------------------------------
Q9GV89_HYDVU/93-318-------------------------------------GFVLI--------------------------------------
Q6PAD9_XENLA/268-495-------------------------------------GYCLI--------------------------------------
ICENC_DROME/196-443-------------------------------------GVLLM--------------------------------------
Q98JS7_RHILO/35-253-------------------------------------RAAIV--------------------------------------
CASP8_MOUSE/236-478-------------------------------------GYCLI--------------------------------------
Q89KP2_BRAJA/86-307-------------------------------------RIALV--------------------------------------
Q86FL0_ANOST/52-286-------------------------------------GIAII--------------------------------------
P74453_SYNY3/40-299-------------------------------------KWALL--------------------------------------
CASPC_MOUSE/176-415-------------------------------------RLALI--------------------------------------
MCA8_ARATH/3-378-------------------------------------KKALL--------------------------------------
Q8JG42_TAKRU/51-279-------------------------------------GHCII--------------------------------------
Q90WU0_CHICK/148-400-------------------------------------GHCLI--------------------------------------
Q89HP3_BRAJA/336-569-------------------------------------RMALI--------------------------------------
Q8I749_SUBDO/254-491-------------------------------------GICLI--------------------------------------
O93417_CHICK/53-281-------------------------------------GVCVI--------------------------------------
CASPE_HUMAN/18-241-------------------------------------RLALI--------------------------------------

PF14538

A2DJF0_TRIVA/81-229--------------------------------QMVPEGVHIH--------------------------------------
A2DYB3_TRIVA/11-163--------------------------------CNKTKAVLSF--------------------------------------
A2DYM2_TRIVA/66-217--------------------------------QIHQVACAYL--------------------------------------
A2E336_TRIVA/52-203--------------------------------NYSKSSIFIV--------------------------------------
A2EZ34_TRIVA/86-237--------------------------------LPQKVDCVYL--------------------------------------
A2F8U1_TRIVA/62-211--------------------------------LTFTTQGIVV--------------------------------------
A2F9H3_TRIVA/30-182--------------------------------INKTKSAICF--------------------------------------
A2FJN8_TRIVA/40-192--------------------------------CVKTKGAICF--------------------------------------
A2G2E2_TRIVA/83-230--------------------------------QKMNISSHIE--------------------------------------
A2G590_TRIVA/29-181--------------------------------CTKTKAALCL--------------------------------------
A2GCD5_TRIVA/96-248--------------------------------RIEPIECVVV--------------------------------------
A8Q911_MALGO/109-262--------------------------------RLRTVTAALV--------------------------------------
A9TBL2_PHYPA/90-243--------------------------------RMKTGWVALC--------------------------------------
A9V5A2_MONBE/627-778--------------------------------KSKTLTLGLI--------------------------------------
B0CNS4_LACBS/33-186--------------------------------KLKTATAALV--------------------------------------
B0ENS2_ENTDS/37-190--------------------------------RIKTIHLILT--------------------------------------
B0WBU4_CULQU/24-183--------------------------------RLDSL.LLTS--------------------------------------
B0WR30_CULQU/146-268--------------------------------HFRQTTVV..--------------------------------------
B3RPQ9_TRIAD/42-195--------------------------------RMKTVSVALV--------------------------------------
B4R5C8_DROSI/213-366--------------------------------RMKTASVALV--------------------------------------
B6JY50_SCHJY/122-275--------------------------------RLKTVSAALF--------------------------------------
B7PLB3_IXOSC/91-248--------------------------------SMKTVSVALV--------------------------------------
B8CBK6_THAPS/255-410--------------------------------RMKTVGICLI--------------------------------------
B8P5W0_POSPM/106-259--------------------------------KLKTANAALV--------------------------------------
C4LXC3_ENTHI/41-195--------------------------------IVRTPHLIIC--------------------------------------
C5KFU4_PERM5/815-945--------------------------------ASLLKSLQML--------------------------------------
D0N306_PHYIT/11-164--------------------------------RMKTMDVALV--------------------------------------
D2VMD1_NAEGR/143-295--------------------------------RLKTVHVALV--------------------------------------
D8LUT8_BLAHO/28-155--------------------------------ILEVISSSLR--------------------------------------
D8RG53_SELML/71-224--------------------------------RMKTVSVALV--------------------------------------
D8T9J0_SELML/49-198--------------------------------RMKTGCVALV--------------------------------------
E1ZHR5_CHLVA/131-284--------------------------------RLKTTAVALV--------------------------------------
E3Q6X3_COLGM/216-369--------------------------------RLKTVSAALA--------------------------------------
E4XFS5_OIKDI/47-229--------------------------------KFKARGIITC--------------------------------------
E4ZUC8_LEPMJ/159-315--------------------------------RLKTVSAVLA--------------------------------------
E5SIN8_TRISP/43-196--------------------------------RMKTVSVALV--------------------------------------
E6R3W2_CRYGW/91-244--------------------------------KLKTVTAGLF--------------------------------------
E7F7S1_DANRE/56-209--------------------------------RMKTVSVALV--------------------------------------
E7LNC0_TRYCR/61-219--------------------------------KVKSTQVILF--------------------------------------
E9BHG6_LEIDB/113-280--------------------------------RVRITQAVLL--------------------------------------
E9CIT6_CAPO3/726-879--------------------------------RMKTVCVALV--------------------------------------
F0W2J7_9STRA/129-282--------------------------------RMKTMDVALV--------------------------------------
F0XXV0_AURAN/11-165--------------------------------RMKTVSVALV--------------------------------------
F0ZAV4_DICPU/114-267--------------------------------RMKTVSVALV--------------------------------------
F1KR12_ASCSU/48-201--------------------------------RMKTVSVALV--------------------------------------
Q0CHB3_ASPTN/188-344--------------------------------RLKTVSAALA--------------------------------------
Q6BQ71_DEBHA/64-218--------------------------------RQKTISAVLV--------------------------------------
RTOR1_ARATH/103-256--------------------------------RMKTGCVALV--------------------------------------

PF01650

VPEG_ARATH/59-330-------------------------------------RWAVL--------------------------------------
A0CQC7_PARTE/19-285-------------------------------------NWALL--------------------------------------
A2FXM6_TRIVA/13-267-------------------------------------TWAVI--------------------------------------
O24539_VICNA/53-325-------------------------------------RWAVL--------------------------------------
HGLB_SCHMA/37-291-------------------------------------KWAVL--------------------------------------
HGLB_SCHJA/31-285-------------------------------------KWAVL--------------------------------------
VPE_VICSA/56-325-------------------------------------RWAIL--------------------------------------
Q02SI3_PSEAB/341-579-------------------------------------LYALS--------------------------------------
Q08BI0_DANRE/27-278-------------------------------------AWVLL--------------------------------------
Q0MYV8_EMIHU/33-301-------------------------------------HWAVL--------------------------------------
Q22P32_TETTS/20-285-------------------------------------NYSVL--------------------------------------
Q22P33_TETTS/20-285-------------------------------------NYSVL--------------------------------------
Q2M438_PHYIN/25-298-------------------------------------HWAVI--------------------------------------
Q2UVF3_HAECO/29-287-------------------------------------LYALL--------------------------------------
Q4K5F2_PSEF5/335-570-------------------------------------LYSLT--------------------------------------
Q4RED0_TETNG/30-283-------------------------------------NWVVI--------------------------------------
Q4UU48_XANC8/124-392-------------------------------------LYVVG--------------------------------------
Q6EHZ7_TRIVA/12-258-------------------------------------RFAVL--------------------------------------
Q6FEB2_ACIAD/229-477-------------------------------------WYFLG--------------------------------------
Q6L4R2_ORYSJ/41-319-------------------------------------RWAVL--------------------------------------
Q6NYJ7_DANRE/32-288-------------------------------------HWVVI--------------------------------------
Q6PRC7_IXORI/38-293-------------------------------------LWALL--------------------------------------
Q711M2_FASHE/21-278-------------------------------------NWAVL--------------------------------------
Q84LM2_ORYSJ/62-334-------------------------------------RWAVL--------------------------------------
Q852T1_TOBAC/49-320-------------------------------------KWAVL--------------------------------------
Q86TV2_HUMAN/29-286-------------------------------------HWVVI--------------------------------------
Q88QE3_PSEPK/400-640-------------------------------------LYSLV--------------------------------------
Q8LGK2_ARATH/46-316-------------------------------------RWAVL--------------------------------------
Q949L7_BETVU/51-321-------------------------------------RWAVL--------------------------------------
Q9LLQ4_SESIN/54-326-------------------------------------RWAVL--------------------------------------
Q9LWZ3_ORYSJ/41-304-------------------------------------KWALL--------------------------------------
Q9SBX2_MAIZE/45-317-------------------------------------RWAVL--------------------------------------
Q9SMD0_SOLLC/39-316-------------------------------------KWAVL--------------------------------------
Q9XG75_TOBAC/40-306-------------------------------------KWAVL--------------------------------------

PF03415

Q8A866_BACTN/37-399-------------------------------------VYIAG--------------------------------------
Q9WZB1_THEMA/121-462-------------------------------------VWMAA--------------------------------------
Q8XM44_CLOPE/59-508-------------------------------------VYADC--------------------------------------
Q9X1S5_THEMA/586-937-------------------------------------VWMCA--------------------------------------
Q9WYY6_THEMA/5-301-------------------------------------SWI..--------------------------------------
CLOS_CLOHI/60-510-------------------------------------YYCDA--------------------------------------
Q8TIY6_METAC/66-593-------------------------------------VYMVG--------------------------------------

PF12770

A0LJ53_SYNFM/581-921--I.........SS-------------------------A----K...VLLVVPTG......SLYTIPFEM..LVRPAAT
A0LQE8_SYNFM/635-947--L.......EQAG-------------------------A----T...TLLLSLDG......ALRYIPFSC..LYDGR..
A0YK41_LYNSP/3523-3818--L.......EAQE-------------------------I----N...NLVFIMDE......GLRSLPLAA..LHDGE..
A0YW51_LYNSP/1488-1787--L.......EKHQ-------------------------V----K...TLIFSMDT......GLRTLPIAA..LYDGE..
A0YZ16_LYNSP/128-434--L.......KEKG-------------------------I----D...TLLLCTGP......GLRTLPLGV..LHDGQ..
A1BCK0_CHLPD/513-826--........QDMG-------------------------I----ADDAELVWFPQG......GSGVFPVHAAWRQDSDGS
A1BEL3_CHLPD/43-361--........KHQA-------------------------G----QSILPIVIESDI.....PAILQLPWEM..LWHPEY.
A1BEL6_CHLPD/46-364--........KKQA-------------------------G----TGILPLVIASDD.....PAILQLPWET..LYHPDY.
A3WDM2_9SPHN/678-1006--M.........AS-------------------------I----K...HLIFEPDG......PMLQLPPQV..LIASQEG
A4HBL7_LEIBR/1053-1432--IIGYVRALDSQL-------------------------L----FGDGMITVVPSG......QMWLVPFHA..LLNVKAG
A8L4T6_FRASN/741-1051--..........AP-------------------------Y----R...RAVLMPGG......LLGSAPLHAARLAETVGG
A8YIK9_MICAE/645-974--L.........GN-------------------------T----K...TILLSPDA......ALNLIPFEA..LVDENN.
A9WBC0_CHLAA/673-929--..........LP-------------------------I----PVEGKLLIAPCA......PIHLAPFAA..LWNGN..
A9WER9_CHLAA/54-394--VSQRTAAQQQQP-------------------------L----R..LRLALDPQD.....AELQAIPWELLHFPATDNQ
A9WF91_CHLAA/60-360--AARAIARRGRRP-------------------------L----PIRFRLFIAPSA.....AELHALRWETLCMPDG...
B0C874_ACAM1/207-507--L.......EKKK-------------------------I----D...TIIFSMDA......GLRSLPLAA..LHDGQ..
B2IXC0_NOSP7/1396-1691--L.......QARE-------------------------I----N...NLVFLPDM......GLRSTPMAA..LHDGK..
B2IZZ4_NOSP7/695-973--........LPKD-------------------------I----R...ALTIVPDD......ILHGFPFAA..IRYKE..
B2JAK0_NOSP7/526-830--I........QLK-------------------------A----N...RIAIVTDN......TLDFIPFSA..LRTNDG.
B2JAM9_NOSP7/866-1190--..........LG-------------------------N----K...RLLIVGDG......ILQYIPFAA..LPNPTQT
B3QB04_RHOPT/774-1131--.........WKP-------------------------A----K...KLIVVTNG......ALGLLPLSLLPIAPAEAA
B4JKU3_DROGR/1402-1700--FDDLLPSVASVS-------------------------R----QGRRELILVLDS......ALYLVPFAI..LRAAGDD
B4VHH6_9CYAN/1150-1443--L.......EAAE-------------------------I----D...TLLFSMDA......GLRTIPMPV..LHDGE..
B4VJ14_9CYAN/646-949--L.........GN-------------------------S----R...HILIAPDG......ALSLIPFEA..LVDESN.
B4VJ30_9CYAN/3784-4081--L.......EAQG-------------------------I----Q...NLVFIMDS......GLRSLPVAA..LHDGQ..
B4VLG1_9CYAN/97-405--MA....QAIAQN-------------------------Q----RTVLRLRLGLKG.....NRLPRLPWEV..LHAGD..
B4VLY5_9CYAN/1558-1850--L.......QTQG-------------------------I----Q...NLSFIMDG......GLRSIPLLA..LYDGE..
B4VPE9_9CYAN/1179-1471--L.......QDRE-------------------------I----N...NLAFIMDQ......GLRSLPVAA..LHDGN..
B4VQD3_9CYAN/1443-1735--L.......QTQE-------------------------I----D...NLAFIMDE......GLRSLPVAA..LHDGE..
B4VQK8_9CYAN/1658-1953--L.......QETG-------------------------I----E...NLVFILDE......GLRSLPIAA..IHDGN..
B4VTQ2_9CYAN/1746-2036--L.......QAQG-------------------------I----Q...NLVFVMDR......GLRSMPVAA..LHNEE..
B4VXN8_9CYAN/1368-1663--L.......EARQ-------------------------I----Q...GLMFAMDS......GLRSLPIAA..LHDGD..
B4VXQ8_9CYAN/1752-2046--L.......EEQG-------------------------I----D...TLIFSMDA......GLRTIPMAA..LHDGN..
B4VYA5_9CYAN/647-942--L.......DALD-------------------------I----D...TLIFCMDG......GLRQLPMAA..LHDGK..
B4WMI9_9SYNE/695-1035--L.........NN-------------------------K----E...QLLLSPDS......QLNLIPFDA..LIDNED.
B6C3H2_9GAMM/45-361--L.........GE-------------------------A----K...RLLLVTHG......GLHLLPLEAAPFPAGNGA
B8G8X7_CHLAD/58-398--TTRLIAIQQQQP-------------------------L----R..LRLAIDPQD.....AILQAIPWELLYLPALDAQ
B8GD94_CHLAD/102-415--MVRNFALAVDRP-------------------------L----LIACHFNAHAAAD....VALASLPWEL..LWADEP.
C3Z401_BRAFL/1278-1602--MEDVLPRMNGPK-------------------------S----PA.GQLVLVLDG......DLYLVPFAV..LKGSSS.
F0SR63_PLABD/137-574--VHEALSSDDGDS-------------------------V----R...QVVVLPSP......LLQQIPLEV..LAGDD..
P72963_SYNY3/155-456--L.......EAQG-------------------------I----D...TLLFCLGN......GVRGLPMAA..LFDGE..
P73032_SYNY3/1449-1747--L.......ENKK-------------------------I----E...NISFILDR......GLRSLPMAT..MYDRQS.
P74108_SYNY3/591-904--............-------------------------.----K...RLLIVPDG......VLQYLPFGALVTDNPPGQ
Q01RE6_SOLUE/865-1136--I.........EH-------------------------A----R...RIWIEPDD......WLSLLPFRA..LRDDRG.
Q024J7_SOLUE/541-814--I.........PA-------------------------G----S...RVILTPDG......ALHGLNFESLPLPGDTP.
Q025F1_SOLUE/607-877--..........RG-------------------------K----S...TIVVVPDG......VLWNLPFQA..LVRPDG.
Q028B5_SOLUE/667-935--L.........RG-------------------------K----S...TVVIAPDG......FLWQLPFQA..LETEPE.
Q02DA1_SOLUE/510-786--L.........DP-------------------------S----R...TLVIEPDG......PVGTIPIQA..LMDPAF.
Q10YT7_TRIEI/1003-1309--L.........GS-------------------------Q----K...QILISPDS......NLNLIPFEA..LVDENN.
Q10YU6_TRIEI/544-838--IDL...KDDASQ-------------------------I----K...TLVFVLEG......NLRNIPMSV..LYDSKR.
Q112V9_TRIEI/62-390--AYYQDILKQQDA-------------------------.----....NLGIILEINEEAMPEVVAYPWELMCLPEKYNQ
Q113D1_TRIEI/130-430--L.........QE-------------------------R----QHNFSYLIINDR......TTFEIPWEMLELKNN...
Q113U8_TRIEI/3002-3297--L.......EAAN-------------------------I----D...TLLFSMSE......SLRALPVAA..LHDGE..
Q115J8_TRIEI/1466-1777--............-------------------------C----Q...RLTLIPHS......FLHFLPLHILPINNPENS
Q117G6_TRIEI/881-1206--I.........GS-------------------------K----E...QILISPDS......HLNLIPFEA..LVDENN.
Q119J2_TRIEI/1474-1770--L.......VAYN-------------------------I----N...MIVFSMDS......GLRTIPIAA..LHDGQ..
Q16H64_AEDAE/1315-1614--FEDLLPDISTTS-------------------------R----IGRRELILVLEK......ELYLVPFAI..LRSGDES
Q2G6U6_NOVAD/692-1020--L.........PQ-------------------------T----R...HLVFEPDG......AMLQLPPTV..LVSGDKG
Q2S6G2_SALRD/540-844--L.........PD-------------------------G----Q...PLTVIPDG......PMFHVPFSMLATAAPGGR
Q2W535_MAGSA/875-1218--L.........GG-------------------------R----T...KVYIIPDG......MLNIAPISA..MVEPNR.
Q38C46_TRYB2/1044-1397--IAAYIRSSDPRL-------------------------L----AKNGVVTIIPTD......GLWLVPFNA..LMSRNG.
Q3AQG5_CHLCH/44-362--........KQRA-------------------------G----QHIVPLLLSSND.....AAIQQLPWET..IYHPDY.
Q4C5K3_CROWT/405-717--........TPKH-------------------------C----D...ELILIPHQ......YLHIFPIHA..VYNPEN.
Q4S217_TETNG/1205-1537--MEVGLMHSTGPV-------------------------G----RH.RQLVLVLEG......ELYLIPFAL..LKGSSS.
Q55594_SYNY3/165-457--L.......KANA-------------------------I----D...TLIFCVGP......KLRSLPFAA..LYDGE..
Q5LLA3_SILPO/680-970--V.........AR-------------------------S----REHDKLFVIFTSM...IHWVFDMPWEF..ARDPER.
Q64CV3_9ARCH/59-374--AL.....KEAEG-------------------------Y----SETLQLIVKAEG......PASNLPFEL..LYHN...
Q7NCT1_GLOVI/600-923--..........LQ-------------------------A----K...HLLIAPDG......QLNTLPFAA..LVGQDG.
Q7NF67_GLOVI/550-854--L.........GG-------------------------R----R...RLLVSPDG......ALNLIPFAA..LVDEHG.
Q7NFD7_GLOVI/666-979--L.........GG-------------------------V----K...HLLLSPDG......QLHTLPFGV..LVDEQG.
Q7NIF7_GLOVI/691-997--L.........GD-------------------------V----H...TLWIAPDA......QLNLLPFGA..LVDEQG.
Q7NJE3_GLOVI/660-988--..........PG-------------------------V----K...HLFLAPDG......QLNTMPFAA..LVAQDG.
Q7NLR0_GLOVI/653-961--L.........GN-------------------------T----R...QILISPDG......LLNLLPIAA..LVDERN.
Q7NVB0_CHRVO/67-386--MAGHEVGDDGNS-------------------------Y----T...QLRLVLSA.....AELALLPFEL..MLSPPGQ
Q82I85_STRAW/1175-1481--LFAEFPEPRAGR-------------------------V----P...RLVLVPMG......ALGLVPWHAAWEQGDDGR
Q82L10_STRAW/969-1256--LGFTGPPESGAP-------------------------W----P...RLWWSPSG......VLNSFPLHAAGRHGSGEA
Q8DGG5_THEEB/541-835--L.........GN-------------------------A----T...HLLIAPDG......ELNTIPFQA..LVDAQG.
Q8DH74_THEEB/570-891--L.........EG-------------------------S----T...HLLVAPDG......QLNTLSFEA..LVDRQD.
Q8DHI1_THEEB/67-394--........VRHT-------------------------Y----E...NLVISLGT......WLNRTRINF..LSEAQLN
Q8DIE5_THEEB/1127-1420--L.......DAQG-------------------------I----E...TLVFVLDS......GMRGIPVAA..LHDGK..
Q8YZU5_NOSS1/56-340--L.......TEQR-------------------------I----K...TLVFIQDG......FLRDVPMAA..LYDKKE.
TTC28_HUMAN/1390-1713--MEGGLMHSSGPV-------------------------G----RH.RQLILVLEG......ELYLIPFAL..LKGSSS.

PF03568

Q75EJ0_ASHGO/1148-1552------------TG-------------------------K----HFHLRLPLNRHE------SRDLSQETLT........
ESPL1_HUMAN/1716-2069------------SP-------------------------P----VS.VQIPTGQNK------LHLRS.............
BIMB_EMENI/1605-2004------------CS-------------------------P----FL.LRLPLRRGN------SEDEEEQFTF........
Q6V3V9_DROVI/167-544------------LA-------------------------A----TC.LRLNSDAMA------SLFKAYGT..........
Q6ZHH8_ORYSJ/451-870------------NK-------------------------P----IT.MLLPVDAIS------KETQHEDSCTKELDNLMR
Q6FTE1_CANGA/1147-1548------------DS-------------------------K----NIMAKIPIDRNV------SRDLDADSLT........
Q8SRL6_ENCCU/365-731------------AQ-------------------------H----FLNCKLVVERIG------GVHGPSPN..........
Q7RB01_PLAYO/620-1007------------..-------------------------.----............------..................
ESPL1_MOUSE/1712-2065------------NP-------------------------P----IT.VKIPTAQNK------LPLSA.............
Q6NR96_XENLA/1471-1824------------SP-------------------------P----VT.VQIPTAHLK------VSISS.............
ESP1_YEAST/1171-1571------------RK-------------------------R----RTHLRLPLIRSN------SRDLDEVHLS........
Q6CQQ7_KLULA/1114-1517------------RN-------------------------K----HLHLRLPLNRHN------SRDLSEEVLG........
Q23491_CAEEL/745-1104------------RD-------------------------P----II...MPLAHYH------QAIE..............
Q6CCJ0_YARLI/1206-1588------------QE-------------------------P----FL.LRLPLHRHN------SRDVDEHPFL........
O82745_ARATH/1299-1653------------SQ-------------------------P----VA.TLLPVDSIV------EDMSDDSANLSSTEATQV
CUT1_SCHPO/1379-1770------------HS-------------------------P----LI.FRLPLQRHN------SRDADEEILV........
Q9VRN6_DROME/169-538------------LG-------------------------P----IC.LKISNENTA------NLFREYST..........
Q6V3V6_DROWI/170-538------------LE-------------------------P----TC.LKVTNERLV------EVFQEYST..........

PF01364

KGP83_PORGN/244-595..........TNAS.........................I----KAFIHKKYNDGLAASA...APVF....LALVGDT..
D1JG83_9ARCH/891-1295..PMEA....EETL.........................K----ESVLDYKIK...........PDY....LIVVGGTGS
A2U064_9FLAO/401-768..SGSK....DITG.........................I----RDFIKHLYTTN.SSPS..TQLKY....VCFFGDSSY
Q7MTE2_PORGI/239-573..........TANA.........................I----QQFVKQEYEKEGNDLT...Y.......VLLIGDH..
D3HWT0_9BACT/400-777..GGTP....DAAA.........................Y----RRYLKMMYDRA.STAS..TMPKY....LLLFGDGVW
Q5S3Q9_9FLAO/543-910..TSKQ....DIGA.........................I----RNLVRYIYENA.P.EG..KKINY....LCLFGDASF
A9DMD5_9FLAO/555-923..TGNP....DIGA.........................I----RNFIKYVYDNA.STVD..NRVKY....VCMFGDASY
B0VGA8_CLOAI/228-563..........STQA.........................I----KNYIQTQYDNPSTRPD...F.......IILLGDT..
B7B5I7_9PORP/382-753..SGTP....DATA.........................Y----RRFMKMFYDRQ.TSEA..DAPKY....LLLFGDGSF
B8FFM0_DESAA/254-600..PATG....DDVS.........................I----KDFLTYAYNNW....A..LRPKW....VILGGDV..
A3U7G6_CROAH/540-908..SGQQ....DISA.........................I----RNFVKYVYDNA.SSPA..SRLKY....VCLFGEGSV
D2QSX9_SPILD/414-786..SGQP....DPTA.........................I----RDMVRYFYQQQ.P..T...KLRY....VLLFGDATF
A3HW99_9BACT/398-769..YGEE....GPTA.........................L----FEFLRTYYPAH.Q.......PTH....LLLAGRSLT
B0VHP2_CLOAI/234-563..........TAAN.........................I----KTYIQNQYNLNDGLM....F.......VQLVGDA..
A8ZUB1_DESOH/278-656.YTGRN....DAET.........................L----RNFIIYAYENLNTEY............VLLGGDT..
B0VIM2_CLOAI/182-528..........TVQD.........................I----KNFIANHYQTYKCDY............LFLWGDV..
Q2Z0E1_9BACT/643-1013..WGLV....DPSA.........................I----RDYLKYLSDNSVVPPT...H.......ALLVGDSSL
B3QXR8_CHLT3/734-1131..YGIK....SPHA.........................I----RDFLDYAYHEWAVAPT...Y.......VLLLGDA..
C2MCN4_9PORP/405-781..GGTP....DATA.........................Y----RLMLWDYKRRY.EAEH..GAESYH.PLLLLMGDGAY
A4A325_9PLAN/24-399..........SKER.........................I----RAAIRETAKSGS........LRW....VVLVGDV..
A7NR84_ROSCS/499-867..DGQV....DPDA.........................I----RAFLQFARPQA................VTLVGDGSS
Q11Q36_CYTH3/558-932..SGKK....DLTA.........................I----RDFVKMVYDRG.S.AG..SQLKY....LLLFGKPTY
Q7MX16_PORGI/272-637NATSYI....NETK.........................L----KNFIRSVYNQSNAKRTLDGKLGY....VLLIGKPLS
A0B5K7_METTP/796-1154..PGEV....EEWL.........................R----ESVGEKKLR...........PEY....LLVVGDPGS
D0MH89_RHOM4/586-975..GGVP....DMRA.........................V----RDYLKFLYDRA.PDES..SLLRY....ALLFGDGHY
A8UH97_9FLAO/539-910..TGSQ....DIAA.........................L----RNFVKYVYDNA.SIPS..KRLKY....LCLFGDGSY
B8KYL6_9GAMM/364-704..NGIH....APDA.........................L----RRFVQYARSHWQKPAP..AM.......LLLVGDAS.
B8FIK5_DESAA/1139-1542...GLD....SQEK.........................I----RNCIRDYVENQGTTF............VALGGDD..
Q11US7_CYTH3/392-767..YGEY....SSIA.........................I----KRYCSEIIQVN.S......KEKY....LLILGKGVV
C6W101_DYAFD/326-680..AGQP....GPQG.........................I----RNAIRWLCDHG.N.......LQF....VLLAGRSID
A5FJM8_FLAJ1/544-914..SGKQ....DIAA.........................I----RNCIRYIYNNA.SSSD..KRVKY....LNLFGDASF
Q7UG73_RHOBA/51-444..........PADN.........................A----SDTHQQIWNVGGADTR...Y.......IVLVGDT..
A3J247_9FLAO/540-919..SGKQ....DVAA.........................I----RNFIKYVYWNA.SASD..KRVKY....VNLFGDASY
A9WIM0_CHLAA/500-869..GGEP....DPRA.........................I----RDFLRYAAATWSPAPE...A.......VILVGDGSS
B0VHE7_CLOAI/227-554..........TNTN.........................I----KSYIQTAYNNPATRPD...Y.......IVLIGDT..
C6VT06_DYAFD/394-758..YGEP....SPVG.........................I----KRFMSYMLSD..SK......DKY....LFLIGKSI.
C6X3N8_FLAB3/546-921..SGSK....DITA.........................I----RDFTTRL.....NTTS..GKLQY....LFILGDTSY
A0LQH1_SYNFM/790-1132..WGIV....TPYA.........................I----RDFLAQASSWNPAPK....F.......VVFAGEGSF
A1ZVJ9_9BACT/406-774..SGKQ....DVTA.........................L----RDFARMLYLRD.S..Q...VFKY....LLLFGDASF
B0VHF1_CLOAI/214-595..QGID....TQDK.........................L----RNYIISLYTTN........PLRY....VFLAGDTDV
B0VIE7_CLOAI/193-598..TGTD....NAEK.........................L----RNYLQNTYAST........PFSY....LLLVGDY..
C6W3P4_DYAFD/414-806..YGEP....SPIA.........................I----RRFVDFMISDLKKDNLG.RLDKY....LLLLGISV.
B2RGP6_PORG3/408-787..GGTP....DATA.........................Y----RLFAKMFYDRW.KANA..PVGETFPMQMLLFGDGAH
D2QJ99_SPILD/409-770..YGER....SPLA.........................I----QQFMNQMRQQN.P..E...HLRY....LLLIGRARS
A9B5Q8_HERA2/466-850..SGNV....DPLA.........................I----RDFMRYLASTWPQAPQ...S.......LVLVGDGTI
D2QFF3_SPILD/397-745..YGEK....SPLA.........................L----RRFADYLVANT.A.......VKH....LLLVGRANS
B0VH03_CLOAI/589-939..GGHI....DPAA.........................I----RLALKYYYFNL...PA..PRITS....LTLLGIGTM
D2R2P5_PIRSD/21-411..........SAAE.........................I----RTAVRRVAATSLEQGG...KLRY....VLLVGDAE.
C6W0Z3_DYAFD/393-758..SGSS....DITA.........................I----RDFARNLYQKT.P..G...KLKY....LLLFGDATY
A3XQP5_LEEBM/552-929..SGKQ....DIGA.........................I----RNLVRYVYENA.SSAE..NRLKY....LCLFGDTSF
C9RIY0_FIBSS/581-957..GGAL....SPIA.........................I----RNYIAYA.....RSVC..PDLRF....VLLAGGGNY
Q2PY26_9BACT/412-780..GGVQ....DLTA.........................I----KDMMRMLWSNA.SSPS..DKPEY....LLLFGDCSY
Q26FX7_FLABB/537-909..EGEQ....DIAA.........................I----RNFVKYVYDNA.SSPA..NRVRY....LNMFGDASF
B0VJT2_CLOAI/236-566..........TTTS.........................I----KNYIQTKYNNPETRPD...F.......VVLIGDT..
C6BTD6_DESAD/56-402..SEAK....VVAG.........................I----QSQVAKLNKDGKLMS............VLILGNR..
D2QE53_SPILD/328-1007CGNGLKA..RDLAE........................LI----RNFVKYAYKSW........KTRY....LLIGGDTDI
A2BK55_HYPBU/159-551GETAPEYNESLAAK.........................I----ISFLREAVDAGVNY.............VLIIGGA..
B0VHP1_CLOAI/283-636..........TTTS.........................I----KAYMQNLWNSATSENPAPSY.......LLIVGDV..
Q1Q1Y4_9BACT/620-970..DGIF....SPQA.........................I----RDFLSYTYNNWQEPAP..AY.......VVLIGDAYQ
C7PNY3_CHIPD/396-764..SGTP....DPTA.........................I----RDFVKMCHDRG.G.......LQY....LLLFGDASY
Q6LFY5_PHOPR/224-617..........TQAQ.........................I----KAYIKDAYSNGTM.......TSY....VLLVGDH..
B3QVL4_CHLT3/688-1063..GGKQ....DFTA.........................I----RDFLKFLYDNA.SSLD..DAPKY....VLLFGDGDW
A9B187_HERA2/552-907..DGRV....DQQA.........................I----ADFIKYAYHNWQAPAP..SF.......VVLVGDGTA
B3C566_9BACE/537-910..SGTP....DGTA.........................Y----RRLMKMLYDRF.PNKA..ESPKY....LLFFGDCSY
B0VJY1_CLOAI/655-1014..AGIT....GAEP.........................I----RDFLRYAYNNW...SS..PQLSS....VILLGEGVD
B8G4Y1_CHLAD/584-1054IA........LVKN.........................I----RNFEIGRYQTYGSRFR...Y.......LMLIGTN..
A1ZEG7_9BACT/410-775..YGEY....SPLA.........................I----KKFARYMYDKG.N.......PKF....LFLIGKGLS
B0VF22_CLOAI/223-583..PGVD....NAEK.........................L----RNFIINAYQTWANSSQ...PLEY....VILGGDDEI
A0LKV0_SYNFM/924-1265..AGVP....EPNA.........................L----RRFLRCARVHSGGALR...Y.......VLLVGDDTF
A8ZTD5_DESOH/257-648..........TAAE.........................I----QAFIQDAYDTWSIPPS...Y.......VLLVGDV..
A9B8S0_HERA2/477-840..FGHV....SPMA.........................I----RTFLQHAAATWPSPPT...S.......VLLVGDGTT
C3JBB2_9PORP/421-799..AGTP....DATA.........................Y----RLMAKYFYDRW.MAAH..PGEKQSAQQLLLFGDGAA
C9SW40_VERA1/279-917FRAGSR....DLQE........................VI----RRFLKDVRTRW........GVNW....LLLGGDTSI
C9LI59_9BACT/509-899..SGTP....DVAA.........................Y----RRYMKMLYDRA.QSNA..DMPRY....LLLFGDCFW
B5ICF9_ACIB4/214-642PVNGYA....NATTDPYGLLGGQALPLEKNMIIGYNYTLA----KKIIAFLQNESYGSN.....VEY....ITIFGNAR.
Y048_ARCFU/22-377LVSGYS....TEQVYDSYN..............YTLALKI----ISFLRTVNASY................VTILGDA..
A3I371_9BACT/360-725..YGNK....DITG.........................I----RNFIAKIYQES....K...SLKN....VLILGKGTF

PF11713

A0AED2_YEREN/2138-2301---------------------------------------T----RYSGQVIVQL.............-------------
A0KHZ7_AERHH/3609-3767---------------------------------------T----RFTSQVIIQT.............-------------
A1EPL5_VIBCL/3469-3627---------------------------------------T----RFDGQIIVQM.............-------------
A2PYQ6_CLOPF/575-753---------------------------------------D----KEYLRYIIQL.............-------------
A3UPN6_VIBSP/3781-3944---------------------------------------T----RFDGQIIIQM.............-------------
A4TI66_YERPP/771-929---------------------------------------K----NHHPQFIVLL.............-------------
A4TI66_YERPP/1083-1262---------------------------------------S----QYDMQIVFQC.............-------------
A5KV80_9GAMM/1072-1230---------------------------------------S----QYDSQIIIQL.............-------------
A5L6I6_9GAMM/693-849---------------------------------------T----NSYKQIIIEL.............-------------
A5L6I6_9GAMM/1529-1710---------------------------------------L----KYQANIVFVMGPTLEELEKKYGI-------------
A5L6I6_9GAMM/1908-2074---------------------------------------P----LEAPRVIVML.............-------------
TOXA_CLODI/576-757---------------------------------------S----KNYVHYIIQL.............-------------
TOXB_CLODI/574-755---------------------------------------E----RGYIHYIVQL.............-------------
Q2KX68_BORA1/2483-2627---------------------------------------D----PYRKRTVVVV.............-------------
Q2SAY5_HAHCH/1-160---------------------------------------M----NYDKQLIIVL.............-------------
Q46149_CLONO/581-762---------------------------------------E----NYDLNMILQI.............-------------
Q46342_CLOSO/574-755---------------------------------------N----KEYIHYIVQL.............-------------
Q7N1Z0_PHOLL/2456-2614---------------------------------------T----RFDGQIILQM.............-------------
Q7N726_PHOLL/2997-3151---------------------------------------T----RFDGQIIIQM.............-------------
Q7VV06_BORPE/2551-2702---------------------------------------D----PYANRVIVQL.............-------------
Q7VV06_BORPE/2959-3112---------------------------------------D----PYALRSIVQL.............-------------
Q7VV06_BORPE/3397-3549---------------------------------------D----RYGHRTIVQL.............-------------
Q7VV06_BORPE/3808-3959---------------------------------------D----RYAHRVIVQL.............-------------

PF13900

B4E0H0_HUMAN/45-92--------------------------------------------------------------------------------
Q7Z4P3_HUMAN/54-101--------------------------------------------------------------------------------
Q6ZTF6_HUMAN/58-105--------------------------------------------------------------------------------
B9NCR3_POPTR/128-175--------------------------------------------------------------------------------
CN165_HUMAN/57-104--------------------------------------------------------------------------------
Q9P195_HUMAN/6-53--------------------------------------------------------------------------------
B3KRW9_HUMAN/44-91--------------------------------------------------------------------------------
Q6ZS53_HUMAN/79-126--------------------------------------------------------------------------------
Q6ZNG3_HUMAN/65-112--------------------------------------------------------------------------------
B7Z559_HUMAN/16-63--------------------------------------------------------------------------------
Q9BGW3_MACFA/24-71--------------------------------------------------------------------------------
Q6ZNU7_HUMAN/32-79--------------------------------------------------------------------------------
B9NCR2_POPTR/11-60--------------------------------------------------------------------------------
Q6ZNZ6_HUMAN/6-53--------------------------------------------------------------------------------
Q8N287_HUMAN/31-78--------------------------------------------------------------------------------
Q95KE1_MACFA/88-135--------------------------------------------------------------------------------
Q9UI48_HUMAN/14-61--------------------------------------------------------------------------------
Q9H5D5_HUMAN/64-111--------------------------------------------------------------------------------
Q9NR08_HUMAN/145-192--------------------------------------------------------------------------------
Q6ZSG7_HUMAN/16-63--------------------------------------------------------------------------------
B9NF68_POPTR/42-89--------------------------------------------------------------------------------
Q9P147_HUMAN/36-83--------------------------------------------------------------------------------
Q6ZQR8_HUMAN/34-81--------------------------------------------------------------------------------
C9JL81_HUMAN/280-327--------------------------------------------------------------------------------
Q96ID7_HUMAN/6-53--------------------------------------------------------------------------------
Q5T5H1_HUMAN/139-186--------------------------------------------------------------------------------
B7Z2Z5_HUMAN/303-350--------------------------------------------------------------------------------
C9JQS0_HUMAN/70-117--------------------------------------------------------------------------------
Q4R5J6_MACFA/21-68--------------------------------------------------------------------------------
Q9NX85_HUMAN/34-81--------------------------------------------------------------------------------
B4XZE4_HUMAN/24-71--------------------------------------------------------------------------------
Q6STG2_HUMAN/10-57--------------------------------------------------------------------------------
Q96LS9_HUMAN/23-70--------------------------------------------------------------------------------
Q6ZTX9_HUMAN/54-102--------------------------------------------------------------------------------
Q9P191_HUMAN/17-60--------------------------------------------------------------------------------

PF00656

Q7Q803_ANOGA/54-306---------------------------------------F----N--HRKFLHA..........SERKGTD---------
Q7QGM9_ANOGA/35-227---------------------------------------F----H--HDQFKNP.........KNNREGSA---------
Q7PV92_ANOGA/14-237---------------------------------------I----N--QVIFSSM..........AVRVGSS---------
Q70VV0_PICAB/3-415---------------------------------------V----G--CNYPGTK..........AELKGCV---------
CASP4_MOUSE/132-369---------------------------------------I----C--NTEFKHL..........SLRYGAN---------
CASP5_HUMAN/193-430---------------------------------------I----C--NTKFDHL..........PARNGAH---------
MCA1_KLULA/138-430---------------------------------------I----G--INYFGSA..........NELRGCI---------
MCA9_ARATH/10-321---------------------------------------V----G--CNYPNTR..........NELHGCI---------
MCA1_ARATH/80-362---------------------------------------C----G--ISYRFSR..........HELKGCI---------
MCA1_DEBHA/146-437---------------------------------------V----G--INYTGSK..........NQLRGCI---------
MCA7_ARATH/3-401---------------------------------------I----G--INYPGTT..........EELQGCV---------
Q7Q1E0_ANOGA/62-291---------------------------------------F----S--HNKYNVRNV......SLPVREGSA---------
Q89XE4_BRAJA/58-278---------------------------------------I----G--NGHYPDA.........NAPLTQSI---------
Q6N5Q1_RHOPA/33-253---------------------------------------I----G--NGAYAK...........APLSTAA---------
Q9ZSP8_HEVBR/3-415---------------------------------------I----G--INYPGTK..........AELKGCI---------
Q89FZ4_BRAJA/32-256---------------------------------------I----G--QSAYRTV..........PELPNAA---------
Q6QN97_PIG/259-484---------------------------------------I----D--CVG.....................---------
Q7Q4X6_ANOGA/73-309---------------------------------------F----N--HENFDVPQ........LRSRAGTN---------
Q6E5N8_ICTPU/119-362---------------------------------------I----N--NVNFASP.........LKERYGSK---------
Q6AKF4_DESPS/28-248---------------------------------------I----G--NSDYRI...........RSLKNPV---------
O42284_CHICK/42-279---------------------------------------I----C--NTKFKHL..........RQRDGAE---------
Q7QKT2_ANOGA/35-260---------------------------------------I----N--NNRD...............RKGSE---------
Q6N0T4_RHOPA/30-251---------------------------------------I----G--NSKYPDA.........DKPLSQAV---------
Q9NHF9_DROME/56-302---------------------------------------L----N--HKDVKGQ..........KQRVGTE---------
Q89HT8_BRAJA/51-272---------------------------------------I----G--NSNYQNA..........PQLQNPD---------
Q87Z21_PSESM/2-225---------------------------------------I----G--IDNYPT...........APLMGCV---------
CASP1_PIG/163-400---------------------------------------I----C--NTEFENL..........PRRDGAD---------
CASP3_XENLA/56-280---------------------------------------I----N--NKNFHSSN........MAVRNGTD---------
Q9I8J3_DANRE/238-473---------------------------------------I----N--NYNFLEST.......NLLKRTGTD---------
Q9GV88_HYDVU/84-316---------------------------------------I----N--VKNFMKSSN.....KHEYPRLGTD---------
MCA4_ARATH/3-416---------------------------------------I----G--INYPGTK..........AELRGCV---------
CASP2_RAT/200-445---------------------------------------M----S--NVHFTGEK.......DLEFRSGGD---------
Q9IB64_XENLA/261-494---------------------------------------I----N--NYDFKEARSQ...DCKYTDREGTA---------
MCA2_ARATH/116-414---------------------------------------V----G--VSYKNTK..........DELKGCI---------
Q9Y1U6_PRIPA/173-413---------------------------------------I----S--NEHFRTM..........PQRRGTK---------
CASPD_BOVIN/136-373---------------------------------------I----C--NTEFDHM..........PPRNGAA---------
CASPE_MOUSE/22-256---------------------------------------L----C--VTKA...............REGSE---------
MCA1_ASHGO/154-449---------------------------------------I----G--INYFNSS..........AELRGCI---------
PCP_DICDI/188-405---------------------------------------I----G--NSKYSQH..........RKLDGVI---------
Q8ITP2_BRAFL/151-396---------------------------------------F----D--NEEFHWTT.......KMNRRRGSH---------
Q7WDK3_BORBR/552-800---------------------------------------V----G--INEFGEA.........SLNLQYAV---------
Q98UI8_DANRE/48-280---------------------------------------I----N--NKNFDRRT.......GMNPRNGTD---------
ICE_DROME/94-328---------------------------------------F----N--HEHFEVPT........LKSRAGTN---------
Q7PZJ9_ANOGA/20-250---------------------------------------I----N--DSEN...............RDGWE---------
Q9NBW3_DROME/38-248---------------------------------------L----N--HEQFPQDS........QLNRKGSS---------
MCA5_ARATH/3-408---------------------------------------I----G--INYPGTK..........AELRGCV---------
O88550_RAT/68-301---------------------------------------I----N--NKNFDKAT.......GMDVRNGTD---------
Q9DDJ2_DANRE/174-400---------------------------------------I----T--NIQFANT.........QHNRDGAD---------
Q985X8_RHILO/35-256---------------------------------------I----G--NAAYPS...........GSLATPA---------
CASP1_SPOFR/61-293---------------------------------------F----N--HEHFDIHS........LKSRTGTN---------
CASP1_FELCA/161-406---------------------------------------I----C--NTTFDHL..........SLRKGAD---------
Q9IB66_XENLA/58-298---------------------------------------F----N--HEDFYWQL.......RLGSRRGTN---------
CFLAR_HUMAN/252-477---------------------------------------I----D--CIG.....................---------
CASP1_MOUSE/162-398---------------------------------------I----C--NTEFQHL..........SPRVGAQ---------
CASP2_CHICK/171-416---------------------------------------L----S--NIHFSSEK.......DLEYRSGGD---------
CASP1_DROME/79-313---------------------------------------F----N--HEFFDIPS........LKSRTGTN---------
Q9DDL2_DANRE/323-560---------------------------------------I----G--NMNYLHH..........RQLRAPM---------
MCA1_SCHPO/130-422---------------------------------------I----G--INYLNTQ..........NELQGCI---------
Q8JIS8_ORYLA/58-285---------------------------------------I----N--NKNFHKDS.......GMGPRNGTD---------
Q89IK1_BRAJA/30-253---------------------------------------I----G--NGAYAST..........AQLPNPP---------
O93415_CHICK/57-299---------------------------------------F----N--HEHFFWHL.......RLPDRRGTL---------
Q89MV1_BRAJA/176-400---------------------------------------V----G--NSAYKNI..........TPLDNPS---------
Q8IEW1_9TRYP/63-322---------------------------------------I----G--INYTGSS..........AQLGGCV---------
Q98IJ9_RHILO/30-261---------------------------------------I----G--NSKYVNA..........VALPNPA---------
Q9TZP5_CAEEL/26-261---------------------------------------I----N--NVVFCGM..........EKRIGSD---------
Q7RFI8_PLAYO/964-1364---------------------------------------I----G--CNYMGEKD.......SINQLHGSA---------
MCA1_YARLI/168-458---------------------------------------I----G--CNYIGSK..........NALRGCI---------
MCA1_CANGA/98-389---------------------------------------I----G--INYIGSK..........NALRGCI---------
Q8I6Y2_GEOCY/158-414---------------------------------------I----N--NRNFTCG.........MKERVGTD---------
Q98IJ6_RHILO/11-238---------------------------------------L----G--NSQYQHA..........APLANPA---------
CASP1_HUMAN/163-400---------------------------------------I----C--NEEFDSI..........PRRTGAE---------
Q9I9L7_DANRE/145-379---------------------------------------I----N--NVDFDDK.........AMKRSGSE---------
Q8YS65_NOSS1/4-245---------------------------------------I----G--VNQYDYL..........EPLNYAK---------
Q8ITP3_BRAFL/87-323---------------------------------------I----N--NKDFEKHT.......GMNTRRGTD---------
Q98G71_RHILO/26-252---------------------------------------I----G--NGTYAEA..........GTLANPV---------
Q74F93_GEOSL/6-270---------------------------------------L----N--AVDPKHYGG......WAGKLNACE---------
CFLAR_MOUSE/257-481---------------------------------------I----D--CIG.....................---------
MCA6_ARATH/3-366---------------------------------------I----G--INYVGTK..........AELRGCV---------
Q8T8E8_9TRYP/84-341---------------------------------------I----G--IDYKGTP..........AELRGCQ---------
CAS1A_XENLA/144-382---------------------------------------I----C--NEKFENL..........NERHGAK---------
CED3_CAEEL/243-494---------------------------------------I----N--NEHFEQM..........PTRNGTK---------
Q53839_STRCH/9-268---------------------------------------V----G--VADYDHL..........PPLPGIR---------
Q6DCI2_XENLA/78-314---------------------------------------I----N--NKIFDKIT.......GMGARNGTD---------
B5VS82_YEAS6/157-450---------------------------------------I----G--INYIGSK..........NQLRGCI---------
Q6N329_RHOPA/73-298---------------------------------------I----G--QSAYRAV..........PALPNPV---------
Q6NTR7_XENLA/280-494---------------------------------------I----D--CVG.....................---------
Q7NPG1_GLOVI/7-278---------------------------------------V----A--INDYPGT.........TNDLPSCL---------
CASP8_HUMAN/234-476---------------------------------------I----N--NHNFAKAREKVPKLHSIRDRNGTH---------
Q98CE0_RHILO/5-238---------------------------------------M----A--DNDYRLV..........RPLANPI---------
Q82I86_STRAW/5-276---------------------------------------V----G--IDDYPSQT........ATPLRGAV---------
CASP1_CANFA/163-400---------------------------------------I----C--NIEFDHL..........STRDGAE---------
Q9I8S9_ONCMY/57-297---------------------------------------F----N--QEHFFWHL.......RMPPRNGTN---------
CASP9_HUMAN/161-413---------------------------------------I----N--NVNFCRES.......GLRTRTGSN---------
CASP6_MOUSE/28-270---------------------------------------F----N--HERFFWHL.......TLPERRGTN---------
Q8T8E6_9TRYP/84-343---------------------------------------I----G--INYYGTS..........AALSGCC---------
Q6NBN5_RHOPA/57-277---------------------------------------I----G--NAHYPDA.........ASPLLQPI---------
Q9IB63_XENLA/144-396---------------------------------------I----N--NMNFHECT.......GLSTRTGSD---------
Q89XG2_BRAJA/27-248---------------------------------------I----G--NAKYPDA.........DAPLKEPL---------
Q90WU1_CHICK/237-479---------------------------------------L----N--NHNFAKAREAVPELRRMKDRNGTH---------
Q9GV89_HYDVU/93-318---------------------------------------I----N--NEKFVEE..........ENRDGSE---------
Q6PAD9_XENLA/268-495---------------------------------------I----D--NSIFAKG..........KRREGSD---------
ICENC_DROME/196-443---------------------------------------V----N--IMDYPDQ.........NRRRIGAE---------
Q98JS7_RHILO/35-253---------------------------------------V----G--NSEYPF...........APLTNPR---------
CASP8_MOUSE/236-478---------------------------------------I----N--NHDFSKAREDITQLRKMKDRKGTD---------
Q89KP2_BRAJA/86-307---------------------------------------V----G--NGAYAK...........SPLATTA---------
Q86FL0_ANOST/52-286---------------------------------------I----N--QVNFSGM..........AKREGSD---------
P74453_SYNY3/40-299---------------------------------------L----A--AGQGNGANG......DRRGLMGCT---------
CASPC_MOUSE/176-415---------------------------------------I----C--NKKFDYL..........FDRDNAD---------
MCA8_ARATH/3-378---------------------------------------I----G--INYPGTA..........VELRGCV---------
Q8JG42_TAKRU/51-279---------------------------------------I----N--NKNFDRRT.......GMNTRNGTD---------
Q90WU0_CHICK/148-400---------------------------------------F----N--NVSFSRDS.......DLSTRAGSD---------
Q89HP3_BRAJA/336-569---------------------------------------I----G--NGAYAHV..........KALPNPP---------
Q8I749_SUBDO/254-491---------------------------------------I----N--NHQFYHSDPE....KCHSNRGGAH---------
O93417_CHICK/53-281---------------------------------------I----N--NKNFHRDT.......GLSSRSGTD---------
CASPE_HUMAN/18-241---------------------------------------L----C--VTKA...............REGSE---------

PF14538

A2DJF0_TRIVA/81-229---------------------------------------L----N--TLTRLIPGK.......PQNRKFIH....TW...
A2DYB3_TRIVA/11-163---------------------------------------L----C--LFDGLRNPS....IRRLVRKPRTV....IQRPL
A2DYM2_TRIVA/66-217---------------------------------------L----C--SSSIYFPPPD...SEYFTDKPTIY....MW...
A2E336_TRIVA/52-203---------------------------------------L----P--FLEQTQENQ........TEYCKLYPFYVYWI..
A2EZ34_TRIVA/86-237---------------------------------------M----C--SQSNLFPQPD...SDYFSRKPMLY....MW...
A2F8U1_TRIVA/62-211---------------------------------------M----C--IPNLLQPPH.......LRGTNSVY....CWSKT
A2F9H3_TRIVA/30-182---------------------------------------L----C--LFDGLRIPS....IRRLVRKPRNI....CDRPL
A2FJN8_TRIVA/40-192---------------------------------------L----C--LFDGLRTPT....IRRLSRKPRLI....CNRPL
A2G2E2_TRIVA/83-230---------------------------------------C----I--FGIYADKTNS...QTANPLIPQII....MW...
A2G590_TRIVA/29-181---------------------------------------L----C--LFDGLHTPT....IRRLSRKPRLI....CNKPL
A2GCD5_TRIVA/96-248---------------------------------------N----V--AHLEQFPKPS...SDFAKQIPSIF....AW...
A8Q911_MALGO/109-262---------------------------------------M----C--LNIGVDPPD....VSKTNPCSKLI....CW...
A9TBL2_PHYPA/90-243---------------------------------------M----C--LNIGVDPPD....VIKISPCARLE....CW...
A9V5A2_MONBE/627-778---------------------------------------L----C--LNIGVTPPD....VVRTHPCAKLE....AW...
B0CNS4_LACBS/33-186---------------------------------------L----C--LNIDVDPPD....IIKTNPCANLE....CW...
B0ENS2_ENTDS/37-190---------------------------------------L----C--LNIGTDSPD....QIKQKDSASKE....CW...
B0WBU4_CULQU/24-183---------------------------------------A----H--LNTAIQTVD....VAGWELTERTN....AWINL
B0WR30_CULQU/146-268---------------------------------------.----.--...................AGGHV....CW...
B3RPQ9_TRIAD/42-195---------------------------------------L----C--LNVGVDPPD....LIKPTPCARLE....CW...
B4R5C8_DROSI/213-366---------------------------------------L----C--LNIGVDPPD....VVKIQPCSRLE....CW...
B6JY50_SCHJY/122-275---------------------------------------V----C--LNIGVDPPD....IIKPNPAAKYE....CW...
B7PLB3_IXOSC/91-248---------------------------------------M----C--LNIGVDPPD....VVKTQPCARLQ....CW...
B8CBK6_THAPS/255-410---------------------------------------L----A--LNVGTDPPD....LNKPNPCAKLQ....CW...
B8P5W0_POSPM/106-259---------------------------------------L----C--LNIDVDPPD....VVKTNPCAVLE....CW...
C4LXC3_ENTHI/41-195---------------------------------------C----C--LNIGTEPPG....YKKPKVSSNTF....GW...
C5KFU4_PERM5/815-945---------------------------------------Y----Y--RLFRFEPGS...................VW...
D0N306_PHYIT/11-164---------------------------------------L----C--LNIGTDPPD....VEKSSPCARKE....CW...
D2VMD1_NAEGR/143-295---------------------------------------V----C--LNIGVDPPD....VVKVQPCAKLE....CW...
D8LUT8_BLAHO/28-155---------------------------------------Q----L--YKSLVYSPG........................
D8RG53_SELML/71-224---------------------------------------V----C--LNIGVDPPD....IIKVSPCARME....CW...
D8T9J0_SELML/49-198---------------------------------------L----C--LNIGIDPPD....VIKISPCARME....CW...
E1ZHR5_CHLVA/131-284---------------------------------------M----C--LNIGVDPPD....VIKISPCARLE....CW...
E3Q6X3_COLGM/216-369---------------------------------------V----C--LNISVEPPD....QLKTNPGAKLE....AW...
E4XFS5_OIKDI/47-229---------------------------------------L----C--LNIDVDPEDWREDLAKDVPVARREGNINAWDVN
E4ZUC8_LEPMJ/159-315---------------------------------------L----C--LNIGVDPPD....VIKTNPCAKEE....CW...
E5SIN8_TRISP/43-196---------------------------------------L----C--LNIGIDPPD....TVKPKPCARTE....CW...
E6R3W2_CRYGW/91-244---------------------------------------I----C--LNLGVDPPD....IVKTNPCAKTE....CW...
E7F7S1_DANRE/56-209---------------------------------------L----C--LNVGVDPPD....VVKTSPCARLE....CW...
E7LNC0_TRYCR/61-219---------------------------------------L----C--LNIGSDPPD....YPRIEPCARLE....CW...
E9BHG6_LEIDB/113-280---------------------------------------M----Y--LHIGSDPPG....FPRVEPCAKME....CW...
E9CIT6_CAPO3/726-879---------------------------------------L----C--LNIGVDPPD....IVKTSPCARLE....CW...
F0W2J7_9STRA/129-282---------------------------------------L----C--LNIGTDPPD....VVKSSPCARKE....CW...
F0XXV0_AURAN/11-165---------------------------------------L----C--LNIGTDPPD....AVAASPRARRE....CW...
F0ZAV4_DICPU/114-267---------------------------------------L----C--LNIGVDPPD....VIKTYPCARME....CW...
F1KR12_ASCSU/48-201---------------------------------------L----C--LNIGVDPPD....VQKPNPCARQE....CW...
Q0CHB3_ASPTN/188-344---------------------------------------I----C--LNIGVDPPD....VVKTNPTAKLE....CW...
Q6BQ71_DEBHA/64-218---------------------------------------L----C--LNLGVDPPD....VMKTYPCAKYE....AW...
RTOR1_ARATH/103-256---------------------------------------L----C--LNITVDPPD....VIKISPCARIE....AW...

PF01650

VPEG_ARATH/59-330---------------------------------------VAGSSG--YWNYRHQADICHAYQLLRK.GGLKEENIVV---
A0CQC7_PARTE/19-285---------------------------------------VSGSNA--FYNYRHQADVCHSYKTLIR.NGYNPENVIV---
A2FXM6_TRIVA/13-267---------------------------------------FCGSRD--FYNYRHTADSYYMYHLIAEVNNLDKDKIIL---
O24539_VICNA/53-325---------------------------------------VAGSNG--YGNYRHQADVCHAYQLLIK.GGVKEENIVV---
HGLB_SCHMA/37-291---------------------------------------VAGSNG--YPNYRHQADVCHAYHVLRS.KGIKPEHIIT---
HGLB_SCHJA/31-285---------------------------------------VAGSNG--FENYRHQADVCHAYHVLLS.KGVKPEHIIT---
VPE_VICSA/56-325---------------------------------------LAGSNG--YWNYRHQSDVCHAYQLLRK.GGSKEENIIV---
Q02SI3_PSEAB/341-579---------------------------------------LGGDGR--QGVFLREAD..YAGDLLGQRFAARGV.IRL---
Q08BI0_DANRE/27-278---------------------------------------VAGSKD--WDNYRHQANVCCAYQLMKK.QGIPDEQIVV---
Q0MYV8_EMIHU/33-301---------------------------------------IAGSSG--YGNYRHQADVCHAYQIMIK.NGIDPDKIIT---
Q22P32_TETTS/20-285---------------------------------------VAGSKG--YENYRHQADVCHAYHTLVK.KGFAPENIIV---
Q22P33_TETTS/20-285---------------------------------------VAGSKG--YENYRHQADVCHAYQSLLK.KGFQPENIIV---
Q2M438_PHYIN/25-298---------------------------------------VSGSNG--YSNYRHQSDACHAYHIVRR.HGIPAENVVL---
Q2UVF3_HAECO/29-287---------------------------------------VAGSDG--WWNYRHQADVSHAYHTLIN.HGVKPDNIIV---
Q4K5F2_PSEF5/335-570---------------------------------------LAGDGK--QSVFLREAD..YVSNMLASRFGAYGQ.IRL---
Q4RED0_TETNG/30-283---------------------------------------VAGSNG--WDNYRHQADACHAYQIVHR.NGIPDEQIVV---
Q4UU48_XANC8/124-392---------------------------------------FAGDAS--DDVFRNETL..YLKQLFEQRFDARGRVITL---
Q6EHZ7_TRIVA/12-258---------------------------------------IAGSND--FYNYRHQADIFNMYQQLVK.RGFDDQHITM---
Q6FEB2_ACIAD/229-477---------------------------------------VAGASY--QDVFKSEIM..RIKDQFDTRFGTFGRSMML---
Q6L4R2_ORYSJ/41-319---------------------------------------IAGSNG--FYNYRHQADVCHAYQIMRK.GGVEEQNIVV---
Q6NYJ7_DANRE/32-288---------------------------------------VAGSNG--WYNYRHQADVCHAYQIVHK.NGIPDEQIVV---
Q6PRC7_IXORI/38-293---------------------------------------VAGSNG--YYNYRHQADICHAYHVLHN.HGIPDERIVV---
Q711M2_FASHE/21-278---------------------------------------VAGSNG--WPNYRHHADVCHAYQVLIK.NGFAPENIVT---
Q84LM2_ORYSJ/62-334---------------------------------------VAGSSG--YGNYRHQADVCHAYQILQK.GGVKEENIVV---
Q852T1_TOBAC/49-320---------------------------------------VAGSRG--YWNYRHQADVCHAYQLLKK.GGLKDENIIV---
Q86TV2_HUMAN/29-286---------------------------------------VAGSNG--WYNYRHQADACHAYQIIHR.NGIPDEQIVV---
Q88QE3_PSEPK/400-640---------------------------------------VAGDGQ--QSVFLREAD..YVSRMLKVRFGARGQ.VTL---
Q8LGK2_ARATH/46-316---------------------------------------VAGSNE--YYNYRHQADICHAYQILRK.GGLKDENIIV---
Q949L7_BETVU/51-321---------------------------------------IAGSSG--YWNYRHQADVCHAYQVLKK.GGLKDENIIV---
Q9LLQ4_SESIN/54-326---------------------------------------VAGSNG--FGNYRHQADVCHAYQILKK.GGLRDENIIV---
Q9LWZ3_ORYSJ/41-304---------------------------------------IAGSKG--YENYRHQADVCHAYQIMKK.GGLKDQNIVV---
Q9SBX2_MAIZE/45-317---------------------------------------IAGSNG--YYNYRHQADICHAYQIMKK.GGLKDENIVV---
Q9SMD0_SOLLC/39-316---------------------------------------VAGSKE--WYNYRHQANLCHAYQLLKK.GGLKDEHIIV---
Q9XG75_TOBAC/40-306---------------------------------------VAGSNE--WDNYRHQADVCHAYQLLKK.GGLKDENIIV---

PF03415

Q8A866_BACTN/37-399---------------------------------------D----N..SLSRFASEDLNEMIEGMQSVDDNHNNLLVYMDK
Q9WZB1_THEMA/121-462---------------------------------------D----N..NLYYYSEDDLSEMRNASGSV.....SVVVVYDG
Q8XM44_CLOPE/59-508---------------------------------------D----N..NLEEYILNDIEEMKEGYKNNPNL..NIIVLVDR
Q9X1S5_THEMA/586-937---------------------------------------D----N..NLESFALNDLSEMLNSNENV.....SVVVIFDG
Q9WYY6_THEMA/5-301---------------------------------------.----............................NVFALVDY
CLOS_CLOHI/60-510---------------------------------------D----N..NLEGSLLNDIEEMKTGYKDSPNL..NLIALVDR
Q8TIY6_METAC/66-593---------------------------------------S----DLESSNGYASKDIFEIIDGASMLNGNETEILIAYGG

PF12770

A0LJ53_SYNFM/581-921KT.................SRKTQYLIEN...QAIL..YLSSAS------------------------------------
A0LQE8_SYNFM/635-947.......................KYLIER...YTPVVFTPASRD------------------------------------
A0YK41_LYNSP/3523-3818.......................QFLIEK...YSVG..LAPSLT------------------------------------
A0YW51_LYNSP/1488-1787.......................KFLLED...YSLA..LIPSLS------------------------------------
A0YZ16_LYNSP/128-434.......................QFLVEK...YSLT..RIPAFN------------------------------------
A1BCK0_CHLPD/513-826......................KRWLIDR...FTVR..YAPDFQ------------------------------------
A1BEL3_CHLPD/43-361.......................GFLALH...KEFT........------------------------------------
A1BEL6_CHLPD/46-364.......................GFLARH...EGFT........------------------------------------
A3WDM2_9SPHN/678-1006VDAYLERTADAQTDEELFDYRGIDWLGKS...RDVS..IAVSPR------------------------------------
A4HBL7_LEIBR/1053-1432......................DRYFVEE...AAVQ..MAFS..------------------------------------
A8L4T6_FRASN/741-1051.....................AGTYALDR...LTLV..YAPSVR------------------------------------
A8YIK9_MICAE/645-974.......................QYLVEN...YHIT..YLTSGR------------------------------------
A9WBC0_CHLAA/673-929.......................NYLMER...YLIE..QIPTGA------------------------------------
A9WER9_CHLAA/54-394S....................QLIPLTTS...DQIL........------------------------------------
A9WF91_CHLAA/60-360.......................EPLLMG...EEVY........------------------------------------
B0C874_ACAM1/207-507.......................QFLVEQ...YNLA..LIPSFS------------------------------------
B2IXC0_NOSP7/1396-1691.......................GFLVEK...YSIG..LMPSIS------------------------------------
B2IZZ4_NOSP7/695-973.......................KYLIEH...YAIS..IAYESK------------------------------------
B2JAK0_NOSP7/526-830.......................QYLIEK...YEIF..YLPSVT------------------------------------
B2JAM9_NOSP7/866-1190.....................KLQPLLVE...HEIV..NAPSAS------------------------------------
B3QB04_RHOPT/774-1131PDADPL..........FTSYRDVPWLARS...HAVT..TVPSAA------------------------------------
B4JKU3_DROGR/1402-1700......................GEYLSER...CALL..TAPSLQ------------------------------------
B4VHH6_9CYAN/1150-1443.......................QFLIEN...YSLS..MIPTFS------------------------------------
B4VJ14_9CYAN/646-949.......................RYLVET...YSFT..YLTSGR------------------------------------
B4VJ30_9CYAN/3784-4081.......................NFLVEK...YSVG..LMPSLS------------------------------------
B4VLG1_9CYAN/97-405.......................RPLATG...TDVA..FSRYQL------------------------------------
B4VLY5_9CYAN/1558-1850.......................QFLIEK...YSAG..LMPSIS------------------------------------
B4VPE9_9CYAN/1179-1471.......................GFIVER...YSIG..FMPSLS------------------------------------
B4VQD3_9CYAN/1443-1735.......................GFLIER...YSVG..LMPSLS------------------------------------
B4VQK8_9CYAN/1658-1953.......................DFIVRR...YSVS..LMPSVS------------------------------------
B4VTQ2_9CYAN/1746-2036.......................QFLIEN...YSVG..IMPSLS------------------------------------
B4VXN8_9CYAN/1368-1663.......................NFLIEN...YSVN..LIPSFS------------------------------------
B4VXQ8_9CYAN/1752-2046.......................QFLVEK...YSIG..SIPSMS------------------------------------
B4VYA5_9CYAN/647-942.......................QFLIEH...YSIG..SIPSFS------------------------------------
B4WMI9_9SYNE/695-1035.......................SYLIET...YQIS..YLSSGR------------------------------------
B6C3H2_9GAMM/45-361......................MTTLSER...MAVS..VTPSAV------------------------------------
B8G8X7_CHLAD/58-398S....................RPQPLATS...DQVL........------------------------------------
B8GD94_CHLAD/102-415.......................TPLLTE...RRLS........------------------------------------
C3Z401_BRAFL/1278-1602......................NECLYER...YGLV..VTPSIQ------------------------------------
F0SR63_PLABD/137-574................................YVVS..YCPSAT------------------------------------
P72963_SYNY3/155-456.......................EYLLEK...YSLT..NIPAFN------------------------------------
P73032_SYNY3/1449-1747......................GQYLIED...YSVG..LMPSLS------------------------------------
P74108_SYNY3/591-904.....................PPTYLTDR...HELV..TMPSAS------------------------------------
Q01RE6_SOLUE/865-1136.......................FWLAEQ...HPIG..VISGLA------------------------------------
Q024J7_SOLUE/541-814.......................RYLIQE...VTLS..LAPSLA------------------------------------
Q025F1_SOLUE/607-877.......................AHLLER...QTVF..YAPSLT------------------------------------
Q028B5_SOLUE/667-935.......................RYLMED...RAIF..YTPSLS------------------------------------
Q02DA1_SOLUE/510-786.......................HYVGER...FAIT..IAAGLA------------------------------------
Q10YT7_TRIEI/1003-1309.......................RFLVEN...YSFT..YLSSGR------------------------------------
Q10YU6_TRIEI/544-838......................ERYLVER...YAIA..VAPSLE------------------------------------
Q112V9_TRIEI/62-390.....................GQIYFATN...RKLS..FYRRRY------------------------------------
Q113D1_TRIEI/130-430.......................DYLGAS...............------------------------------------
Q113U8_TRIEI/3002-3297.......................QFLIEK...YSLS..LIPSIS------------------------------------
Q115J8_TRIEI/1466-1777QE..................NPEKKYLQDYFNQGVS..YAPSCQ------------------------------------
Q117G6_TRIEI/881-1206.......................QYLVEN...YSIT..YLSSGR------------------------------------
Q119J2_TRIEI/1474-1770.......................QFLVEK...YSLG..LIPSFT------------------------------------
Q16H64_AEDAE/1315-1614......................GEYLSER...CSLL..TVPSLH------------------------------------
Q2G6U6_NOVAD/692-1020IEAYKARMES..PDGDPFDFTGVEWLGRG...REVS..IAVSPR------------------------------------
Q2S6G2_SALRD/540-844YD.................HEQARFVLHE...RPTA..LDLSAS------------------------------------
Q2W535_MAGSA/875-1218.......................KYLIER...IDLH..VLNSSR------------------------------------
Q38C46_TRYB2/1044-1397.......................NFVIED...FAFQ..LGFS..------------------------------------
Q3AQG5_CHLCH/44-362.......................GFLARH...EGFT........------------------------------------
Q4C5K3_CROWT/405-717.......................NLSLAETFKQGIQ..YSPSCQ------------------------------------
Q4S217_TETNG/1205-1537......................NEYLYER...FSLI..CVPSLC------------------------------------
Q55594_SYNY3/165-457.......................KFLAEQ...YAIT..RIPGFN------------------------------------
Q5LLA3_SILPO/680-970......................GTYLATE....DVH..FIRNV.------------------------------------
Q64CV3_9ARCH/59-374.......................DFLVPS....QIH........------------------------------------
Q7NCT1_GLOVI/600-923.......................HPLLQD...HTLT..YLVSGR------------------------------------
Q7NF67_GLOVI/550-854.......................RFLVER...FTIQ..YLGSGR------------------------------------
Q7NFD7_GLOVI/666-979.......................HYLIEK...YTLS..YLNAGR------------------------------------
Q7NIF7_GLOVI/691-997.......................RYLLER...FELV..YLSSGR------------------------------------
Q7NJE3_GLOVI/660-988.......................RSLLQR...YALT..YLVSGR------------------------------------
Q7NLR0_GLOVI/653-961.......................RYLVEN...YTIS..YLSSGR------------------------------------
Q7NVB0_CHRVO/67-386P...................GAGQHLLLQ............AQR------------------------------------
Q82I85_STRAW/1175-1481......................RRYALQA...AEIS..YAASAR------------------------------------
Q82L10_STRAW/969-1256.....................ADAAVLDR...VASS..YTPTLR------------------------------------
Q8DGG5_THEEB/541-835.......................RYLVES...YWIT..LLTSGR------------------------------------
Q8DH74_THEEB/570-891.......................RYLVQS...YTIT..LLTSGR------------------------------------
Q8DHI1_THEEB/67-394E....................QSAFSREQASFFGLGNFILPPP.------------------------------------
Q8DIE5_THEEB/1127-1420.......................GFLVER...FSMA..LVPSLR------------------------------------
Q8YZU5_NOSS1/56-340......................SRYLTEK...YAVA..TTSSLQ------------------------------------
TTC28_HUMAN/1390-1713......................NEYLYER...FGLL..AVPSIR------------------------------------

PF03568

Q75EJ0_ASHGO/1148-1552...............FALLMEELNDIIEK---NNRTTSIEVTSV------------------------------------
ESPL1_HUMAN/1716-2069..................VLNEFDAIQKA---QKENS.......------------------------------------
BIMB_EMENI/1605-2004................EDGRDEMKELIRL---ANESA..HAAKL------------------------------------
Q6V3V9_DROVI/167-544..................LVERFRRVVTV---DPLTV.......------------------------------------
Q6ZHH8_ORYSJ/451-870ATD.KNWQCPWGYTIIDYVAPTFRKILEE---NFISLSSATLTL------------------------------------
Q6FTE1_CANGA/1147-1548...............FQQASESLQKIIND---SNESVSKNVTET------------------------------------
Q8SRL6_ENCCU/365-731..................IRLDLREMIDP---RHVAV.......------------------------------------
Q7RB01_PLAYO/620-1007....................NKYNFIVTN---YEKEESQQNGNK------------------------------------
ESPL1_MOUSE/1712-2065..................VLKEFDAIQKD---QKENS.......------------------------------------
Q6NR96_XENLA/1471-1824..................TLQEFDEIQKQ---QKAVN.......------------------------------------
ESP1_YEAST/1171-1571...............FPEATKKLLSIINE---SNQTTSVEVTNK------------------------------------
Q6CQQ7_KLULA/1114-1517...............FEAALDELNHIISS---NNCTTSIEVTSV------------------------------------
Q23491_CAEEL/745-1104..................VMDKFTYLLEE---DRQIV......S------------------------------------
Q6CCJ0_YARLI/1206-1588...............FSDGLDELKSIISE---SDTMT....RTG------------------------------------
O82745_ARATH/1299-1653KSLKGPWLCPWGTTVVDEVAPAFKSILEE---SHSSS...STTE------------------------------------
CUT1_SCHPO/1379-1770...............FTKAQTELFRIISK---SNQMA..QNGKH------------------------------------
Q9VRN6_DROME/169-538..................LVERFRRVVTV---DPLNM.......------------------------------------
Q6V3V6_DROWI/170-538..................LVERFRRVVNV---DPILA.......------------------------------------

PF01364

KGP83_PORGN/244-595.................................DVISGEKG.......................................
D1JG83_9ARCH/891-1295VPFVDTELVQNLTVTYDNYSLVEDYLPQDFIDALNDPKIQEKITLLAQEGY.............................
A2U064_9FLAO/401-768D...................YKDR..IAANNNI..VPVKLSTIS....................................
Q7MTE2_PORGI/239-573.................................KDIPAKI........................................
D3HWT0_9BACT/400-777DNR..............MLTPECR..NLNPDDY..LLCFESENS....................................
Q5S3Q9_9FLAO/543-910D...................YKDR..VKNNTNL..VPNLQSLGS....................................
A9DMD5_9FLAO/555-923D...................YKDR..IEGNTNI..VPVYQAFDS....................................
B0VGA8_CLOAI/228-563..............................NGSYTIPTYTEQ......................................
B7B5I7_9PORP/382-753DNR..............KLTSAWK..SVDMSNM..LLTYQTENS....................................
B8FFM0_DESAA/254-600.................................DKIPTHHTACATWN.................................
A3U7G6_CROAH/540-908D...................YKDR..LQNNNLI..IPTYQRLRS....................................
D2QSX9_SPILD/414-786NYR..............NIGGLVS..PAQLANM..VPVYESRES....................................
A3HW99_9BACT/398-769MYSTAR.........QNGVNYFYRNNPSAFSFQNLVPPGG........................................
B0VHP2_CLOAI/234-563.................................PQIPTLT........................................
A8ZUB1_DESOH/278-656.................................GIIPPRTLWCE....................................
B0VIM2_CLOAI/182-528..............................NGTYAIPTNFIVSP....................................
Q2Z0E1_9BACT/643-1013D..................YRHY....LTTGIECFVPTYYTG......................................
B3QXR8_CHLT3/734-1131...........................SYSTSNDYVPTMHVQT.....................................
C2MCN4_9PORP/405-781DNR..............KVSQDWSARDFQLTEF..LLTYQGENS....................................
A4A325_9PLAN/24-399........................PGDQPTPEAPGVPTHLMDAVVN..................................
A7NR84_ROSCS/499-867DP................FDYTD....RGAKNVNLIPPYLAMV.....................................
Q11Q36_CYTH3/558-932D...................YKNH..TGIGGNF..VPTYESRES....................................
Q7MX16_PORGI/272-637KYL..............ADTDNTKVPTSFIHNVSLIPSHPT.......................................
A0B5K7_METTP/796-1154LPFPT..........TGVKQELE...........GDP...........................................
D0MH89_RHOM4/586-975NY.................RELWQ..KPTLKNW..VPPYETVDS....................................
A8UH97_9FLAO/539-910D...................YKDR..IRNNTNL..VPSWYSTNS....................................
B8KYL6_9GAMM/364-704......................WERATPTGNSRNLVPTEQVM......................................
B8FIK5_DESAA/1139-1542.................................TVVPARMCYIA....................................
Q11US7_CYTH3/392-767PSMSNFINNVGSVVYRKNPSFYWTNTDFKNHFVNLVPPFG........................................
C6W101_DYAFD/326-680PQK...............ARKMK.....DSWQTDMVPNAG........................................
A5FJM8_FLAJ1/544-914D...................YKNR..IANNNNI..VPIYQALRS....................................
Q7UG73_RHOBA/51-444.......................PDYDTPRNQPHQIPTWMIPAPVT..................................
A3J247_9FLAO/540-919D...................YKNR..LFNNTNI..VPVFHGFNPLASET...............................
A9WIM0_CHLAA/500-869D..................PRDY....LRRGWPTLIPPYLAEV.....................................
B0VHE7_CLOAI/227-554................................DGTIAVTS........................................
C6VT06_DYAFD/394-758......................TQNEKMVRELPGEVPTIG........................................
C6X3N8_FLAB3/546-921D...................FRGK..NNPGSDI..VPSYQSEES....................................
A0LQH1_SYNFM/790-1132D...................YKN....VKGYRDALVPPLMAD......................................
A1ZVJ9_9BACT/406-774D...................YKDR..VANNTNF..VPIYESRES....................................
B0VHF1_CLOAI/214-595IPHRGFYV.....SVNNSDEGTD.........................................................
B0VIE7_CLOAI/193-598........................D.TVPVAYVTPEPNGQ........................................
C6W3P4_DYAFD/414-806......................TRNDRINKELLNEVPTFS........................................
B2RGP6_PORG3/408-787DNR..............KVSVAWQKPYLQQTEF..LLTFQAVNS....................................
D2QJ99_SPILD/409-770TPG...............VRNNP.....SQSGLDMVMTAG........................................
A9B5Q8_HERA2/466-850D..................PLNY....LGRNNPNMIPPLPAYT.....................................
D2QFF3_SPILD/397-745YPY...............TVKTA.....TD...DLVPTMG........................................
B0VH03_CLOAI/589-939DWR...............NFSGF....SAPKNK..LIVWQ........................................
D2R2P5_PIRSD/21-411......................PGSGTNIELRRRCVPTYHVDAKVN..................................
C6W0Z3_DYAFD/393-758DYR..............NLLRNQS..PAQRAAW..VPVYESRES....................................
A3XQP5_LEEBM/552-929D...................YKDR..IDNNNNL..VPTFNTYYS....................................
C9RIY0_FIBSS/581-957D...................YRGK..ANIGENY..IPPFE........................................
Q2PY26_9BACT/412-780D...................MKGR..LSPDQNQ..IPAFQSQAS....................................
Q26FX7_FLABB/537-909D...................YKDR..ISIRENI..VPSFHTAEA....................................
B0VJT2_CLOAI/236-566..............................SGSYTIPANSA.......................................
C6BTD6_DESAD/56-402.................................DIVPPARFD......................................
D2QE53_SPILD/328-1007VPMRNMVSYVSDKGNYGWDFVYVSDPVPPIRKCFKIPGQSIAKLRHDSSTGAFALRTVPDPQNPGKTKQVFDDTQPFRTL
A2BK55_HYPBU/159-551.................................AEVPPVYVCSPILS.................................
B0VHP1_CLOAI/283-636.................................AQVPTNNG.......................................
Q1Q1Y4_9BACT/620-970DYN..............DNLASGTINYVPSQIIETDELGE........................................
C7PNY3_CHIPD/396-764D...................YKNR..IAGNTNM..IPTWQSTIS....................................
Q6LFY5_PHOPR/224-617.................................EDIPGYEIVGHP...................................
B3QVL4_CHLT3/688-1063D...................FRS....IKNDDYEKLVTYQSDEV....................................
A9B187_HERA2/552-907DPH...............DYADI....IGQPVTNFIPPYLADV.....................................
B3C566_9BACE/537-910DNR..............MLTSSWK..NYRPENF..LLSYQSETS....................................
B0VJY1_CLOAI/655-1014DT................RDNSP....SRIYNL..IPVKKTWT.....................................
B8G4Y1_CHLAD/584-1054.................................QVLPYAQVEAGADKDYSQAP...........................
A1ZEG7_9BACT/410-775IDQS.............ATSLNPRIIP.AHRGQDLIPPFG........................................
B0VF22_CLOAI/223-583VPERGA........YGQVGDTVD.........................................................
A0LKV0_SYNFM/924-1265D..................PKDH....LGRGLVSFIPSLNGMD.....................................
A8ZTD5_DESOH/257-648.................................EFIPTHR........................................
A9B8S0_HERA2/477-840D..................PRDV....LGYGQPPLIPPYLAEV.....................................
C3JBB2_9PORP/421-799DNR..............KVSVHWESIGLQNTPF..LLTYQSSNS....................................
C9SW40_VERA1/279-917VPVRRVAGALEGGIEPPLTVNPPANNKSFWTGSHLRIHAVNPGTWWGASTDNLLVRPDTGALIRYDAAGTSSSTSPGW..
C9LI59_9BACT/509-899DNR...............MLTTT...KLNAADF..LLAYEAGPGDGQT................................
B5ICF9_ACIB4/214-642.....................AVPPSYYWTDQYMYLLAYYGLS.....................................
Y048_ARCFU/22-377.................................DIVPPSYYAK.....................................
A3I371_9BACT/360-725D...................YKGK..LGGRPNI..VPTYSSRNS....................................

PF11713

A0AED2_YEREN/2138-2301--------------------------------------------------------------------------------
A0KHZ7_AERHH/3609-3767--------------------------------------------------------------------------------
A1EPL5_VIBCL/3469-3627--------------------------------------------------------------------------------
A2PYQ6_CLOPF/575-753--------------------------------------------------------------------------------
A3UPN6_VIBSP/3781-3944--------------------------------------------------------------------------------
A4TI66_YERPP/771-929--------------------------------------------------------------------------------
A4TI66_YERPP/1083-1262--------------------------------------------------------------------------------
A5KV80_9GAMM/1072-1230--------------------------------------------------------------------------------
A5L6I6_9GAMM/693-849--------------------------------------------------------------------------------
A5L6I6_9GAMM/1529-1710--------------------------------------------------------------------------------
A5L6I6_9GAMM/1908-2074--------------------------------------------------------------------------------
TOXA_CLODI/576-757--------------------------------------------------------------------------------
TOXB_CLODI/574-755--------------------------------------------------------------------------------
Q2KX68_BORA1/2483-2627--------------------------------------------------------------------------------
Q2SAY5_HAHCH/1-160--------------------------------------------------------------------------------
Q46149_CLONO/581-762--------------------------------------------------------------------------------
Q46342_CLOSO/574-755--------------------------------------------------------------------------------
Q7N1Z0_PHOLL/2456-2614--------------------------------------------------------------------------------
Q7N726_PHOLL/2997-3151--------------------------------------------------------------------------------
Q7VV06_BORPE/2551-2702--------------------------------------------------------------------------------
Q7VV06_BORPE/2959-3112--------------------------------------------------------------------------------
Q7VV06_BORPE/3397-3549--------------------------------------------------------------------------------
Q7VV06_BORPE/3808-3959--------------------------------------------------------------------------------

PF13900

B4E0H0_HUMAN/45-92--------------------------------------------------------------------------------
Q7Z4P3_HUMAN/54-101--------------------------------------------------------------------------------
Q6ZTF6_HUMAN/58-105--------------------------------------------------------------------------------
B9NCR3_POPTR/128-175--------------------------------------------------------------------------------
CN165_HUMAN/57-104--------------------------------------------------------------------------------
Q9P195_HUMAN/6-53--------------------------------------------------------------------------------
B3KRW9_HUMAN/44-91--------------------------------------------------------------------------------
Q6ZS53_HUMAN/79-126--------------------------------------------------------------------------------
Q6ZNG3_HUMAN/65-112--------------------------------------------------------------------------------
B7Z559_HUMAN/16-63--------------------------------------------------------------------------------
Q9BGW3_MACFA/24-71--------------------------------------------------------------------------------
Q6ZNU7_HUMAN/32-79--------------------------------------------------------------------------------
B9NCR2_POPTR/11-60--------------------------------------------------------------------------------
Q6ZNZ6_HUMAN/6-53--------------------------------------------------------------------------------
Q8N287_HUMAN/31-78--------------------------------------------------------------------------------
Q95KE1_MACFA/88-135--------------------------------------------------------------------------------
Q9UI48_HUMAN/14-61--------------------------------------------------------------------------------
Q9H5D5_HUMAN/64-111--------------------------------------------------------------------------------
Q9NR08_HUMAN/145-192--------------------------------------------------------------------------------
Q6ZSG7_HUMAN/16-63--------------------------------------------------------------------------------
B9NF68_POPTR/42-89--------------------------------------------------------------------------------
Q9P147_HUMAN/36-83--------------------------------------------------------------------------------
Q6ZQR8_HUMAN/34-81--------------------------------------------------------------------------------
C9JL81_HUMAN/280-327--------------------------------------------------------------------------------
Q96ID7_HUMAN/6-53--------------------------------------------------------------------------------
Q5T5H1_HUMAN/139-186--------------------------------------------------------------------------------
B7Z2Z5_HUMAN/303-350--------------------------------------------------------------------------------
C9JQS0_HUMAN/70-117--------------------------------------------------------------------------------
Q4R5J6_MACFA/21-68--------------------------------------------------------------------------------
Q9NX85_HUMAN/34-81--------------------------------------------------------------------------------
B4XZE4_HUMAN/24-71--------------------------------------------------------------------------------
Q6STG2_HUMAN/10-57--------------------------------------------------------------------------------
Q96LS9_HUMAN/23-70--------------------------------------------------------------------------------
Q6ZTX9_HUMAN/54-102--------------------------------------------------------------------------------
Q9P191_HUMAN/17-60--------------------------------------------------------------------------------

PF00656

Q7Q803_ANOGA/54-306--------------------------ADC---------------------------------------------------
Q7QGM9_ANOGA/35-227--------------------------NDM---------------------------------------------------
Q7PV92_ANOGA/14-237--------------------------KDR---------------------------------------------------
Q70VV0_PICAB/3-415--------------------------NDV---------------------------------------------------
CASP4_MOUSE/132-369--------------------------FDI---------------------------------------------------
CASP5_HUMAN/193-430--------------------------YDI---------------------------------------------------
MCA1_KLULA/138-430--------------------------NDS---------------------------------------------------
MCA9_ARATH/10-321--------------------------NDV---------------------------------------------------
MCA1_ARATH/80-362--------------------------NDA---------------------------------------------------
MCA1_DEBHA/146-437--------------------------NDV---------------------------------------------------
MCA7_ARATH/3-401--------------------------NDV---------------------------------------------------
Q7Q1E0_ANOGA/62-291--------------------------IDC---------------------------------------------------
Q89XE4_BRAJA/58-278--------------------------NDA---------------------------------------------------
Q6N5Q1_RHOPA/33-253--------------------------NDG---------------------------------------------------
Q9ZSP8_HEVBR/3-415--------------------------NDV---------------------------------------------------
Q89FZ4_BRAJA/32-256--------------------------NDA---------------------------------------------------
Q6QN97_PIG/259-484--------------------------NDT---------------------------------------------------
Q7Q4X6_ANOGA/73-309--------------------------VDC---------------------------------------------------
Q6E5N8_ICTPU/119-362--------------------------LDE---------------------------------------------------
Q6AKF4_DESPS/28-248--------------------------NDA---------------------------------------------------
O42284_CHICK/42-279--------------------------VDV---------------------------------------------------
Q7QKT2_ANOGA/35-260--------------------------KDV---------------------------------------------------
Q6N0T4_RHOPA/30-251--------------------------SDA---------------------------------------------------
Q9NHF9_DROME/56-302--------------------------RDR---------------------------------------------------
Q89HT8_BRAJA/51-272--------------------------NDA---------------------------------------------------
Q87Z21_PSESM/2-225--------------------------NDA---------------------------------------------------
CASP1_PIG/163-400--------------------------VDI---------------------------------------------------
CASP3_XENLA/56-280--------------------------VDA---------------------------------------------------
Q9I8J3_DANRE/238-473--------------------------MDK---------------------------------------------------
Q9GV88_HYDVU/84-316--------------------------VDA---------------------------------------------------
MCA4_ARATH/3-416--------------------------NDV---------------------------------------------------
CASP2_RAT/200-445--------------------------VDH---------------------------------------------------
Q9IB64_XENLA/261-494--------------------------KDA---------------------------------------------------
MCA2_ARATH/116-414--------------------------NDA---------------------------------------------------
Q9Y1U6_PRIPA/173-413--------------------------ADV---------------------------------------------------
CASPD_BOVIN/136-373--------------------------LDI---------------------------------------------------
CASPE_MOUSE/22-256--------------------------VDM---------------------------------------------------
MCA1_ASHGO/154-449--------------------------NDV---------------------------------------------------
PCP_DICDI/188-405--------------------------NDV---------------------------------------------------
Q8ITP2_BRAFL/151-396--------------------------VDA---------------------------------------------------
Q7WDK3_BORBR/552-800--------------------------NDA---------------------------------------------------
Q98UI8_DANRE/48-280--------------------------VDA---------------------------------------------------
ICE_DROME/94-328--------------------------VDC---------------------------------------------------
Q7PZJ9_ANOGA/20-250--------------------------KDL---------------------------------------------------
Q9NBW3_DROME/38-248--------------------------NDV---------------------------------------------------
MCA5_ARATH/3-408--------------------------NDV---------------------------------------------------
O88550_RAT/68-301--------------------------KDA---------------------------------------------------
Q9DDJ2_DANRE/174-400--------------------------RDE---------------------------------------------------
Q985X8_RHILO/35-256--------------------------NDA---------------------------------------------------
CASP1_SPOFR/61-293--------------------------VDS---------------------------------------------------
CASP1_FELCA/161-406--------------------------LDV---------------------------------------------------
Q9IB66_XENLA/58-298--------------------------TDS---------------------------------------------------
CFLAR_HUMAN/252-477--------------------------NET---------------------------------------------------
CASP1_MOUSE/162-398--------------------------VDL---------------------------------------------------
CASP2_CHICK/171-416--------------------------VDC---------------------------------------------------
CASP1_DROME/79-313--------------------------VDA---------------------------------------------------
Q9DDL2_DANRE/323-560--------------------------ADV---------------------------------------------------
MCA1_SCHPO/130-422--------------------------NDV---------------------------------------------------
Q8JIS8_ORYLA/58-285--------------------------NDA---------------------------------------------------
Q89IK1_BRAJA/30-253--------------------------HDA---------------------------------------------------
O93415_CHICK/57-299--------------------------ADR---------------------------------------------------
Q89MV1_BRAJA/176-400--------------------------KDA---------------------------------------------------
Q8IEW1_9TRYP/63-322--------------------------NDV---------------------------------------------------
Q98IJ9_RHILO/30-261--------------------------NDA---------------------------------------------------
Q9TZP5_CAEEL/26-261--------------------------KDK---------------------------------------------------
Q7RFI8_PLAYO/964-1364--------------------------NDA---------------------------------------------------
MCA1_YARLI/168-458--------------------------NDV---------------------------------------------------
MCA1_CANGA/98-389--------------------------NDA---------------------------------------------------
Q8I6Y2_GEOCY/158-414--------------------------KDA---------------------------------------------------
Q98IJ6_RHILO/11-238--------------------------RDA---------------------------------------------------
CASP1_HUMAN/163-400--------------------------VDI---------------------------------------------------
Q9I9L7_DANRE/145-379--------------------------KDE---------------------------------------------------
Q8YS65_NOSS1/4-245--------------------------RDA---------------------------------------------------
Q8ITP3_BRAFL/87-323--------------------------LDA---------------------------------------------------
Q98G71_RHILO/26-252--------------------------NDA---------------------------------------------------
Q74F93_GEOSL/6-270--------------------------ADA---------------------------------------------------
CFLAR_MOUSE/257-481--------------------------NDT---------------------------------------------------
MCA6_ARATH/3-366--------------------------NDV---------------------------------------------------
Q8T8E8_9TRYP/84-341--------------------------ADA---------------------------------------------------
CAS1A_XENLA/144-382--------------------------VDL---------------------------------------------------
CED3_CAEEL/243-494--------------------------ADK---------------------------------------------------
Q53839_STRCH/9-268--------------------------NNL---------------------------------------------------
Q6DCI2_XENLA/78-314--------------------------IDA---------------------------------------------------
B5VS82_YEAS6/157-450--------------------------NDA---------------------------------------------------
Q6N329_RHOPA/73-298--------------------------NDA---------------------------------------------------
Q6NTR7_XENLA/280-494--------------------------NDA---------------------------------------------------
Q7NPG1_GLOVI/7-278--------------------------EDA---------------------------------------------------
CASP8_HUMAN/234-476--------------------------LDA---------------------------------------------------
Q98CE0_RHILO/5-238--------------------------HDG---------------------------------------------------
Q82I86_STRAW/5-276--------------------------TDV---------------------------------------------------
CASP1_CANFA/163-400--------------------------LDI---------------------------------------------------
Q9I8S9_ONCMY/57-297--------------------------ADR---------------------------------------------------
CASP9_HUMAN/161-413--------------------------IDC---------------------------------------------------
CASP6_MOUSE/28-270--------------------------ADR---------------------------------------------------
Q8T8E6_9TRYP/84-343--------------------------NDV---------------------------------------------------
Q6NBN5_RHOPA/57-277--------------------------NDA---------------------------------------------------
Q9IB63_XENLA/144-396--------------------------IDR---------------------------------------------------
Q89XG2_BRAJA/27-248--------------------------NDA---------------------------------------------------
Q90WU1_CHICK/237-479--------------------------VDA---------------------------------------------------
Q9GV89_HYDVU/93-318--------------------------VDV---------------------------------------------------
Q6PAD9_XENLA/268-495--------------------------KDA---------------------------------------------------
ICENC_DROME/196-443--------------------------KDS---------------------------------------------------
Q98JS7_RHILO/35-253--------------------------NDA---------------------------------------------------
CASP8_MOUSE/236-478--------------------------CDK---------------------------------------------------
Q89KP2_BRAJA/86-307--------------------------NDA---------------------------------------------------
Q86FL0_ANOST/52-286--------------------------RDR---------------------------------------------------
P74453_SYNY3/40-299--------------------------TDR---------------------------------------------------
CASPC_MOUSE/176-415--------------------------TDI---------------------------------------------------
MCA8_ARATH/3-378--------------------------NDV---------------------------------------------------
Q8JG42_TAKRU/51-279--------------------------VDA---------------------------------------------------
Q90WU0_CHICK/148-400--------------------------IDC---------------------------------------------------
Q89HP3_BRAJA/336-569--------------------------NDA---------------------------------------------------
Q8I749_SUBDO/254-491--------------------------IDV---------------------------------------------------
O93417_CHICK/53-281--------------------------ADA---------------------------------------------------
CASPE_HUMAN/18-241--------------------------EDL---------------------------------------------------

PF14538

A2DJF0_TRIVA/81-229..........................EDL---------------------------------------------------
A2DYB3_TRIVA/11-163LTFDPTY....YAPQ.......TK..HVV---------------------------------------------------
A2DYM2_TRIVA/66-217..RNMSK...................TLP---------------------------------------------------
A2E336_TRIVA/52-203QISNTTQ...................TLL---------------------------------------------------
A2EZ34_TRIVA/86-237..RNMSN...................ILP---------------------------------------------------
A2F8U1_TRIVA/62-211STESTS....................NPQ---------------------------------------------------
A2F9H3_TRIVA/30-182LTFDPTY....YAPD.......SR..KAI---------------------------------------------------
A2FJN8_TRIVA/40-192LTFDPSV....FAPS.......SQ..NAI---------------------------------------------------
A2G2E2_TRIVA/83-230..........................KNI---------------------------------------------------
A2G590_TRIVA/29-181LTFDPTV....FAPS.......SS..NAI---------------------------------------------------
A2GCD5_TRIVA/96-248..QNTNN...................SFS---------------------------------------------------
A8Q911_MALGO/109-262..MDPES....LDA.........S..KAL---------------------------------------------------
A9TBL2_PHYPA/90-243..IDPFS....TAS.........V..KAL---------------------------------------------------
A9V5A2_MONBE/627-778..IDPEE....KP.............KAI---------------------------------------------------
B0CNS4_LACBS/33-186..VDPHT....LPA.........Q..KAL---------------------------------------------------
B0ENS2_ENTDS/37-190..IDTAG....KTN.........R..KLV---------------------------------------------------
B0WBU4_CULQU/24-183LCLEDDS.....................T---------------------------------------------------
B0WR30_CULQU/146-268..V.......................KNE---------------------------------------------------
B3RPQ9_TRIAD/42-195..LDPLT....MNP.........N..KSL---------------------------------------------------
B4R5C8_DROSI/213-366..IDPSS....VSP.........P..KAM---------------------------------------------------
B6JY50_SCHJY/122-275..IDPFS....LPA.........S..KAL---------------------------------------------------
B7PLB3_IXOSC/91-248..LGEDAGIRRSPP.........Q..KAL---------------------------------------------------
B8CBK6_THAPS/255-410..LDPTS....ISR.........A..KAK---------------------------------------------------
B8P5W0_POSPM/106-259..VDPHT....LPA.........Q..KAL---------------------------------------------------
C4LXC3_ENTHI/41-195..INTKE....HKK.........R..EIG---------------------------------------------------
C5KFU4_PERM5/815-945.............................---------------------------------------------------
D0N306_PHYIT/11-164..VDPFS....MPA.........K..KAI---------------------------------------------------
D2VMD1_NAEGR/143-295..VDPQT.....HP.........Q..KAL---------------------------------------------------
D8LUT8_BLAHO/28-155..........................RVF---------------------------------------------------
D8RG53_SELML/71-224..IDPSS....LAP.........Q..KAL---------------------------------------------------
D8T9J0_SELML/49-198..IEPSA...................KAI---------------------------------------------------
E1ZHR5_CHLVA/131-284..VDPLS....MQA.........P..KAL---------------------------------------------------
E3Q6X3_COLGM/216-369..TDPTT....PPP.........Q..KAL---------------------------------------------------
E4XFS5_OIKDI/47-229DNFDNEL....PPQDVIYRNVQDTLKSNF---------------------------------------------------
E4ZUC8_LEPMJ/159-315..IDPTV....TSQT......PGH..TPM---------------------------------------------------
E5SIN8_TRISP/43-196..IDPQC....MPM.........Q..KAL---------------------------------------------------
E6R3W2_CRYGW/91-244..IDPTQ....LPA.........P..KAI---------------------------------------------------
E7F7S1_DANRE/56-209..IDPLS....MSP.........Q..KAL---------------------------------------------------
E7LNC0_TRYCR/61-219..IDPHVA..QISRF......ALE..GGS---------------------------------------------------
E9BHG6_LEIDB/113-280..VDPMVA..HVAKSAHRSGRGSGAGGGS---------------------------------------------------
E9CIT6_CAPO3/726-879..MDPFS....VPP.........Q..RAL---------------------------------------------------
F0W2J7_9STRA/129-282..VDPFS....MPA.........Q..KAL---------------------------------------------------
F0XXV0_AURAN/11-165..LEPFA....GPS........RQ..KAL---------------------------------------------------
F0ZAV4_DICPU/114-267..IDPAS....QPP.........Q..KSL---------------------------------------------------
F1KR12_ASCSU/48-201..IDPHG....MNP.........Q..KAI---------------------------------------------------
Q0CHB3_ASPTN/188-344..VDPTS....TTGG......GQT..KIM---------------------------------------------------
Q6BQ71_DEBHA/64-218..CDPSL....FSD........TK..KAI---------------------------------------------------
RTOR1_ARATH/103-256..IDPFS....MAP.........P..KAL---------------------------------------------------

PF01650

VPEG_ARATH/59-330--------------------------FMY---------------------------------------------------
A0CQC7_PARTE/19-285--------------------------FAY---------------------------------------------------
A2FXM6_TRIVA/13-267--------------------------MCY---------------------------------------------------
O24539_VICNA/53-325--------------------------FMY---------------------------------------------------
HGLB_SCHMA/37-291--------------------------MMY---------------------------------------------------
HGLB_SCHJA/31-285--------------------------FMY---------------------------------------------------
VPE_VICSA/56-325--------------------------FMY---------------------------------------------------
Q02SI3_PSEAB/341-579--------------------------VNH---------------------------------------------------
Q08BI0_DANRE/27-278--------------------------MIY---------------------------------------------------
Q0MYV8_EMIHU/33-301--------------------------LAV---------------------------------------------------
Q22P32_TETTS/20-285--------------------------FLY---------------------------------------------------
Q22P33_TETTS/20-285--------------------------FLY---------------------------------------------------
Q2M438_PHYIN/25-298--------------------------MMY---------------------------------------------------
Q2UVF3_HAECO/29-287--------------------------MMK---------------------------------------------------
Q4K5F2_PSEF5/335-570--------------------------VNH---------------------------------------------------
Q4RED0_TETNG/30-283--------------------------MMY---------------------------------------------------
Q4UU48_XANC8/124-392--------------------------VNH---------------------------------------------------
Q6EHZ7_TRIVA/12-258--------------------------MAY---------------------------------------------------
Q6FEB2_ACIAD/229-477--------------------------VNN---------------------------------------------------
Q6L4R2_ORYSJ/41-319--------------------------MMY---------------------------------------------------
Q6NYJ7_DANRE/32-288--------------------------MMY---------------------------------------------------
Q6PRC7_IXORI/38-293--------------------------MMY---------------------------------------------------
Q711M2_FASHE/21-278--------------------------IMY---------------------------------------------------
Q84LM2_ORYSJ/62-334--------------------------FMY---------------------------------------------------
Q852T1_TOBAC/49-320--------------------------FMY---------------------------------------------------
Q86TV2_HUMAN/29-286--------------------------MMY---------------------------------------------------
Q88QE3_PSEPK/400-640--------------------------VNH---------------------------------------------------
Q8LGK2_ARATH/46-316--------------------------FMY---------------------------------------------------
Q949L7_BETVU/51-321--------------------------FMY---------------------------------------------------
Q9LLQ4_SESIN/54-326--------------------------FMY---------------------------------------------------
Q9LWZ3_ORYSJ/41-304--------------------------MMY---------------------------------------------------
Q9SBX2_MAIZE/45-317--------------------------FMY---------------------------------------------------
Q9SMD0_SOLLC/39-316--------------------------FMY---------------------------------------------------
Q9XG75_TOBAC/40-306--------------------------FMY---------------------------------------------------

PF03415

Q8A866_BACTN/37-399......................----GSN---------------------------------------------------
Q9WZB1_THEMA/121-462I.....................----GIG---------------------------------------------------
Q8XM44_CLOPE/59-508IPGYSNDSKVLGSNFEDTRLYK----IGE---------------------------------------------------
Q9X1S5_THEMA/586-937F.....................----FHS---------------------------------------------------
Q9WYY6_THEMA/5-301R.....................----SSS---------------------------------------------------
CLOS_CLOHI/60-510SPRYSSDEKVLGEDFSDTRLYK----IEH---------------------------------------------------
Q8TIY6_METAC/66-593AAAEGWEGMTI...........----AEL---------------------------------------------------

PF12770

A0LJ53_SYNFM/581-921-----------------------------------------------------------------------L...LKTLR
A0LQE8_SYNFM/635-947-----------------------------------------------------------------------R...LRDSP
A0YK41_LYNSP/3523-3818-----------------------------------------------------------------------....LTETR
A0YW51_LYNSP/1488-1787-----------------------------------------------------------------------....LTDTS
A0YZ16_LYNSP/128-434-----------------------------------------------------------------------L...LVDTN
A1BCK0_CHLPD/513-826-----------------------------------------------------------------------V...LLSGE
A1BEL3_CHLPD/43-361-----------------------------------------------------------------------....LSRS.
A1BEL6_CHLPD/46-364-----------------------------------------------------------------------....LSRT.
A3WDM2_9SPHN/678-1006-----------------------------------------------------------------------G...FLNIR
A4HBL7_LEIBR/1053-1432-----------------------------------------------------------------------....ATQAA
A8L4T6_FRASN/741-1051-----------------------------------------------------------------------A...LAATR
A8YIK9_MICAE/645-974-----------------------------------------------------------------------D...LLRLK
A9WBC0_CHLAA/673-929-----------------------------------------------------------------------....LLGIP
A9WER9_CHLAA/54-394-----------------------------------------------------------------------....FSRYI
A9WF91_CHLAA/60-360-----------------------------------------------------------------------....FSRYL
B0C874_ACAM1/207-507-----------------------------------------------------------------------....LTDTR
B2IXC0_NOSP7/1396-1691-----------------------------------------------------------------------....LTNTL
B2IZZ4_NOSP7/695-973-----------------------------------------------------------------------G...RRSPS
B2JAK0_NOSP7/526-830-----------------------------------------------------------------------AQLLIEDDE
B2JAM9_NOSP7/866-1190-----------------------------------------------------------------------T...ISVVR
B3QB04_RHOPT/774-1131-----------------------------------------------------------------------A...LRTLR
B4JKU3_DROGR/1402-1700-----------------------------------------------------------------------A...LRGRS
B4VHH6_9CYAN/1150-1443-----------------------------------------------------------------------....LMNSN
B4VJ14_9CYAN/646-949-----------------------------------------------------------------------D...LLRLQ
B4VJ30_9CYAN/3784-4081-----------------------------------------------------------------------....ITDTS
B4VLG1_9CYAN/97-405-----------------------------------------------------------------------STGLMRPIH
B4VLY5_9CYAN/1558-1850-----------------------------------------------------------------------....LTDTR
B4VPE9_9CYAN/1179-1471-----------------------------------------------------------------------....LTDTR
B4VQD3_9CYAN/1443-1735-----------------------------------------------------------------------....LTDTR
B4VQK8_9CYAN/1658-1953-----------------------------------------------------------------------....LTDTR
B4VTQ2_9CYAN/1746-2036-----------------------------------------------------------------------....LTDTR
B4VXN8_9CYAN/1368-1663-----------------------------------------------------------------------....LMQAR
B4VXQ8_9CYAN/1752-2046-----------------------------------------------------------------------....LTNHR
B4VYA5_9CYAN/647-942-----------------------------------------------------------------------....LTNTR
B4WMI9_9SYNE/695-1035-----------------------------------------------------------------------D...LLKLQ
B6C3H2_9GAMM/45-361-----------------------------------------------------------------------F...LAENR
B8G8X7_CHLAD/58-398-----------------------------------------------------------------------....FSRYI
B8GD94_CHLAD/102-415-----------------------------------------------------------------------....ATIER
C3Z401_BRAFL/1278-1602-----------------------------------------------------------------------A...LSMNQ
F0SR63_PLABD/137-574-----------------------------------------------------------------------L...LVELC
P72963_SYNY3/155-456-----------------------------------------------------------------------....LIDSN
P73032_SYNY3/1449-1747-----------------------------------------------------------------------....LTNRD
P74108_SYNY3/591-904-----------------------------------------------------------------------T...LGILR
Q01RE6_SOLUE/865-1136-----------------------------------------------------------------------D...LAPTG
Q024J7_SOLUE/541-814-----------------------------------------------------------------------L...LAGKP
Q025F1_SOLUE/607-877-----------------------------------------------------------------------F...LRQDR
Q028B5_SOLUE/667-935-----------------------------------------------------------------------VLYEMEKMR
Q02DA1_SOLUE/510-786-----------------------------------------------------------------------D...YQRRT
Q10YT7_TRIEI/1003-1309-----------------------------------------------------------------------D...LLTFT
Q10YU6_TRIEI/544-838-----------------------------------------------------------------------....LLPPK
Q112V9_TRIEI/62-390-----------------------------------------------------------------------Q...LEESN
Q113D1_TRIEI/130-430-----------------------------------------------------------------------....LVTVR
Q113U8_TRIEI/3002-3297-----------------------------------------------------------------------....LMDTN
Q115J8_TRIEI/1466-1777-----------------------------------------------------------------------I...LQKVR
Q117G6_TRIEI/881-1206-----------------------------------------------------------------------D...LLQLT
Q119J2_TRIEI/1474-1770-----------------------------------------------------------------------....LTDTR
Q16H64_AEDAE/1315-1614-----------------------------------------------------------------------T...LRQKS
Q2G6U6_NOVAD/692-1020-----------------------------------------------------------------------G...FLDIR
Q2S6G2_SALRD/540-844-----------------------------------------------------------------------LATDTSATR
Q2W535_MAGSA/875-1218-----------------------------------------------------------------------D...L..LP
Q38C46_TRYB2/1044-1397-----------------------------------------------------------------------....ATQCR
Q3AQG5_CHLCH/44-362-----------------------------------------------------------------------....FSRT.
Q4C5K3_CROWT/405-717-----------------------------------------------------------------------L...LQKIE
Q4S217_TETNG/1205-1537-----------------------------------------------------------------------S...LTSAV
Q55594_SYNY3/165-457-----------------------------------------------------------------------....LTEWG
Q5LLA3_SILPO/680-970-----------------------------------------------------------------------....LTQTP
Q64CV3_9ARCH/59-374-----------------------------------------------------------------------....LIRRV
Q7NCT1_GLOVI/600-923-----------------------------------------------------------------------E...LPRLA
Q7NF67_GLOVI/550-854-----------------------------------------------------------------------D...LLRLA
Q7NFD7_GLOVI/666-979-----------------------------------------------------------------------D...LTRLQ
Q7NIF7_GLOVI/691-997-----------------------------------------------------------------------D...LIRLS
Q7NJE3_GLOVI/660-988-----------------------------------------------------------------------E...LPRLE
Q7NLR0_GLOVI/653-961-----------------------------------------------------------------------D...LLRLG
Q7NVB0_CHRVO/67-386-----------------------------------------------------------------------P...ICLTR
Q82I85_STRAW/1175-1481-----------------------------------------------------------------------L...LCEVA
Q82L10_STRAW/969-1256-----------------------------------------------------------------------ALLFSRARR
Q8DGG5_THEEB/541-835-----------------------------------------------------------------------E...LLRIL
Q8DH74_THEEB/570-891-----------------------------------------------------------------------D...LLRLQ
Q8DHI1_THEEB/67-394-----------------------------------------------------------------------....ISEIH
Q8DIE5_THEEB/1127-1420-----------------------------------------------------------------------....LTDTR
Q8YZU5_NOSS1/56-340-----------------------------------------------------------------------....LTDLK
TTC28_HUMAN/1390-1713-----------------------------------------------------------------------S...LSVQS

PF03568

Q75EJ0_ASHGO/1148-1552-----------------------------------------------------------------------I---KTKED
ESPL1_HUMAN/1716-2069-----------------------------------------------------------------------.---.SCTD
BIMB_EMENI/1605-2004-----------------------------------------------------------------------Q---VDRQM
Q6V3V9_DROVI/167-544-----------------------------------------------------------------------.---KAQEA
Q6ZHH8_ORYSJ/451-870-----------------------------------------------------------------------N---DGQAN
Q6FTE1_CANGA/1147-1548-----------------------------------------------------------------------I---KDKND
Q8SRL6_ENCCU/365-731-----------------------------------------------------------------------.---....N
Q7RB01_PLAYO/620-1007-----------------------------------------------------------------------N---EDKLK
ESPL1_MOUSE/1712-2065-----------------------------------------------------------------------.---.SCTE
Q6NR96_XENLA/1471-1824-----------------------------------------------------------------------.---.NLTD
ESP1_YEAST/1171-1571-----------------------------------------------------------------------I---KTREE
Q6CQQ7_KLULA/1114-1517-----------------------------------------------------------------------I---TTKEQ
Q23491_CAEEL/745-1104-----------------------------------------------------------------------N---HEKYK
Q6CCJ0_YARLI/1206-1588-----------------------------------------------------------------------T---AFPGG
O82745_ARATH/1299-1653-----------------------------------------------------------------------E---DTIES
CUT1_SCHPO/1379-1770-----------------------------------------------------------------------Y---TRRED
Q9VRN6_DROME/169-538-----------------------------------------------------------------------.---KGKEA
Q6V3V6_DROWI/170-538-----------------------------------------------------------------------.---KNKET

PF01364

KGP83_PORGN/244-595..........................................................................KKTKKV
D1JG83_9ARCH/891-1295................................................................LNSPNNPILTLMGFDI
A2U064_9FLAO/401-768.......................................................................FNLASS.YV
Q7MTE2_PORGI/239-573...........................................................................TPGIK
D3HWT0_9BACT/400-777.......................................................................FNKVTC.YV
Q5S3Q9_9FLAO/543-910.......................................................................FTLSDS.FV
A9DMD5_9FLAO/555-923.......................................................................FNLTRG.FM
B0VGA8_CLOAI/228-563.........................................................................MSTYGGE
B7B5I7_9PORP/382-753........................................................................LSSQS.YV
B8FFM0_DESAA/254-600....................................................................DPGDEPHHGLMA
A3U7G6_CROAH/540-908.......................................................................FSLLSS.FA
D2QSX9_SPILD/414-786.......................................................................LHPVLS.YS
A3HW99_9BACT/398-769..............................................................................YP
B0VHP2_CLOAI/234-563...........................................................................YSGGG
A8ZUB1_DESOH/278-656.......................................................................AGRYEDYIP
B0VIM2_CLOAI/182-528........................................................................EYPTENDA
Q2Z0E1_9BACT/643-1013..........................................................................GVLYWP
B3QXR8_CHLT3/734-1131.........................................................................LRFGATA
C2MCN4_9PORP/405-781........................................................................TNVYS.YS
A4A325_9PLAN/24-399......................................................................VHFGSEPTLV
A7NR84_ROSCS/499-867........................................................................DPWLGETA
Q11Q36_CYTH3/558-932.......................................................................LKELQS.YN
Q7MX16_PORGI/272-637..........................................................................FGSICA
A0B5K7_METTP/796-1154...........................................................................ISYDV
D0MH89_RHOM4/586-975.......................................................................YHPINS.YT
A8UH97_9FLAO/539-910.......................................................................FSLTNS.FV
B8KYL6_9GAMM/364-704.........................................................................VQGHFAA
B8FIK5_DESAA/1139-1542.......................................................................YAYYEEETP
Q11US7_CYTH3/392-767..............................................................................EP
C6W101_DYAFD/326-680..............................................................................WP
A5FJM8_FLAJ1/544-914.......................................................................NSVGESGFA
Q7UG73_RHOBA/51-444......................................................................SRFGSTSTLP
A3J247_9FLAO/540-919..................................................................NNISNFSLYSS.FM
A9WIM0_CHLAA/500-869........................................................................DPWLGETA
B0VHE7_CLOAI/227-554............................................................................NNTY
C6VT06_DYAFD/394-758..............................................................................YP
C6X3N8_FLAB3/546-921.......................................................................RDYELS.FV
A0LQH1_SYNFM/790-1132.........................................................................TPNGLAP
A1ZVJ9_9BACT/406-774.......................................................................LHPILS.HS
B0VHF1_CLOAI/214-595............................................................................ADIP
B0VIE7_CLOAI/193-598............................................................................ETVP
C6W3P4_DYAFD/414-806..............................................................................FP
B2RGP6_PORG3/408-787........................................................................TNVNS.YV
D2QJ99_SPILD/409-770..............................................................................YP
A9B5Q8_HERA2/466-850........................................................................DPWLGEIA
D2QFF3_SPILD/397-745..............................................................................YP
B0VH03_CLOAI/589-939...........................................................................GSYIV
D2R2P5_PIRSD/21-411......................................................................VKFGSEPTIP
C6W0Z3_DYAFD/393-758.......................................................................LNPVYT.YS
A3XQP5_LEEBM/552-929.......................................................................FSQSQS.YM
C9RIY0_FIBSS/581-957...........................................................................KEASV
Q2PY26_9BACT/412-780.......................................................................FSLYSS.FV
Q26FX7_FLABB/537-909.......................................................................TSLTQS.YV
B0VJT2_CLOAI/236-566...........................................................................ANSGV
C6BTD6_DESAD/56-402.........................................................................SGNEVHL
D2QE53_SPILD/328-1007CNATSGKIISFNLNASAQQPGWYFTKESEFMDAKKTTGFTRLAKPETDDLGKIYMILEGPDASVSSTYGFYWLGNDRNIP
A2BK55_HYPBU/159-551.....................................................................ELVSPREAAIP
B0VHP1_CLOAI/283-636..........................................................................NAGSHP
Q1Q1Y4_9BACT/620-970..............................................................................TP
C7PNY3_CHIPD/396-764.......................................................................TDPVYA.YP
Q6LFY5_PHOPR/224-617.......................................................................YHGKNHRWH
B3QVL4_CHLT3/688-1063.......................................................................LELVNDVSI
A9B187_HERA2/552-907........................................................................DPWLRETA
B3C566_9BACE/537-910.......................................................................LEETSS.YV
B0VJY1_CLOAI/655-1014.........................................................................YKHGATA
B8G4Y1_CHLAD/584-1054..............................................................WNSNCRNPQGTEPGSGWR
A1ZEG7_9BACT/410-775..............................................................................YP
B0VF22_CLOAI/223-583............................................................................ARMP
A0LKV0_SYNFM/924-1265.........................................................................EIFGRVP
A8ZTD5_DESOH/257-648...........................................................................GDGCG
A9B8S0_HERA2/477-840........................................................................DLWLGETA
C3JBB2_9PORP/421-799........................................................................LNIYS.YT
C9SW40_VERA1/279-917......................................YFTTADDYATRSATPTNFVRVEGPSSLVNAGLQFIYAWNTLP
C9LI59_9BACT/509-899....................................................................DISIGTLYS.YV
B5ICF9_ACIB4/214-642........................................................................DMYDAWIP
Y048_ARCFU/22-377........................................................................LIFYEPFP
A3I371_9BACT/360-725.......................................................................LDPLKS.YS

PF11713

A0AED2_YEREN/2138-2301---------------------------------------------------------------------------.....
A0KHZ7_AERHH/3609-3767---------------------------------------------------------------------------.....
A1EPL5_VIBCL/3469-3627---------------------------------------------------------------------------.....
A2PYQ6_CLOPF/575-753---------------------------------------------------------------------------.....
A3UPN6_VIBSP/3781-3944---------------------------------------------------------------------------.....
A4TI66_YERPP/771-929---------------------------------------------------------------------------.....
A4TI66_YERPP/1083-1262---------------------------------------------------------------------------.....
A5KV80_9GAMM/1072-1230---------------------------------------------------------------------------.....
A5L6I6_9GAMM/693-849---------------------------------------------------------------------------.....
A5L6I6_9GAMM/1529-1710---------------------------------------------------------------------------NSKEY
A5L6I6_9GAMM/1908-2074---------------------------------------------------------------------------.....
TOXA_CLODI/576-757---------------------------------------------------------------------------.....
TOXB_CLODI/574-755---------------------------------------------------------------------------.....
Q2KX68_BORA1/2483-2627---------------------------------------------------------------------------.....
Q2SAY5_HAHCH/1-160---------------------------------------------------------------------------...LT
Q46149_CLONO/581-762---------------------------------------------------------------------------.....
Q46342_CLOSO/574-755---------------------------------------------------------------------------.....
Q7N1Z0_PHOLL/2456-2614---------------------------------------------------------------------------.....
Q7N726_PHOLL/2997-3151---------------------------------------------------------------------------.....
Q7VV06_BORPE/2551-2702---------------------------------------------------------------------------.....
Q7VV06_BORPE/2959-3112---------------------------------------------------------------------------.....
Q7VV06_BORPE/3397-3549---------------------------------------------------------------------------.....
Q7VV06_BORPE/3808-3959---------------------------------------------------------------------------.....

PF13900

B4E0H0_HUMAN/45-92--------------------------------------------------------------------------------
Q7Z4P3_HUMAN/54-101--------------------------------------------------------------------------------
Q6ZTF6_HUMAN/58-105--------------------------------------------------------------------------------
B9NCR3_POPTR/128-175--------------------------------------------------------------------------------
CN165_HUMAN/57-104--------------------------------------------------------------------------------
Q9P195_HUMAN/6-53--------------------------------------------------------------------------------
B3KRW9_HUMAN/44-91--------------------------------------------------------------------------------
Q6ZS53_HUMAN/79-126--------------------------------------------------------------------------------
Q6ZNG3_HUMAN/65-112--------------------------------------------------------------------------------
B7Z559_HUMAN/16-63--------------------------------------------------------------------------------
Q9BGW3_MACFA/24-71--------------------------------------------------------------------------------
Q6ZNU7_HUMAN/32-79--------------------------------------------------------------------------------
B9NCR2_POPTR/11-60--------------------------------------------------------------------------------
Q6ZNZ6_HUMAN/6-53--------------------------------------------------------------------------------
Q8N287_HUMAN/31-78--------------------------------------------------------------------------------
Q95KE1_MACFA/88-135--------------------------------------------------------------------------------
Q9UI48_HUMAN/14-61--------------------------------------------------------------------------------
Q9H5D5_HUMAN/64-111--------------------------------------------------------------------------------
Q9NR08_HUMAN/145-192--------------------------------------------------------------------------------
Q6ZSG7_HUMAN/16-63--------------------------------------------------------------------------------
B9NF68_POPTR/42-89--------------------------------------------------------------------------------
Q9P147_HUMAN/36-83--------------------------------------------------------------------------------
Q6ZQR8_HUMAN/34-81--------------------------------------------------------------------------------
C9JL81_HUMAN/280-327--------------------------------------------------------------------------------
Q96ID7_HUMAN/6-53--------------------------------------------------------------------------------
Q5T5H1_HUMAN/139-186--------------------------------------------------------------------------------
B7Z2Z5_HUMAN/303-350--------------------------------------------------------------------------------
C9JQS0_HUMAN/70-117--------------------------------------------------------------------------------
Q4R5J6_MACFA/21-68--------------------------------------------------------------------------------
Q9NX85_HUMAN/34-81--------------------------------------------------------------------------------
B4XZE4_HUMAN/24-71--------------------------------------------------------------------------------
Q6STG2_HUMAN/10-57--------------------------------------------------------------------------------
Q96LS9_HUMAN/23-70--------------------------------------------------------------------------------
Q6ZTX9_HUMAN/54-102--------------------------------------------------------------------------------
Q9P191_HUMAN/17-60--------------------------------------------------------------------------------

PF00656

Q7Q803_ANOGA/54-306---------------------------------------------------------------------------DN-I-
Q7QGM9_ANOGA/35-227---------------------------------------------------------------------------KQ-I-
Q7PV92_ANOGA/14-237---------------------------------------------------------------------------TD-I-
Q70VV0_PICAB/3-415---------------------------------------------------------------------------NR-M-
CASP4_MOUSE/132-369---------------------------------------------------------------------------IG-M-
CASP5_HUMAN/193-430---------------------------------------------------------------------------VG-M-
MCA1_KLULA/138-430---------------------------------------------------------------------------HN-M-
MCA9_ARATH/10-321---------------------------------------------------------------------------LA-M-
MCA1_ARATH/80-362---------------------------------------------------------------------------KC-M-
MCA1_DEBHA/146-437---------------------------------------------------------------------------KN-M-
MCA7_ARATH/3-401---------------------------------------------------------------------------HR-M-
Q7Q1E0_ANOGA/62-291---------------------------------------------------------------------------KR-L-
Q89XE4_BRAJA/58-278---------------------------------------------------------------------------RA-L-
Q6N5Q1_RHOPA/33-253---------------------------------------------------------------------------GL-I-
Q9ZSP8_HEVBR/3-415---------------------------------------------------------------------------KR-M-
Q89FZ4_BRAJA/32-256---------------------------------------------------------------------------KG-M-
Q6QN97_PIG/259-484---------------------------------------------------------------------------DV-L-
Q7Q4X6_ANOGA/73-309---------------------------------------------------------------------------EN-L-
Q6E5N8_ICTPU/119-362---------------------------------------------------------------------------DS-L-
Q6AKF4_DESPS/28-248---------------------------------------------------------------------------KD-F-
O42284_CHICK/42-279---------------------------------------------------------------------------KE-M-
Q7QKT2_ANOGA/35-260---------------------------------------------------------------------------KA-L-
Q6N0T4_RHOPA/30-251---------------------------------------------------------------------------RE-L-
Q9NHF9_DROME/56-302---------------------------------------------------------------------------DD-M-
Q89HT8_BRAJA/51-272---------------------------------------------------------------------------ES-M-
Q87Z21_PSESM/2-225---------------------------------------------------------------------------VA-I-
CASP1_PIG/163-400---------------------------------------------------------------------------RD-M-
CASP3_XENLA/56-280---------------------------------------------------------------------------LK-L-
Q9I8J3_DANRE/238-473---------------------------------------------------------------------------DR-L-
Q9GV88_HYDVU/84-316---------------------------------------------------------------------------ES-L-
MCA4_ARATH/3-416---------------------------------------------------------------------------RR-M-
CASP2_RAT/200-445---------------------------------------------------------------------------TT-L-
Q9IB64_XENLA/261-494---------------------------------------------------------------------------EE-I-
MCA2_ARATH/116-414---------------------------------------------------------------------------NC-M-
Q9Y1U6_PRIPA/173-413---------------------------------------------------------------------------IA-L-
CASPD_BOVIN/136-373---------------------------------------------------------------------------LG-M-
CASPE_MOUSE/22-256---------------------------------------------------------------------------EA-L-
MCA1_ASHGO/154-449---------------------------------------------------------------------------QN-I-
PCP_DICDI/188-405---------------------------------------------------------------------------NS-F-
Q8ITP2_BRAFL/151-396---------------------------------------------------------------------------GN-L-
Q7WDK3_BORBR/552-800---------------------------------------------------------------------------NA-I-
Q98UI8_DANRE/48-280---------------------------------------------------------------------------GN-V-
ICE_DROME/94-328---------------------------------------------------------------------------EN-L-
Q7PZJ9_ANOGA/20-250---------------------------------------------------------------------------EA-V-
Q9NBW3_DROME/38-248---------------------------------------------------------------------------NA-L-
MCA5_ARATH/3-408---------------------------------------------------------------------------RR-V-
O88550_RAT/68-301---------------------------------------------------------------------------EA-L-
Q9DDJ2_DANRE/174-400---------------------------------------------------------------------------EN-A-
Q985X8_RHILO/35-256---------------------------------------------------------------------------GL-I-
CASP1_SPOFR/61-293---------------------------------------------------------------------------DN-L-
CASP1_FELCA/161-406---------------------------------------------------------------------------AG-M-
Q9IB66_XENLA/58-298---------------------------------------------------------------------------MN-L-
CFLAR_HUMAN/252-477---------------------------------------------------------------------------EL-L-
CASP1_MOUSE/162-398---------------------------------------------------------------------------RE-M-
CASP2_CHICK/171-416---------------------------------------------------------------------------AS-L-
CASP1_DROME/79-313---------------------------------------------------------------------------QE-L-
Q9DDL2_DANRE/323-560---------------------------------------------------------------------------HE-L-
MCA1_SCHPO/130-422---------------------------------------------------------------------------MS-M-
Q8JIS8_ORYLA/58-285---------------------------------------------------------------------------AA-A-
Q89IK1_BRAJA/30-253---------------------------------------------------------------------------ED-V-
O93415_CHICK/57-299---------------------------------------------------------------------------NN-L-
Q89MV1_BRAJA/176-400---------------------------------------------------------------------------SL-M-
Q8IEW1_9TRYP/63-322---------------------------------------------------------------------------MH-M-
Q98IJ9_RHILO/30-261---------------------------------------------------------------------------HL-I-
Q9TZP5_CAEEL/26-261---------------------------------------------------------------------------KK-L-
Q7RFI8_PLAYO/964-1364---------------------------------------------------------------------------YV-F-
MCA1_YARLI/168-458---------------------------------------------------------------------------HN-L-
MCA1_CANGA/98-389---------------------------------------------------------------------------HN-I-
Q8I6Y2_GEOCY/158-414---------------------------------------------------------------------------EN-L-
Q98IJ6_RHILO/11-238---------------------------------------------------------------------------QA-M-
CASP1_HUMAN/163-400---------------------------------------------------------------------------TG-M-
Q9I9L7_DANRE/145-379---------------------------------------------------------------------------EN-M-
Q8YS65_NOSS1/4-245---------------------------------------------------------------------------EL-I-
Q8ITP3_BRAFL/87-323---------------------------------------------------------------------------NN-L-
Q98G71_RHILO/26-252---------------------------------------------------------------------------LD-I-
Q74F93_GEOSL/6-270---------------------------------------------------------------------------ED-M-
CFLAR_MOUSE/257-481---------------------------------------------------------------------------KY-L-
MCA6_ARATH/3-366---------------------------------------------------------------------------RR-M-
Q8T8E8_9TRYP/84-341---------------------------------------------------------------------------VM-M-
CAS1A_XENLA/144-382---------------------------------------------------------------------------DG-M-
CED3_CAEEL/243-494---------------------------------------------------------------------------DN-L-
Q53839_STRCH/9-268---------------------------------------------------------------------------AA-L-
Q6DCI2_XENLA/78-314---------------------------------------------------------------------------RE-L-
B5VS82_YEAS6/157-450---------------------------------------------------------------------------HN-I-
Q6N329_RHOPA/73-298---------------------------------------------------------------------------KA-I-
Q6NTR7_XENLA/280-494---------------------------------------------------------------------------SL-L-
Q7NPG1_GLOVI/7-278---------------------------------------------------------------------------RK-F-
CASP8_HUMAN/234-476---------------------------------------------------------------------------GA-L-
Q98CE0_RHILO/5-238---------------------------------------------------------------------------EA-M-
Q82I86_STRAW/5-276---------------------------------------------------------------------------EE-A-
CASP1_CANFA/163-400---------------------------------------------------------------------------AG-M-
Q9I8S9_ONCMY/57-297---------------------------------------------------------------------------SN-L-
CASP9_HUMAN/161-413---------------------------------------------------------------------------EK-L-
CASP6_MOUSE/28-270---------------------------------------------------------------------------DN-L-
Q8T8E6_9TRYP/84-343---------------------------------------------------------------------------KQ-M-
Q6NBN5_RHOPA/57-277---------------------------------------------------------------------------RL-L-
Q9IB63_XENLA/144-396---------------------------------------------------------------------------DK-L-
Q89XG2_BRAJA/27-248---------------------------------------------------------------------------RD-V-
Q90WU1_CHICK/237-479---------------------------------------------------------------------------DA-L-
Q9GV89_HYDVU/93-318---------------------------------------------------------------------------QA-L-
Q6PAD9_XENLA/268-495---------------------------------------------------------------------------GA-L-
ICENC_DROME/196-443---------------------------------------------------------------------------KS-L-
Q98JS7_RHILO/35-253---------------------------------------------------------------------------KL-I-
CASP8_MOUSE/236-478---------------------------------------------------------------------------EA-L-
Q89KP2_BRAJA/86-307---------------------------------------------------------------------------GL-I-
Q86FL0_ANOST/52-286---------------------------------------------------------------------------DS-I-
P74453_SYNY3/40-299---------------------------------------------------------------------------QL-L-
CASPC_MOUSE/176-415---------------------------------------------------------------------------LN-M-
MCA8_ARATH/3-378---------------------------------------------------------------------------HR-M-
Q8JG42_TAKRU/51-279---------------------------------------------------------------------------AN-A-
Q90WU0_CHICK/148-400---------------------------------------------------------------------------EK-L-
Q89HP3_BRAJA/336-569---------------------------------------------------------------------------RA-V-
Q8I749_SUBDO/254-491---------------------------------------------------------------------------HN-L-
O93417_CHICK/53-281---------------------------------------------------------------------------AS-V-
CASPE_HUMAN/18-241---------------------------------------------------------------------------DA-L-

PF14538

A2DJF0_TRIVA/81-229---------------------------------------------------------------------------SV-VN
A2DYB3_TRIVA/11-163---------------------------------------------------------------------------QD-VY
A2DYM2_TRIVA/66-217---------------------------------------------------------------------------SD-F.
A2E336_TRIVA/52-203---------------------------------------------------------------------------SS-VI
A2EZ34_TRIVA/86-237---------------------------------------------------------------------------SD-F.
A2F8U1_TRIVA/62-211---------------------------------------------------------------------------QE-I.
A2F9H3_TRIVA/30-182---------------------------------------------------------------------------ED-MY
A2FJN8_TRIVA/40-192---------------------------------------------------------------------------QN-LY
A2G2E2_TRIVA/83-230---------------------------------------------------------------------------HE-LS
A2G590_TRIVA/29-181---------------------------------------------------------------------------QD-LY
A2GCD5_TRIVA/96-248---------------------------------------------------------------------------SE-Y.
A8Q911_MALGO/109-262---------------------------------------------------------------------------PA-I.
A9TBL2_PHYPA/90-243---------------------------------------------------------------------------EA-I.
A9V5A2_MONBE/627-778---------------------------------------------------------------------------EL-I.
B0CNS4_LACBS/33-186---------------------------------------------------------------------------EA-I.
B0ENS2_ENTDS/37-190---------------------------------------------------------------------------YD-I.
B0WBU4_CULQU/24-183---------------------------------------------------------------------------AK-L.
B0WR30_CULQU/146-268---------------------------------------------------------------------------NE-V.
B3RPQ9_TRIAD/42-195---------------------------------------------------------------------------EA-V.
B4R5C8_DROSI/213-366---------------------------------------------------------------------------EL-I.
B6JY50_SCHJY/122-275---------------------------------------------------------------------------EA-I.
B7PLB3_IXOSC/91-248---------------------------------------------------------------------------EA-I.
B8CBK6_THAPS/255-410---------------------------------------------------------------------------ER-I.
B8P5W0_POSPM/106-259---------------------------------------------------------------------------DI-I.
C4LXC3_ENTHI/41-195---------------------------------------------------------------------------YE-I.
C5KFU4_PERM5/815-945---------------------------------------------------------------------------NR-FE
D0N306_PHYIT/11-164---------------------------------------------------------------------------ET-I.
D2VMD1_NAEGR/143-295---------------------------------------------------------------------------EA-I.
D8LUT8_BLAHO/28-155---------------------------------------------------------------------------LS-F.
D8RG53_SELML/71-224---------------------------------------------------------------------------DT-I.
D8T9J0_SELML/49-198---------------------------------------------------------------------------DV-I.
E1ZHR5_CHLVA/131-284---------------------------------------------------------------------------DT-I.
E3Q6X3_COLGM/216-369---------------------------------------------------------------------------EN-I.
E4XFS5_OIKDI/47-229---------------------------------------------------------------------------IE-LA
E4ZUC8_LEPMJ/159-315---------------------------------------------------------------------------NQ-I.
E5SIN8_TRISP/43-196---------------------------------------------------------------------------ES-I.
E6R3W2_CRYGW/91-244---------------------------------------------------------------------------DA-I.
E7F7S1_DANRE/56-209---------------------------------------------------------------------------ET-I.
E7LNC0_TRYCR/61-219---------------------------------------------------------------------------DS-I.
E9BHG6_LEIDB/113-280---------------------------------------------------------------------------DS-I.
E9CIT6_CAPO3/726-879---------------------------------------------------------------------------EQ-I.
F0W2J7_9STRA/129-282---------------------------------------------------------------------------ET-I.
F0XXV0_AURAN/11-165---------------------------------------------------------------------------ET-I.
F0ZAV4_DICPU/114-267---------------------------------------------------------------------------DL-I.
F1KR12_ASCSU/48-201---------------------------------------------------------------------------AK-I.
Q0CHB3_ASPTN/188-344---------------------------------------------------------------------------EQ-I.
Q6BQ71_DEBHA/64-218---------------------------------------------------------------------------ET-I.
RTOR1_ARATH/103-256---------------------------------------------------------------------------ET-I.

PF01650

VPEG_ARATH/59-330---------------------------------------------------------------------------DD.I-
A0CQC7_PARTE/19-285---------------------------------------------------------------------------DD.I-
A2FXM6_TRIVA/13-267---------------------------------------------------------------------------DD.I-
O24539_VICNA/53-325---------------------------------------------------------------------------DD.I-
HGLB_SCHMA/37-291---------------------------------------------------------------------------DD.I-
HGLB_SCHJA/31-285---------------------------------------------------------------------------DD.I-
VPE_VICSA/56-325---------------------------------------------------------------------------DD.I-
Q02SI3_PSEAB/341-579---------------------------------------------------------------------------RDHF-
Q08BI0_DANRE/27-278---------------------------------------------------------------------------DD.I-
Q0MYV8_EMIHU/33-301---------------------------------------------------------------------------DD.V-
Q22P32_TETTS/20-285---------------------------------------------------------------------------ND.V-
Q22P33_TETTS/20-285---------------------------------------------------------------------------ND.V-
Q2M438_PHYIN/25-298---------------------------------------------------------------------------DD.V-
Q2UVF3_HAECO/29-287---------------------------------------------------------------------------DD.I-
Q4K5F2_PSEF5/335-570---------------------------------------------------------------------------RDHL-
Q4RED0_TETNG/30-283---------------------------------------------------------------------------DD.L-
Q4UU48_XANC8/124-392---------------------------------------------------------------------------PDNL-
Q6EHZ7_TRIVA/12-258---------------------------------------------------------------------------DD.I-
Q6FEB2_ACIAD/229-477---------------------------------------------------------------------------PD..-
Q6L4R2_ORYSJ/41-319---------------------------------------------------------------------------DD.I-
Q6NYJ7_DANRE/32-288---------------------------------------------------------------------------DD.L-
Q6PRC7_IXORI/38-293---------------------------------------------------------------------------DD.I-
Q711M2_FASHE/21-278---------------------------------------------------------------------------ND.V-
Q84LM2_ORYSJ/62-334---------------------------------------------------------------------------DD.I-
Q852T1_TOBAC/49-320---------------------------------------------------------------------------DD.I-
Q86TV2_HUMAN/29-286---------------------------------------------------------------------------DD.I-
Q88QE3_PSEPK/400-640---------------------------------------------------------------------------RDHM-
Q8LGK2_ARATH/46-316---------------------------------------------------------------------------DD.I-
Q949L7_BETVU/51-321---------------------------------------------------------------------------DD.I-
Q9LLQ4_SESIN/54-326---------------------------------------------------------------------------DD.I-
Q9LWZ3_ORYSJ/41-304---------------------------------------------------------------------------DD.I-
Q9SBX2_MAIZE/45-317---------------------------------------------------------------------------DD.I-
Q9SMD0_SOLLC/39-316---------------------------------------------------------------------------DD.I-
Q9XG75_TOBAC/40-306---------------------------------------------------------------------------DD.I-

PF03415

Q8A866_BACTN/37-399---------------------------------------------------------------------------PK-LI
Q9WZB1_THEMA/121-462---------------------------------------------------------------------------DG-ML
Q8XM44_CLOPE/59-508---------------------------------------------------------------------------NS-AE
Q9X1S5_THEMA/586-937---------------------------------------------------------------------------DW-IY
Q9WYY6_THEMA/5-301---------------------------------------------------------------------------DT-LY
CLOS_CLOHI/60-510---------------------------------------------------------------------------NK-AN
Q8TIY6_METAC/66-593---------------------------------------------------------------------------ED-LR

PF12770

A0LJ53_SYNFM/581-921EAAAIRKAGA------------------DY...------------------------------------------..PLL
A0LQE8_SYNFM/635-947SLSWQVAG..------------------.....------------------------------------------....F
A0YK41_LYNSP/3523-3818YSDVKQARV.------------------.....------------------------------------------....L
A0YW51_LYNSP/1488-1787YVNLKNSKV.------------------.....------------------------------------------....L
A0YZ16_LYNSP/128-434YENLQRGEV.------------------.....------------------------------------------....L
A1BCK0_CHLPD/513-826SGVGCASGSL------------------.....------------------------------------------....L
A1BEL3_CHLPD/43-361SPAIKVHMPD------------------IETGP------------------------------------------LRILL
A1BEL6_CHLPD/46-364IPSIKTGVSD------------------IEPGP------------------------------------------LRILL
A3WDM2_9SPHN/678-1006EIAPSKATKA------------------Y....------------------------------------------....L
A4HBL7_LEIBR/1053-1432FAALSAVRVQ------------------QQDLH------------------------------------------REVVA
A8L4T6_FRASN/741-1051IAPGPARSGD------------------L....------------------------------------------...LL
A8YIK9_MICAE/645-974DKFASQQSP.------------------.....------------------------------------------....L
A9WBC0_CHLAA/673-929VPAGPSGPA.------------------.....------------------------------------------....L
A9WER9_CHLAA/54-394DSEQFALFEP------------------IDHHP------------------------------------------IRLLL
A9WF91_CHLAA/60-360TSNDVQPIRA------------------RSRNA------------------------------------------LRVLI
B0C874_ACAM1/207-507FAPIQGKQV.------------------.....------------------------------------------....L
B2IXC0_NOSP7/1396-1691YKDIKKSQV.------------------.....------------------------------------------....L
B2IZZ4_NOSP7/695-973NSIISKQKA.------------------.....------------------------------------------....L
B2JAK0_NOSP7/526-830RVSNVQLPDI------------------NNNET------------------------------------------QRNIF
B2JAM9_NOSP7/866-1190NETKNRNVAV------------------KK...------------------------------------------...LA
B3QB04_RHOPT/774-1131QLQPGKPNRG------------------D....------------------------------------------...LV
B4JKU3_DROGR/1402-1700RSRRDRGRPP------------------T....------------------------------------------...AL
B4VHH6_9CYAN/1150-1443YQRLTNPRI.------------------.....------------------------------------------....L
B4VJ14_9CYAN/646-949TPFPSHDNP.------------------.....------------------------------------------....V
B4VJ30_9CYAN/3784-4081YNNIQNAPV.------------------.....------------------------------------------....L
B4VLG1_9CYAN/97-405SLPPQPNPV.------------------LK...------------------------------------------..ILM
B4VLY5_9CYAN/1558-1850YRDINDFQV.------------------.....------------------------------------------....L
B4VPE9_9CYAN/1179-1471YVDVRDLQV.------------------.....------------------------------------------....L
B4VQD3_9CYAN/1443-1735YVDIRNVGV.------------------.....------------------------------------------....L
B4VQK8_9CYAN/1658-1953YANIKTMPV.------------------.....------------------------------------------....L
B4VTQ2_9CYAN/1746-2036FQSVQDSKV.------------------.....------------------------------------------....L
B4VXN8_9CYAN/1368-1663NPDIRLRPV.------------------.....------------------------------------------....L
B4VXQ8_9CYAN/1752-2046YNTIKNAQV.------------------.....------------------------------------------....L
B4VYA5_9CYAN/647-942YQPVKDAQI.------------------.....------------------------------------------....L
B4WMI9_9SYNE/695-1035TEQPPSQQPP------------------.....------------------------------------------....L
B6C3H2_9GAMM/45-361QHARGSEQSW------------------R....------------------------------------------...LV
B8G8X7_CHLAD/58-398DSEQFPLGDP------------------LEHRP------------------------------------------IRMLI
B8GD94_CHLAD/102-415RLKHTGPPPQ------------------PAPGS------------------------------------------GALRI
C3Z401_BRAFL/1278-1602QGHPQSRPSD------------------VL...------------------------------------------..PGL
F0SR63_PLABD/137-574NRVDGQASGL------------------.....------------------------------------------....L
P72963_SYNY3/155-456YKPLQPGNI.------------------.....------------------------------------------....L
P73032_SYNY3/1449-1747YAPLTGAQI.------------------.....------------------------------------------....L
P74108_SYNY3/591-904QNTAQRKPAP------------------NL...------------------------------------------...LA
Q01RE6_SOLUE/865-1136EAAISAASRM------------------.....------------------------------------------....L
Q024J7_SOLUE/541-814PDSHPAHRL.------------------.....------------------------------------------....L
Q025F1_SOLUE/607-877RSGGPAGREL------------------.....------------------------------------------....L
Q028B5_SOLUE/667-935PAHRASQPR.------------------.....------------------------------------------....L
Q02DA1_SOLUE/510-786VAGPVESGAR------------------A....------------------------------------------....L
Q10YT7_TRIEI/1003-1309STPRNTSPA.------------------.....------------------------------------------....V
Q10YU6_TRIEI/544-838PLLKQQIRV.------------------.....------------------------------------------....L
Q112V9_TRIEI/62-390KLSIKINQDE------------------QLK..------------------------------------------..IAL
Q113D1_TRIEI/130-430WQDITNPEDL------------------DNVNG------------------------------------------FINLE
Q113U8_TRIEI/3002-3297YRPLQGTQV.------------------.....------------------------------------------....L
Q115J8_TRIEI/1466-1777ERNNQEFQSL------------------.....------------------------------------------....F
Q117G6_TRIEI/881-1206TKARKTSPA.------------------.....------------------------------------------....L
Q119J2_TRIEI/1474-1770YLGLDGSQV.------------------.....------------------------------------------....L
Q16H64_AEDAE/1315-1614RTKTREPGLN------------------S....------------------------------------------...AL
Q2G6U6_NOVAD/692-1020KLAASTAPRN------------------Y....------------------------------------------....L
Q2S6G2_SALRD/540-844GDAASSSSDL------------------.....------------------------------------------....A
Q2W535_MAGSA/875-1218SSIPAAKGGY------------------.....------------------------------------------....L
Q38C46_TRYB2/1044-1397LAALSAKRVQ------------------QRCLF------------------------------------------QNLVL
Q3AQG5_CHLCH/44-362IPSVQKALPD------------------AAKGP------------------------------------------LRILL
Q4C5K3_CROWT/405-717KKSRQRKEPK------------------PL...------------------------------------------...FF
Q4S217_TETNG/1205-1537KPHQRRGGPF------------------VCSDG------------------------------------------GSMAA
Q55594_SYNY3/165-457PTDLSQARI.------------------.....------------------------------------------....L
Q5LLA3_SILPO/680-970VEKLSPRES.------------------LK...------------------------------------------..ILI
Q64CV3_9ARCH/59-374SDRGSKKKPE------------------PEDRP------------------------------------------LKILF
Q7NCT1_GLOVI/600-923QASSAPRSAP------------------.....------------------------------------------....L
Q7NF67_GLOVI/550-854.RPATLRHPP------------------.....------------------------------------------....L
Q7NFD7_GLOVI/666-979ERASDPREAP------------------.....------------------------------------------....L
Q7NIF7_GLOVI/691-997DLPVPPRQGP------------------.....------------------------------------------....L
Q7NJE3_GLOVI/660-988QAAPAPRSGP------------------.....------------------------------------------....L
Q7NLR0_GLOVI/653-961RSQPAAQSA.------------------.....------------------------------------------....L
Q7NVB0_CHRVO/67-386EIRRVTDDAV------------------SWPVH------------------------------------------PRILV
Q82I85_STRAW/1175-1481ARPAVAHSGA------------------A....------------------------------------------....L
Q82L10_STRAW/969-1256RAAPGRRRT.------------------.....------------------------------------------....L
Q8DGG5_THEEB/541-835.SRPVTANPP------------------.....------------------------------------------....L
Q8DH74_THEEB/570-891.QRGKPANPP------------------.....------------------------------------------....L
Q8DHI1_THEEB/67-394RISVQTDFVQ------------------LWRYP------------------------------------------WHDWT
Q8DIE5_THEEB/1127-1420YRSIQRERI.------------------.....------------------------------------------....L
Q8YZU5_NOSS1/56-340PLSSQVNRA.------------------.....------------------------------------------....L
TTC28_HUMAN/1390-1713KSHLRKNPP.------------------TYSSS------------------------------------------TSMAA

PF03568

Q75EJ0_ASHGO/1148-1552RREWWEERYS------------------LDKRM------------------------------------------CDLMR
ESPL1_HUMAN/1716-2069KREWWTGRLA------------------LDHRM------------------------------------------EVLIA
BIMB_EMENI/1605-2004KKEWWKNREA------------------LDRRM------------------------------------------ENLLQ
Q6V3V9_DROVI/167-544KAKYWKEVNA------------------FEEFL------------------------------------------KKLIA
Q6ZHH8_ORYSJ/451-870HVKWWSHRMK------------------LNNHL------------------------------------------DKMLK
Q6FTE1_CANGA/1147-1548VRNWWKRRYD------------------LDELL------------------------------------------GNLIE
Q8SRL6_ENCCU/365-731EQKVVSNRVF------------------TNLAL------------------------------------------KDEMS
Q7RB01_PLAYO/620-1007KNKMKNEKGK------------------RSRKS------------------------------------------....I
ESPL1_MOUSE/1712-2065KRVWWTGRLA------------------LDQRM------------------------------------------EALIT
Q6NR96_XENLA/1471-1824KKEWWEGRME------------------LDCRM------------------------------------------KALIR
ESP1_YEAST/1171-1571RKSWWTTRYD------------------LDKRM------------------------------------------QQLLN
Q6CQQ7_KLULA/1114-1517RKNWWDERYA------------------LNNRL------------------------------------------QTLLT
Q23491_CAEEL/745-1104FEECWDRRKI------------------VDCQM------------------------------------------KKCVE
Q6CCJ0_YARLI/1206-1588SEAWWAKRHE------------------LDARL------------------------------------------KQLLH
O82745_ARATH/1299-1653RGLWWKKRKK------------------LNHRL------------------------------------------GIFLR
CUT1_SCHPO/1379-1770KETWWKERRH------------------LDQCL------------------------------------------QQLLE
Q9VRN6_DROME/169-538KQKYWEELNG------------------FDTFQ------------------------------------------QKLLA
Q6V3V6_DROWI/170-538KRKYWVDLHE------------------FGKVL------------------------------------------EKLIA

PF01364

KGP83_PORGN/244-595TDLYYSAVD.------------------...............................................GDYFP
D1JG83_9ARCH/891-1295YRDYNIQLD.------------------...............................................DDDFL
A2U064_9FLAO/401-768TDDFFVMLDD------------------NEGTM.........................................STSHTV
Q7MTE2_PORGI/239-573SDQVYGQIVG------------------...............................................NDHYN
D3HWT0_9BACT/400-777DDGWFGLLDD------------------GEGTN........................................LEEADRL
Q5S3Q9_9FLAO/543-910SDEFFGMMDP------------------DEGRM.........................................TGTEGC
A9DMD5_9FLAO/555-923TDDFYGMMDP------------------DEGLL.........................................TISDRL
B0VGA8_CLOAI/228-563GDYPYTFLAG------------------...............................................NDYLG
B7B5I7_9PORP/382-753IDDYFGFLDD------------------ADNKK........................................SLQNKKL
B8FFM0_DESAA/254-600SDHFYADIS.------------------...............................................GDILP
A3U7G6_CROAH/540-908SDDYFGMIDP------------------NEGTF.........................................QNFDKL
D2QSX9_SPILD/414-786SDDYFGFMDS------------------HEGEWPE.....................................NQNGDYSL
A3HW99_9BACT/398-769TADNNFVVGL------------------DPS............................................QPLVP
B0VHP2_CLOAI/234-563SDPSYALLAG------------------...............................................NDNYY
A8ZUB1_DESOH/278-656SDLYYQCLDG------------------DFNFDGDEEWGE..........................RTDGEDGGDVDLMA
B0VIM2_CLOAI/182-528DDNYYTMLEG------------------...............................................DDYFP
Q2Z0E1_9BACT/643-1013TDVWFVGFDA------------------V..............................................NRYEP
B3QXR8_CHLT3/734-1131ADVWYAMVDG------------------LDESG.........................................QLDLLP
C2MCN4_9PORP/405-781TDDYFGLLTE------------------GLRGV........................................GVGAQPL
A4A325_9PLAN/24-399TDNYYADVD.------------------...............................................DDLLP
A7NR84_ROSCS/499-867CETCYAQLDG------------------ERPT...........................................DDRLP
Q11Q36_CYTH3/558-932SDDYFGFMDN------------------TEGYWDE.....................................TPLDDNTL
Q7MX16_PORGI/272-637SDYFFSCVSP------------------...............................................LDTVG
A0B5K7_METTP/796-1154YRDYRIEMD.------------------...............................................DDNYT
D0MH89_RHOM4/586-975SDDYFGLLDD------------------DEGLWPDY..................................GAGAYSTERL
A8UH97_9FLAO/539-910SDDFYAMLDS------------------NEGSM.........................................NNSDRM
B8KYL6_9GAMM/364-704SDNRLVSVEG------------------...............................................DDYLP
B8FIK5_DESAA/1139-1542ADLYYSDLDG------------------DWDANGNGVY...............................GEVDDDLDFAP
Q11US7_CYTH3/392-767GSDLMFSVD.------------------...............................................NKYAA
C6W101_DYAFD/326-680GSDIALATTK------------------G...............................................SRMP
A5FJM8_FLAJ1/544-914SDDFFGLMDS------------------NEGVV........................................AFPFGGI
Q7UG73_RHOBA/51-444TDLPYGDRD.------------------...............................................GDRVS
A3J247_9FLAO/540-919SDDFYGLMDD------------------GEGQM........................................LGSFDGI
A9WIM0_CHLAA/500-869CEVCFAQLDG------------------DDPTA.........................................ETLFQA
B0VHE7_CLOAI/227-554VDYQYTWLAG------------------...............................................NDNLG
C6VT06_DYAFD/394-758GSDILLVEGI------------------AGA............................................PVNAP
C6X3N8_FLAB3/546-921TDDYYTMTKP------------------QPVTSI.......................................SVASTLP
A0LQH1_SYNFM/790-1132SDARLADFAG------------------...............................................EDGLA
A1ZVJ9_9BACT/406-774SDDYFGFLEA------------------SEGEWTE.....................................TSLGDHTL
B0VHF1_CLOAI/214-595ADMYYACLDG------------------NWNTDGDSY................................WGEMYEADLTP
B0VIE7_CLOAI/193-598TDFFYSDLSS------------------NWDTDNDGKRGEY........................STGYMNEDYGIDFTP
C6W3P4_DYAFD/414-806GSDLLLIEGL------------------QGT............................................PRDVP
B2RGP6_PORG3/408-787TDDYFGLLDD------------------QPASV........................................NIGWRNY
D2QJ99_SPILD/409-770GSDGLLTAG.------------------...............................................PDGVP
A9B5Q8_HERA2/466-850CDTCFVQLDG------------------ANPL...........................................DDPMP
D2QFF3_SPILD/397-745GSDILLSAGL------------------GGF............................................PPNTP
B0VH03_CLOAI/589-939SDDYFGMFN.------------------...............................................TSYYP
D2R2P5_PIRSD/21-411SDNWFADLD.------------------...............................................DDSIP
C6W0Z3_DYAFD/393-758SDDYFGFMDE------------------AEGDWNE.....................................HATGDHTV
A3XQP5_LEEBM/552-929SDDFFGSLDP------------------EEGVIENNS.................................PAGSGGSDRL
C9RIY0_FIBSS/581-957TEDFFAVLDS------------------GEVVR........................................SGKTYDV
Q2PY26_9BACT/412-780TDDYLGFMDD------------------NEGIQ.........................................LTRKTL
Q26FX7_FLABB/537-909TDDFFTYMNP------------------NEGNV.........................................ATNNLM
B0VJT2_CLOAI/236-566TDYNYTFLAG------------------...............................................NDQLG
C6BTD6_DESAD/56-402SDYGYGG...------------------...............................................SDSAP
D2QE53_SPILD/328-1007TDFYYASVDG------------------SCYSVLGRYDFDPLASGRYG..........MFALNPVNKEEEPLLNSYKTTQ
A2BK55_HYPBU/159-551SDYYYSDPD.------------------...............................................YDNYL
B0VHP1_CLOAI/283-636TDLTYVRLQG------------------...............................................TDYMP
Q1Q1Y4_9BACT/620-970SDNWFVLVSG------------------...............................................NDILP
C7PNY3_CHIPD/396-764SDDFFGFLDD------------------ADDINDN.....................................GRV..NLL
Q6LFY5_PHOPR/224-617TDYEYTLVDG------------------...............................................DDKYS
B3QVL4_CHLT3/688-1063ADDFFGSVDG------------------DEIP...........................................DDMVP
A9B187_HERA2/552-907ADNRYVTVAG------------------...............................................NDTLP
B3C566_9BACE/537-910TDDYFGFLDD------------------GEGEN........................................LSD.AML
B0VJY1_CLOAI/655-1014SDPWYGCIVG------------------...............................................TDIVP
B8G4Y1_CHLAD/584-1054TDWYYADLTS------------------NWDTNGNGCLGDGIFGD................PAAQQRNGYTSDSRNVFNL
A1ZEG7_9BACT/410-775PSDVMYTAGF------------------NPI............................................SPQTP
B0VF22_CLOAI/223-583TDIYFSNLDG------------------NWNANQNQIW...............................GETNDNTDLIP
A0LKV0_SYNFM/924-1265SENRYADLN.------------------...............................................DDGVP
A8ZTD5_DESOH/257-648TDLYYATVDG------------------...............................................DDYFP
A9B8S0_HERA2/477-840CEACYGQLDG------------------ADPL...........................................SDLLP
C3JBB2_9PORP/421-799TDDYFGYLRD------------------GEDHL........................................TNGRKQL
C9SW40_VERA1/279-917TDFYYASLTS------------------WVVRTRPVRFGPVTFQMPYVYTPPHDWDAIGNGVYGQFRLDGSDIDGVNLQT
C9LI59_9BACT/509-899TDDYFGMLDD------------------GEGNS........................................MAQTDKL
B5ICF9_ACIB4/214-642TDAFYAQPNY------------------NSTY...........................................FSYEP
Y048_ARCFU/22-377TDFFYASPD.------------------...............................................YDLKP
A3I371_9BACT/360-725SDDYYALIDF------------------GQGMWEE.....................................TLAGDESL

PF11713

A0AED2_YEREN/2138-2301EENTAVQEAA------------------VTWAY-----------------------------------------------
A0KHZ7_AERHH/3609-3767EDDPVAAKAA------------------A....-----------------------------------------------
A1EPL5_VIBCL/3469-3627ENDPVVAKAA------------------A....-----------------------------------------------
A2PYQ6_CLOPF/575-753QGDKVSYEAA------------------I....-----------------------------------------------
A3UPN6_VIBSP/3781-3944ENDSSVSKAA------------------E....-----------------------------------------------
A4TI66_YERPP/771-929QDDSLSKRVG------------------E....-----------------------------------------------
A4TI66_YERPP/1083-1262ENNPTVNRAA------------------T....-----------------------------------------------
A5KV80_9GAMM/1072-1230ENDAIVAESA------------------S....-----------------------------------------------
A5L6I6_9GAMM/693-849ENDVAVSNSV------------------K....-----------------------------------------------
A5L6I6_9GAMM/1529-1710KEEKIIWDDV------------------A....-----------------------------------------------
A5L6I6_9GAMM/1908-2074DNSTTSRQSA------------------L....-----------------------------------------------
TOXA_CLODI/576-757QGDDISYEAT------------------C....-----------------------------------------------
TOXB_CLODI/574-755QGDKISYEAA------------------C....-----------------------------------------------
Q2KX68_BORA1/2483-2627GDDLQALQSA------------------E....-----------------------------------------------
Q2SAY5_HAHCH/1-160EPKDNLRSFG------------------R....-----------------------------------------------
Q46149_CLONO/581-762QGDDISYESA------------------V....-----------------------------------------------
Q46342_CLOSO/574-755QGDKISYEAS------------------C....-----------------------------------------------
Q7N1Z0_PHOLL/2456-2614EDDPIAARAA------------------A....-----------------------------------------------
Q7N726_PHOLL/2997-3151ENDPIVAKAA------------------L....-----------------------------------------------
Q7VV06_BORPE/2551-2702AQDDVATQAA------------------Q....-----------------------------------------------
Q7VV06_BORPE/2959-3112GTDAATARAA------------------A....-----------------------------------------------
Q7VV06_BORPE/3397-3549GSDALTETAA------------------R....-----------------------------------------------
Q7VV06_BORPE/3808-3959GSDTVTESAA------------------R....-----------------------------------------------

PF13900

B4E0H0_HUMAN/45-92--------------------------------------------------------------------------------
Q7Z4P3_HUMAN/54-101--------------------------------------------------------------------------------
Q6ZTF6_HUMAN/58-105--------------------------------------------------------------------------------
B9NCR3_POPTR/128-175--------------------------------------------------------------------------------
CN165_HUMAN/57-104--------------------------------------------------------------------------------
Q9P195_HUMAN/6-53--------------------------------------------------------------------------------
B3KRW9_HUMAN/44-91--------------------------------------------------------------------------------
Q6ZS53_HUMAN/79-126--------------------------------------------------------------------------------
Q6ZNG3_HUMAN/65-112--------------------------------------------------------------------------------
B7Z559_HUMAN/16-63--------------------------------------------------------------------------------
Q9BGW3_MACFA/24-71--------------------------------------------------------------------------------
Q6ZNU7_HUMAN/32-79--------------------------------------------------------------------------------
B9NCR2_POPTR/11-60--------------------------------------------------------------------------------
Q6ZNZ6_HUMAN/6-53--------------------------------------------------------------------------------
Q8N287_HUMAN/31-78--------------------------------------------------------------------------------
Q95KE1_MACFA/88-135--------------------------------------------------------------------------------
Q9UI48_HUMAN/14-61--------------------------------------------------------------------------------
Q9H5D5_HUMAN/64-111--------------------------------------------------------------------------------
Q9NR08_HUMAN/145-192--------------------------------------------------------------------------------
Q6ZSG7_HUMAN/16-63--------------------------------------------------------------------------------
B9NF68_POPTR/42-89--------------------------------------------------------------------------------
Q9P147_HUMAN/36-83--------------------------------------------------------------------------------
Q6ZQR8_HUMAN/34-81--------------------------------------------------------------------------------
C9JL81_HUMAN/280-327--------------------------------------------------------------------------------
Q96ID7_HUMAN/6-53--------------------------------------------------------------------------------
Q5T5H1_HUMAN/139-186--------------------------------------------------------------------------------
B7Z2Z5_HUMAN/303-350--------------------------------------------------------------------------------
C9JQS0_HUMAN/70-117--------------------------------------------------------------------------------
Q4R5J6_MACFA/21-68--------------------------------------------------------------------------------
Q9NX85_HUMAN/34-81--------------------------------------------------------------------------------
B4XZE4_HUMAN/24-71--------------------------------------------------------------------------------
Q6STG2_HUMAN/10-57--------------------------------------------------------------------------------
Q96LS9_HUMAN/23-70--------------------------------------------------------------------------------
Q6ZTX9_HUMAN/54-102--------------------------------------------------------------------------------
Q9P191_HUMAN/17-60--------------------------------------------------------------------------------

PF00656

Q7Q803_ANOGA/54-306RQVL.IYL.Q.....FE-----V-----RV...-----------------------------------------------
Q7QGM9_ANOGA/35-227KEFC.QHY.R.....CD-----R-----LD...-----------------------------------------------
Q7PV92_ANOGA/14-237STVL.QRI.G.....FE-----V-----RV...-----------------------------------------------
Q70VV0_PICAB/3-415YKCLVERY.G.....FE-----E-----ENIR.-----------------------------------------------
CASP4_MOUSE/132-369KGLL.EDL.G.....YD-----V-----VV...-----------------------------------------------
CASP5_HUMAN/193-430KRLL.QGL.G.....YT-----V-----VD...-----------------------------------------------
MCA1_KLULA/138-430FNFLTQRY.G.....YK-----A-----ED...-----------------------------------------------
MCA9_ARATH/10-321KETILSRF.G.....FK-----Q-----DD...-----------------------------------------------
MCA1_ARATH/80-362RHLLINKF.K.....FS-----P-----DS...-----------------------------------------------
MCA1_DEBHA/146-437SNFLNQHF.G.....YS-----Y-----DDMV.-----------------------------------------------
MCA7_ARATH/3-401HKCLVDRF.G.....FA-----E-----EDITV-----------------------------------------------
Q7Q1E0_ANOGA/62-291KETL.ELF.R.....FD-----V-----KV...-----------------------------------------------
Q89XE4_BRAJA/58-278SSTL.RKN.G.....FD-----V-----DM...-----------------------------------------------
Q6N5Q1_RHOPA/33-253AQTL.QAA.G.....FD-----V-----SG...-----------------------------------------------
Q9ZSP8_HEVBR/3-415YRCLVDRY.G.....FS-----E-----EDIT.-----------------------------------------------
Q89FZ4_BRAJA/32-256TELL.GNA.G.....FT-----V-----TT...-----------------------------------------------
Q6QN97_PIG/259-484RDTF.SSL.G.....YE-----V-----QY...-----------------------------------------------
Q7Q4X6_ANOGA/73-309TASL.KGL.D.....FE-----V-----HV...-----------------------------------------------
Q6E5N8_ICTPU/119-362KEVF.QWL.G.....FN-----V-----CV...-----------------------------------------------
Q6AKF4_DESPS/28-248SRTL.SAL.G.....FE-----T-----II...-----------------------------------------------
O42284_CHICK/42-279TKLL.EGL.G.....YN-----V-----EC...-----------------------------------------------
Q7QKT2_ANOGA/35-260QAVL.SHL.Q.....FD-----V-----RL...-----------------------------------------------
Q6N0T4_RHOPA/30-251ADDL.KRA.G.....FD-----A-----EL...-----------------------------------------------
Q9NHF9_DROME/56-302EATL.QGF.G.....FD-----V-----RT...-----------------------------------------------
Q89HT8_BRAJA/51-272AKFL.NSA.G.....FE-----V-----VA...-----------------------------------------------
Q87Z21_PSESM/2-225AELL.END.GNGDPNFS-----V-----IKL..-----------------------------------------------
CASP1_PIG/163-400KILL.EDL.G.....YS-----V-----DV...-----------------------------------------------
CASP3_XENLA/56-280HETF.TGL.G.....YE-----V-----MV...-----------------------------------------------
Q9I8J3_DANRE/238-473AKLF.SRM.H.....FQ-----I-----EV...-----------------------------------------------
Q9GV88_HYDVU/84-316CDLF.LKL.G.....FK-----I-----DR...-----------------------------------------------
MCA4_ARATH/3-416YKCLVERY.G.....FS-----E-----ENIT.-----------------------------------------------
CASP2_RAT/200-445VTLF.KLL.G.....YN-----V-----HV...-----------------------------------------------
Q9IB64_XENLA/261-494TRIF.NAR.G.....YI-----T-----EE...-----------------------------------------------
MCA2_ARATH/116-414KFMLMKRF.Q.....FP-----E-----SCIL.-----------------------------------------------
Q9Y1U6_PRIPA/173-413KNLFISKL.G.....YE-----V-----EV...-----------------------------------------------
CASPD_BOVIN/136-373KQLL.EGL.G.....YT-----V-----EV...-----------------------------------------------
CASPE_MOUSE/22-256ERMF.RYL.K.....FE-----S-----TM...-----------------------------------------------
MCA1_ASHGO/154-449KNFLISRY.G.....YR-----E-----ENMV.-----------------------------------------------
PCP_DICDI/188-405YCAL.LGC.S.....FH-----S-----DNI..-----------------------------------------------
Q8ITP2_BRAFL/151-396KVMF.EGL.G.....FS-----V-----EV...-----------------------------------------------
Q7WDK3_BORBR/552-800AREL.RERTRGLYRDVR-----I-----ELL..-----------------------------------------------
Q98UI8_DANRE/48-280MNVF.RKL.G.....YI-----V-----KV...-----------------------------------------------
ICE_DROME/94-328TRVL.KQL.D.....FE-----V-----TV...-----------------------------------------------
Q7PZJ9_ANOGA/20-250ETVL.QRL.K.....CD-----V-----RT...-----------------------------------------------
Q9NBW3_DROME/38-248RKTF.ESL.K.....CR-----V-----EV...-----------------------------------------------
MCA5_ARATH/3-408HKSLVDRF.G.....FS-----E-----RNIT.-----------------------------------------------
O88550_RAT/68-301FKCF.RSL.G.....FE-----V-----TV...-----------------------------------------------
Q9DDJ2_DANRE/174-400EWLL.RSL.G.....FA-----V-----MK...-----------------------------------------------
Q985X8_RHILO/35-256AQTL.QAA.G.....FD-----V-----VG...-----------------------------------------------
CASP1_SPOFR/61-293SKVL.KTL.G.....FK-----V-----TV...-----------------------------------------------
CASP1_FELCA/161-406RRLL.TDL.G.....YS-----V-----HI...-----------------------------------------------
Q9IB66_XENLA/58-298NRIL.TDL.G.....FD-----V-----QN...-----------------------------------------------
CFLAR_HUMAN/252-477RDTF.TSL.G.....YE-----V-----QK...-----------------------------------------------
CASP1_MOUSE/162-398KLLL.EDL.G.....YT-----V-----KV...-----------------------------------------------
CASP2_CHICK/171-416ELLF.KHL.G.....YQ-----V-----TV...-----------------------------------------------
CASP1_DROME/79-313KKAF.ENL.G.....FA-----V-----SV...-----------------------------------------------
Q9DDL2_DANRE/323-560TNLL.RQL.D.....FK-----V-----VS...-----------------------------------------------
MCA1_SCHPO/130-422SQLLIQRY.G.....YK-----Q-----EDMV.-----------------------------------------------
Q8JIS8_ORYLA/58-285WKSF.MKL.G.....YE-----I-----QM...-----------------------------------------------
Q89IK1_BRAJA/30-253ASSL.RRS.G.....FE-----V-----LQ...-----------------------------------------------
O93415_CHICK/57-299KRSL.TDL.G.....FE-----V-----RI...-----------------------------------------------
Q89MV1_BRAJA/176-400AETL.STL.G.....FT-----L-----VGG..-----------------------------------------------
Q8IEW1_9TRYP/63-322LQTL.QRI.E.....FP-----I-----SECC.-----------------------------------------------
Q98IJ9_RHILO/30-261ASTL.RNA.G.....FD-----V-----IE...-----------------------------------------------
Q9TZP5_CAEEL/26-261SKLF.ERL.G.....YQ-----S-----TS...-----------------------------------------------
Q7RFI8_PLAYO/964-1364SRALVKYF.N.....FL-----P-----ENIL.-----------------------------------------------
MCA1_YARLI/168-458QRYLVQRA.G.....YK-----P-----DDMV.-----------------------------------------------
MCA1_CANGA/98-389FNYLTTYC.G.....YR-----P-----EDIV.-----------------------------------------------
Q8I6Y2_GEOCY/158-414YGLF.NWL.G.....MA-----T-----IR...-----------------------------------------------
Q98IJ6_RHILO/11-238AERL.QNL.G.....FE-----V-----VS...-----------------------------------------------
CASP1_HUMAN/163-400TMLL.QNL.G.....YS-----V-----DV...-----------------------------------------------
Q9I9L7_DANRE/145-379EKLL.KEL.D.....YQ-----V-----VK...-----------------------------------------------
Q8YS65_NOSS1/4-245QQFLIKEA.G.....FD-----Q-----VIL..-----------------------------------------------
Q8ITP3_BRAFL/87-323YRIF.SKL.G.....FE-----T-----KV...-----------------------------------------------
Q98G71_RHILO/26-252ADKL.RSI.G.....FE-----V-----IE...-----------------------------------------------
Q74F93_GEOSL/6-270AAIA.AER.G.....FA-----V-----TTL..-----------------------------------------------
CFLAR_MOUSE/257-481QETF.TSL.G.....YH-----I-----QL...-----------------------------------------------
MCA6_ARATH/3-366RISLVERY.G.....FS-----E-----ENIK.-----------------------------------------------
Q8T8E8_9TRYP/84-341AGTM.EKI.G.....IP-----I-----TERCV-----------------------------------------------
CAS1A_XENLA/144-382TKLL.NEL.G.....YQ-----V-----HP...-----------------------------------------------
CED3_CAEEL/243-494TNLF.RCM.G.....YT-----V-----IC...-----------------------------------------------
Q53839_STRCH/9-268AEFFTSPQ.G.....WG-----L-----PPEHC-----------------------------------------------
Q6DCI2_XENLA/78-314LRCF.KGL.G.....FD-----V-----NV...-----------------------------------------------
B5VS82_YEAS6/157-450FNFLTNGY.G.....YS-----S-----DDIV.-----------------------------------------------
Q6N329_RHOPA/73-298AALL.GEA.G.....FE-----V-----TE...-----------------------------------------------
Q6NTR7_XENLA/280-494ENTF.KSL.R.....FT-----V-----RT...-----------------------------------------------
Q7NPG1_GLOVI/7-278IEVL.KSP.S.....YG-----L-----RT...-----------------------------------------------
CASP8_HUMAN/234-476TTTF.EEL.H.....FE-----I-----KP...-----------------------------------------------
Q98CE0_RHILO/5-238EAAL.KKL.G.....FE-----V-----IL...-----------------------------------------------
Q82I86_STRAW/5-276ARLV.TELVGERADLLF-----L-----RD...-----------------------------------------------
CASP1_CANFA/163-400ESLL.EGL.G.....YS-----V-----VV...-----------------------------------------------
Q9I8S9_ONCMY/57-297VKRF.EDL.N.....FE-----V-----QA...-----------------------------------------------
CASP9_HUMAN/161-413RRRF.SSL.H.....FM-----V-----EV...-----------------------------------------------
CASP6_MOUSE/28-270TRRF.SDL.G.....FE-----V-----KC...-----------------------------------------------
Q8T8E6_9TRYP/84-343LATL.QKK.G.....LP-----I-----NEAV.-----------------------------------------------
Q6NBN5_RHOPA/57-277SASL.RHE.G.....YD-----V-----DM...-----------------------------------------------
Q9IB63_XENLA/144-396ANRM.RSF.H.....FE-----V-----TV...-----------------------------------------------
Q89XG2_BRAJA/27-248ADEL.KRD.G.....FS-----V-----EI...-----------------------------------------------
Q90WU1_CHICK/237-479RKVF.SNL.H.....FT-----V-----AE...-----------------------------------------------
Q9GV89_HYDVU/93-318NSFFKGTL.G.....WC-----V-----KS...-----------------------------------------------
Q6PAD9_XENLA/268-495RDVF.KWL.G.....LD-----V-----EI...-----------------------------------------------
ICENC_DROME/196-443IHLF.QEL.N.....FT-----I-----FP...-----------------------------------------------
Q98JS7_RHILO/35-253ANTL.TEL.K.....FD-----V-----LL...-----------------------------------------------
CASP8_MOUSE/236-478SKTF.KEL.H.....FE-----I-----VS...-----------------------------------------------
Q89KP2_BRAJA/86-307AQTL.QAA.G.....FD-----V-----VG...-----------------------------------------------
Q86FL0_ANOST/52-286GAVL.ESI.G.....FD-----V-----RV...-----------------------------------------------
P74453_SYNY3/40-299GEVLTGRY.G.....FD-----Q-----AKI..-----------------------------------------------
CASPC_MOUSE/176-415QELL.ENL.G.....YS-----V-----VL...-----------------------------------------------
MCA8_ARATH/3-378QKCLIELY.G.....FA-----N-----KDIV.-----------------------------------------------
Q8JG42_TAKRU/51-279MKVF.LSL.G.....YK-----V-----KV...-----------------------------------------------
Q90WU0_CHICK/148-400EKRF.RSL.C.....FH-----V-----RT...-----------------------------------------------
Q89HP3_BRAJA/336-569AKSL.RDI.G.....FT-----V-----SE...-----------------------------------------------
Q8I749_SUBDO/254-491TQTF.KYL.R.....YK-----V-----EV...-----------------------------------------------
O93417_CHICK/53-281REVF.MKL.G.....YK-----V-----KL...-----------------------------------------------
CASPE_HUMAN/18-241EHMF.RQL.R.....FE-----S-----TM...-----------------------------------------------

PF14538

A2DJF0_TRIVA/81-229TVEAVRTLQG-----FF-----P-----SQYFK-----------------------------------------------
A2DYB3_TRIVA/11-163RAAIQ.....-----..-----.-----.....-----------------------------------------------
A2DYM2_TRIVA/66-217SSYVQEYFHD-----..-----.-----KYVSI-----------------------------------------------
A2E336_TRIVA/52-203LKEINAGFSD-----IF-----P-----RHS..-----------------------------------------------
A2EZ34_TRIVA/86-237SAYLQDYMHE-----..-----.-----KYSNY-----------------------------------------------
A2F8U1_TRIVA/62-211AKAIVTQYQQ-----CM-----P-----K....-----------------------------------------------
A2F9H3_TRIVA/30-182NNAIK.....-----..-----.-----.....-----------------------------------------------
A2FJN8_TRIVA/40-192MNSLK.....-----..-----.-----.....-----------------------------------------------
A2G2E2_TRIVA/83-230DVDYRNQLVA-----YI-----R-----SEIKK-----------------------------------------------
A2G590_TRIVA/29-181SASMK.....-----..-----.-----.....-----------------------------------------------
A2GCD5_TRIVA/96-248PTTIQTYFKN-----..-----.-----TYHQI-----------------------------------------------
A8Q911_MALGO/109-262GRNLQVQFET-----L.-----.-----SMK..-----------------------------------------------
A9TBL2_PHYPA/90-243AKNLQTQYER-----W.-----.-----QPR..-----------------------------------------------
A9V5A2_MONBE/627-778SQRLTSQYLR-----W.-----.-----QPK..-----------------------------------------------
B0CNS4_LACBS/33-186GNNLQHQFEG-----L.-----.-----SLK..-----------------------------------------------
B0ENS2_ENTDS/37-190AANLTDQYRS-----W.-----.-----QNG..-----------------------------------------------
B0WBU4_CULQU/24-183LRSERRHFQS-----F.-----D-----REHSH-----------------------------------------------
B0WR30_CULQU/146-268DGALQQQYTE-----V.-----.-----NLN..-----------------------------------------------
B3RPQ9_TRIAD/42-195GNSLQKQYER-----W.-----.-----QPK..-----------------------------------------------
B4R5C8_DROSI/213-366GSNLQMQYER-----W.-----.-----QPR..-----------------------------------------------
B6JY50_SCHJY/122-275GKNLQQQYET-----L.-----.-----SMR..-----------------------------------------------
B7PLB3_IXOSC/91-248GAALQKQYER-----W.-----.-----QSR..-----------------------------------------------
B8CBK6_THAPS/255-410GERLEQQYAK-----W.-----.-----QQRS.-----------------------------------------------
B8P5W0_POSPM/106-259GTNLAHQFEG-----L.-----.-----SPK..-----------------------------------------------
C4LXC3_ENTHI/41-195TNQLGIQYQR-----Y.-----C-----TPT..-----------------------------------------------
C5KFU4_PERM5/815-945NAPMPAQL..-----..-----.-----.....-----------------------------------------------
D0N306_PHYIT/11-164GNTLQSQYER-----W.-----.-----QPR..-----------------------------------------------
D2VMD1_NAEGR/143-295GSNLKLQYER-----W.-----.-----QPR..-----------------------------------------------
D8LUT8_BLAHO/28-155LFSTHTQYQ.-----..-----.-----.....-----------------------------------------------
D8RG53_SELML/71-224GKNLQSQYAL-----W.-----.-----QPR..-----------------------------------------------
D8T9J0_SELML/49-198GQTLQSQYKR-----W.-----.-----QPK..-----------------------------------------------
E1ZHR5_CHLVA/131-284GKNLQAQYER-----W.-----.-----QPR..-----------------------------------------------
E3Q6X3_COLGM/216-369GKALQAQYET-----L.-----.-----AIR..-----------------------------------------------
E4XFS5_OIKDI/47-229PRVLQTNTFN-----W.-----K-----QLHH.-----------------------------------------------
E4ZUC8_LEPMJ/159-315GKALQTQYEQ-----L.-----.-----SMR..-----------------------------------------------
E5SIN8_TRISP/43-196GTALQRQYQW-----W.-----.-----QPR..-----------------------------------------------
E6R3W2_CRYGW/91-244GRNLHQQFET-----L.-----.-----NPK..-----------------------------------------------
E7F7S1_DANRE/56-209GANLQKQYEN-----W.-----.-----QPR..-----------------------------------------------
E7LNC0_TRYCR/61-219AEILERQYRS-----Q.-----Q-----RDA..-----------------------------------------------
E9BHG6_LEIDB/113-280AETLERQYRS-----V.-----L-----RDD..-----------------------------------------------
E9CIT6_CAPO3/726-879GLRLEQQYSR-----W.-----.-----QNK..-----------------------------------------------
F0W2J7_9STRA/129-282GKTLQSQYER-----W.-----.-----QPR..-----------------------------------------------
F0XXV0_AURAN/11-165GAALQAQYER-----W.-----.-----QSR..-----------------------------------------------
F0ZAV4_DICPU/114-267GKTLQAQYEK-----W.-----.-----QSK..-----------------------------------------------
F1KR12_ASCSU/48-201ASALQKNYER-----W.-----.-----QPR..-----------------------------------------------
Q0CHB3_ASPTN/188-344GKKLQEQYET-----L.-----.-----SLR..-----------------------------------------------
Q6BQ71_DEBHA/64-218GKNLQSQYET-----L.-----.-----SLR..-----------------------------------------------
RTOR1_ARATH/103-256GKNLSTQYER-----W.-----.-----QPR..-----------------------------------------------

PF01650

VPEG_ARATH/59-330ANNYENPRPGTIINSPH.....G.....KDVYQ-----------------------------------------------
A0CQC7_PARTE/19-285AQNRQNIYKGAIYNQPNEDG.FS.....ENVYD-----------------------------------------------
A2FXM6_TRIVA/13-267VNDAENPFKGQIFRSLD.....H.....LNVYP-----------------------------------------------
O24539_VICNA/53-325AYNEMNPRPGVIINHPQ.....G.....PNVYD-----------------------------------------------
HGLB_SCHMA/37-291AYNLMNPFPGKLFNDYN.....H.....KDWYE-----------------------------------------------
HGLB_SCHJA/31-285AHNKENPFPGKIFNDYR.....H.....KDYYK-----------------------------------------------
VPE_VICSA/56-325ASNEENPRPGVIINKPD.....G.....DDVYA-----------------------------------------------
Q02SI3_PSEAB/341-579GDR...PLAT............R.....ESLSR-----------------------------------------------
Q08BI0_DANRE/27-278ANNPNNPFPGSIRSVVD.....Q.....TNVYK-----------------------------------------------
Q0MYV8_EMIHU/33-301ANDDMNPFPGKLFNKPTGDGTPG.....TDVYA-----------------------------------------------
Q22P32_TETTS/20-285AFDKSNPFKGKLFNKPL.....G.....DDVYE-----------------------------------------------
Q22P33_TETTS/20-285ANNKQNPFKGKLFNQPN.....G.....QDVYA-----------------------------------------------
Q2M438_PHYIN/25-298AWHESNPYRGQLYNKPTTKNASHGAVQPVDVYK-----------------------------------------------
Q2UVF3_HAECO/29-287ANHERNPYKGKIFNDPS.....L.....TDVYE-----------------------------------------------
Q4K5F2_PSEF5/335-570MNR...PMAT............R.....ENLRR-----------------------------------------------
Q4RED0_TETNG/30-283AENRMNPTPGKLINRPS.....G.....SDVYK-----------------------------------------------
Q4UU48_XANC8/124-392GERPYAPLAT............Y.....DNLYD-----------------------------------------------
Q6EHZ7_TRIVA/12-258ALSSENPFRGKVFHTLK.....H.....VNIYP-----------------------------------------------
Q6FEB2_ACIAD/229-477.TRTQIPIAS............R.....TSIAM-----------------------------------------------
Q6L4R2_ORYSJ/41-319AHNPDNPRPGLIFNHPS.....G.....PDVYA-----------------------------------------------
Q6NYJ7_DANRE/32-288AESPDNPTKGVVINRPN.....G.....SDVYK-----------------------------------------------
Q6PRC7_IXORI/38-293AHDPSNPTPGIIINHLN.....G.....SNVYA-----------------------------------------------
Q711M2_FASHE/21-278AYSRQNPYRGKIFHDYK.....H.....KDVYE-----------------------------------------------
Q84LM2_ORYSJ/62-334AHNILNPRPGTIINHPK.....G.....GDVYA-----------------------------------------------
Q852T1_TOBAC/49-320AHNFENPRPGVIINSPN.....G.....DDVYK-----------------------------------------------
Q86TV2_HUMAN/29-286AYSEDNPTPGIVINRPN.....G.....TDVYQ-----------------------------------------------
Q88QE3_PSEPK/400-640ATR...PMAT............R.....ENLSR-----------------------------------------------
Q8LGK2_ARATH/46-316AFSSENPRPGVIINKPD.....G.....EDVYK-----------------------------------------------
Q949L7_BETVU/51-321AYDEENPRPGVLINSPY.....G.....HDVYA-----------------------------------------------
Q9LLQ4_SESIN/54-326AMNELNPRKGVIINHPT.....G.....GDVYA-----------------------------------------------
Q9LWZ3_ORYSJ/41-304AYNPENPHKGVIINKPN.....G.....PNVYA-----------------------------------------------
Q9SBX2_MAIZE/45-317AHSPENPRPGVIINHPQ.....G.....GDVYA-----------------------------------------------
Q9SMD0_SOLLC/39-316ANNPENPRPGVIINNPH.....G.....HDVYK-----------------------------------------------
Q9XG75_TOBAC/40-306AYNKNNPRPGIIINSPH.....G.....HDVYK-----------------------------------------------

PF03415

Q8A866_BACTN/37-399RLRKDKDVVV------------------QDVIA-----------------------------------------------
Q9WZB1_THEMA/121-462VLDESGNF..------------------QAVVG-----------------------------------------------
Q8XM44_CLOPE/59-508RISGKSEF..------------------PEITT-----------------------------------------------
Q9X1S5_THEMA/586-937VLNEEGEW..------------------EG..G-----------------------------------------------
Q9WYY6_THEMA/5-301RVEE......------------------GLIPL-----------------------------------------------
CLOS_CLOHI/60-510RLDGKNEF..------------------PEIST-----------------------------------------------
Q8TIY6_METAC/66-593KDSEDGVIGN------------------EEIHR-----------------------------------------------

PF12770

A0LJ53_SYNFM/581-921V--FANPSYP......TAPIPHGMTVPLSKRTDAG.............................................
A0LQE8_SYNFM/635-947G--VADKVSD......HF..............................................................
A0YK41_LYNSP/3523-3818A--MGSTEFPA...DSRL..............................................................
A0YW51_LYNSP/1488-1787A--MGASKFSD....PAQ..............................................................
A0YZ16_LYNSP/128-434A--MGVSEFA......EQ..............................................................
A1BCK0_CHLPD/513-826L--VANPC........................................................................
A1BEL3_CHLPD/43-361F--SSLPDDLDE..TDQ...............................................................
A1BEL6_CHLPD/46-364F--SSLPDNLGE..KNQ...............................................................
A3WDM2_9SPHN/678-1006G--LGSNALP......TGREP...........................................................
A4HBL7_LEIBR/1053-1432V--QGDADHD......AAD.............................................................
A8L4T6_FRASN/741-1051A--VADPASS......GA..............................................................
A8YIK9_MICAE/645-974I--VADPFYG......KAGEKVA.........................................................
A9WBC0_CHLAA/673-929V--IGASAD.......................................................................
A9WER9_CHLAA/54-394I--FSEPTDL......DR..............................................................
A9WF91_CHLAA/60-360A--IANPHGI......................................................................
B0C874_ACAM1/207-507G--MGITQEV.....EGQ..............................................................
B2IXC0_NOSP7/1396-1691A--MGVSQST.....QGQ..............................................................
B2IZZ4_NOSP7/695-973V--VGVSNGNK....QF...............................................................
B2JAK0_NOSP7/526-830L--IGNPLFS......NPYTV...........................................................
B2JAM9_NOSP7/866-1190V--LADPVFS......KDDDRLKPDVTQSVQNRG..............................................
B3QB04_RHOPT/774-1131A--FGDPYFN......TEQAAEAATVKVADAASNAAAE..........................................
B4JKU3_DROGR/1402-1700V--VGGPRVP.......A..............................................................
B4VHH6_9CYAN/1150-1443A--MGASEFT......EL..............................................................
B4VJ14_9CYAN/646-949L--IADPYFQ......RPGEFVA.........................................................
B4VJ30_9CYAN/3784-4081A--MGVAESSSLAKELNL..............................................................
B4VLG1_9CYAN/97-405V--IAGPSDQ......ES..............................................................
B4VLY5_9CYAN/1558-1850A--MGASEFT......DA..............................................................
B4VPE9_9CYAN/1179-1471A--MGASEFT......EQ..............................................................
B4VQD3_9CYAN/1443-1735A--MGADTFQ......DL..............................................................
B4VQK8_9CYAN/1658-1953A--MGASDFPD...NPLL..............................................................
B4VTQ2_9CYAN/1746-2036A--MGAAQFS......DQ..............................................................
B4VXN8_9CYAN/1368-1663A--MGASKFL......DL..............................................................
B4VXQ8_9CYAN/1752-2046A--MGASKFE......DL..............................................................
B4VYA5_9CYAN/647-942A--MGATEFA......DL..............................................................
B4WMI9_9SYNE/695-1035I--LANPDYA......SASKPQNSLEQ.....................................................
B6C3H2_9GAMM/45-361A--LENPRND......................................................................
B8G8X7_CHLAD/58-398V--LSEPSDL......NR..............................................................
B8GD94_CHLAD/102-415L--ALSPQ........................................................................
C3Z401_BRAFL/1278-1602V--LGNPKLP.......P..............................................................
F0SR63_PLABD/137-574A--VGDPKFR......VDDASPPESVAGVRVNKVVEGSVAESAGVKPGDVIVAIDGRRLESPEELLSAVQSIAGKDRPAA
P72963_SYNY3/155-456A--MGASEFA......DQ..............................................................
P73032_SYNY3/1449-1747A--MGAEEFA......NQ..............................................................
P74108_SYNY3/591-904V--FADPVFT......SSDERLGTAIARR...................................................
Q01RE6_SOLUE/865-1136V--VSAPAAG......AR..............................................................
Q024J7_SOLUE/541-814L--LGDPITN......DP..............................................................
Q025F1_SOLUE/607-877A--MGNPGA.......................................................................
Q028B5_SOLUE/667-935M--AVDA.........................................................................
Q02DA1_SOLUE/510-786V--VADPTLG......RE..............................................................
Q10YT7_TRIEI/1003-1309L--LGYPTYS......EKDQVTI.........................................................
Q10YU6_TRIEI/544-838T--TGTDKEAPSYRQRGY..............................................................
Q112V9_TRIEI/62-390V--VSKPTAD......................................................................
Q113D1_TRIEI/130-430V--TEKKCCG......KI..............................................................
Q113U8_TRIEI/3002-3297A--MGASEFI......AK..............................................................
Q115J8_TRIEI/1466-1777A--IQTPT........................................................................
Q117G6_TRIEI/881-1206L--LGDPNYE......KKDKIAT.........................................................
Q119J2_TRIEI/1474-1770A--MGASKFSP...NTNE..............................................................
Q16H64_AEDAE/1315-1614V--VGGPKIP.......S..............................................................
Q2G6U6_NOVAD/692-1020G--LGHNAKP......AARPVT..........................................................
Q2S6G2_SALRD/540-844A--FGVSSFD......SLRPPPPSL.......................................................
Q2W535_MAGSA/875-1218I--NAGPDYN......TEEVTGKATLEKARSR................................................
Q38C46_TRYB2/1044-1397V--QKQADAT......EQ..............................................................
Q3AQG5_CHLCH/44-362F--SSLPDDLTE..KEQ...............................................................
Q4C5K3_CROWT/405-717G--IQNPT........................................................................
Q4S217_TETNG/1205-1537V--IGAPRLP.......P..............................................................
Q55594_SYNY3/165-457A--MGSSEFT......DA..............................................................
Q5LLA3_SILPO/680-970A--TSEPRDQ......RR..............................................................
Q64CV3_9ARCH/59-374M--ACSPLDT......................................................................
Q7NCT1_GLOVI/600-923V--LGGPDFA......RAAAGLSPATQQRAGP................................................
Q7NF67_GLOVI/550-854L--IANPDFD......RADAVVDRLAA.....................................................
Q7NFD7_GLOVI/666-979V--VAGPDYG......RSPAALQAPS......................................................
Q7NIF7_GLOVI/691-997L--VAAPDFD......NAGPPAVNAAH.....................................................
Q7NJE3_GLOVI/660-988V--LGGPDFA......RAAAGPPLASRPAAERRAT.............................................
Q7NLR0_GLOVI/653-961I--VANPNFD......NAEVARTRSAGE....................................................
Q7NVB0_CHRVO/67-386V--LASP.........................................................................
Q82I85_STRAW/1175-1481V--VGNPT........................................................................
Q82L10_STRAW/969-1256A--VAMPQTA......GQ..............................................................
Q8DGG5_THEEB/541-835I--IADPSFD......RSSTM...........................................................
Q8DH74_THEEB/570-891V--VGNPTFS......QGSGRALAGS......................................................
Q8DHI1_THEEB/67-394P--IRQHSNL.......D..............................................................
Q8DIE5_THEEB/1127-1420A--MGASEFL......DQ..............................................................
Q8YZU5_NOSS1/56-340V--LALSQES......................................................................
TTC28_HUMAN/1390-1713V--IGNPKLP.......S..............................................................

PF03568

Q75EJ0_ASHGO/1148-1552R--IEDSWIC----------------------------------------------------------------------
ESPL1_HUMAN/1716-2069S--LEKSVLG----------------------------------------------------------------------
BIMB_EMENI/1605-2004N--IENVWFG----------------------------------------------------------------------
Q6V3V9_DROVI/167-544D--LGS.VFS----------------------------------------------------------------------
Q6ZHH8_ORYSJ/451-870D--MEESWLG----------------------------------------------------------------------
Q6FTE1_CANGA/1147-1548R--IEKTWLN----------------------------------------------------------------------
Q8SRL6_ENCCU/365-731N--LRE....----------------------------------------------------------------------
Q7RB01_PLAYO/620-1007S--IEYSFLN----------------------------------------------------------------------
ESPL1_MOUSE/1712-2065A--LEEQVLG----------------------------------------------------------------------
Q6NR96_XENLA/1471-1824L--LEEQVLG----------------------------------------------------------------------
ESP1_YEAST/1171-1571N--IENSWFN----------------------------------------------------------------------
Q6CQQ7_KLULA/1114-1517K--IEDSWFC----------------------------------------------------------------------
Q23491_CAEEL/745-1104N--TQKHFLG----------------------------------------------------------------------
Q6CCJ0_YARLI/1206-1588D--AEFCWFG----------------------------------------------------------------------
O82745_ARATH/1299-1653N--LEASWLG----------------------------------------------------------------------
CUT1_SCHPO/1379-1770N--IEISWLG----------------------------------------------------------------------
Q9VRN6_DROME/169-538D--FRD.IIS----------------------------------------------------------------------
Q6V3V6_DROWI/170-538D--LRE.IIL----------------------------------------------------------------------

PF01364

KGP83_PORGN/244-595E..MYTFRMS----------------------------------------------------------------------
D1JG83_9ARCH/891-1295E..VATGRII----------------------------------------------------------------------
A2U064_9FLAO/401-768D..VASSRIP----------------------------------------------------------------------
Q7MTE2_PORGI/239-573E..VFIGRFS----------------------------------------------------------------------
D3HWT0_9BACT/400-777D..IGVGRFP----------------------------------------------------------------------
Q5S3Q9_9FLAO/543-910D..IAVGRIL----------------------------------------------------------------------
A9DMD5_9FLAO/555-923D..IALGRML----------------------------------------------------------------------
B0VGA8_CLOAI/228-563D..AFIGRIS----------------------------------------------------------------------
B7B5I7_9PORP/382-753C..LGIGRFP----------------------------------------------------------------------
B8FFM0_DESAA/254-600E..LLVGRFP----------------------------------------------------------------------
A3U7G6_CROAH/540-908D..IAIGRIL----------------------------------------------------------------------
D2QSX9_SPILD/414-786D..VGIGRIP----------------------------------------------------------------------
A3HW99_9BACT/398-769A..MAVGRIP----------------------------------------------------------------------
B0VHP2_CLOAI/234-563D..IFVGRFS----------------------------------------------------------------------
A8ZUB1_DESOH/278-656E..IFVGRAS----------------------------------------------------------------------
B0VIM2_CLOAI/182-528E..MIAGRFS----------------------------------------------------------------------
Q2Z0E1_9BACT/643-1013G..MALGRLT----------------------------------------------------------------------
B3QXR8_CHLT3/734-1131D..MQISRVP----------------------------------------------------------------------
C2MCN4_9PORP/405-781S..VGIGRLP----------------------------------------------------------------------
A4A325_9PLAN/24-399D..VAIGRLS----------------------------------------------------------------------
A7NR84_ROSCS/499-867D..VWLGRLP----------------------------------------------------------------------
Q11Q36_CYTH3/558-932N..IGVGRLP----------------------------------------------------------------------
Q7MX16_PORGI/272-637D..LFIGRFS----------------------------------------------------------------------
A0B5K7_METTP/796-1154E..VATGRFI----------------------------------------------------------------------
D0MH89_RHOM4/586-975D..LGIGRLP----------------------------------------------------------------------
A8UH97_9FLAO/539-910D..IAVGRIL----------------------------------------------------------------------
B8KYL6_9GAMM/364-704D..LAVGRLP----------------------------------------------------------------------
B8FIK5_DESAA/1139-1542D..VFVGRIP----------------------------------------------------------------------
Q11US7_CYTH3/392-767Q..IHTGRVP----------------------------------------------------------------------
C6W101_DYAFD/326-680L..VPIGRIN----------------------------------------------------------------------
A5FJM8_FLAJ1/544-914D..IAVGRML----------------------------------------------------------------------
Q7UG73_RHOBA/51-444D..AAIGRLP----------------------------------------------------------------------
A3J247_9FLAO/540-919D..IAVGRML----------------------------------------------------------------------
A9WIM0_CHLAA/500-869D..LWIGRLP----------------------------------------------------------------------
B0VHE7_CLOAI/227-554D..VMIGRIS----------------------------------------------------------------------
C6VT06_DYAFD/394-758A..IPVGRLS----------------------------------------------------------------------
C6X3N8_FLAB3/546-921D..FPVGRLP----------------------------------------------------------------------
A0LQH1_SYNFM/790-1132D..VALGRIP----------------------------------------------------------------------
A1ZVJ9_9BACT/406-774E..IGIGRLP----------------------------------------------------------------------
B0VHF1_CLOAI/214-595E..LAIGRFC----------------------------------------------------------------------
B0VIE7_CLOAI/193-598E..VFVGRIS----------------------------------------------------------------------
C6W3P4_DYAFD/414-806A..IPVGRIP----------------------------------------------------------------------
B2RGP6_PORG3/408-787N..MAVGRFP----------------------------------------------------------------------
D2QJ99_SPILD/409-770A..IPTGRIN----------------------------------------------------------------------
A9B5Q8_HERA2/466-850D..LQIGRLP----------------------------------------------------------------------
D2QFF3_SPILD/397-745A..IPTGRIN----------------------------------------------------------------------
B0VH03_CLOAI/589-939E..LAIGRYP----------------------------------------------------------------------
D2R2P5_PIRSD/21-411D..LAIGRLP----------------------------------------------------------------------
C6W0Z3_DYAFD/393-758D..IGVGRLP----------------------------------------------------------------------
A3XQP5_LEEBM/552-929D..IAVGRIL----------------------------------------------------------------------
C9RIY0_FIBSS/581-957D..LALGRLP----------------------------------------------------------------------
Q2PY26_9BACT/412-780D..LCIGRMT----------------------------------------------------------------------
Q26FX7_FLABB/537-909D..LAVGRMI----------------------------------------------------------------------
B0VJT2_CLOAI/236-566D..CFIGRIS----------------------------------------------------------------------
C6BTD6_DESAD/56-402ENMLPVGRIP----------------------------------------------------------------------
D2QE53_SPILD/328-1007D..IWVGRAP----------------------------------------------------------------------
A2BK55_HYPBU/159-551E..LAVGRIP----------------------------------------------------------------------
B0VHP1_CLOAI/283-636E..MYFGRFS----------------------------------------------------------------------
Q1Q1Y4_9BACT/620-970D..MHIGRLC----------------------------------------------------------------------
C7PNY3_CHIPD/396-764D..VAIGRLP----------------------------------------------------------------------
Q6LFY5_PHOPR/224-617D..VVIGRLP----------------------------------------------------------------------
B3QVL4_CHLT3/688-1063D..IAVGRLT----------------------------------------------------------------------
A9B187_HERA2/552-907D..LFLGRIP----------------------------------------------------------------------
B3C566_9BACE/537-910D..IGIGRFP----------------------------------------------------------------------
B0VJY1_CLOAI/655-1014D..ISIARIS----------------------------------------------------------------------
B8G4Y1_CHLAD/584-1054T..VAVGRIP----------------------------------------------------------------------
A1ZEG7_9BACT/410-775M..IPTGRLS----------------------------------------------------------------------
B0VF22_CLOAI/223-583E..VHIGRFP----------------------------------------------------------------------
A0LKV0_SYNFM/924-1265D..LAIGRLP----------------------------------------------------------------------
A8ZTD5_DESOH/257-648D..LSLGRLS----------------------------------------------------------------------
A9B8S0_HERA2/477-840D..LPVGRWP----------------------------------------------------------------------
C3JBB2_9PORP/421-799S..IGIGRFP----------------------------------------------------------------------
C9SW40_VERA1/279-917E..LSVGRAP----------------------------------------------------------------------
C9LI59_9BACT/509-899D..LGIGRFM----------------------------------------------------------------------
B5ICF9_ACIB4/214-642Q..FFIGRIP----------------------------------------------------------------------
Y048_ARCFU/22-377D..FAVGRIP----------------------------------------------------------------------
A3I371_9BACT/360-725Q..IGIGRLP----------------------------------------------------------------------

PF11713

A0AED2_YEREN/2138-2301---NLAAKRP----------------------------------------------------------------------
A0KHZ7_AERHH/3609-3767---SLAGKHP----------------------------------------------------------------------
A1EPL5_VIBCL/3469-3627---NLAGKHA----------------------------------------------------------------------
A2PYQ6_CLOPF/575-753---NLFIKNP----------------------------------------------------------------------
A3UPN6_VIBSP/3781-3944---NLAGKHP----------------------------------------------------------------------
A4TI66_YERPP/771-929---IIASYNN----------------------------------------------------------------------
A4TI66_YERPP/1083-1262---RLAGKHA----------------------------------------------------------------------
A5KV80_9GAMM/1072-1230---RLAGKHP----------------------------------------------------------------------
A5L6I6_9GAMM/693-849---DLAQKYP----------------------------------------------------------------------
A5L6I6_9GAMM/1529-1710---SDYKKRS----------------------------------------------------------------------
A5L6I6_9GAMM/1908-2074---NILQRLN----------------------------------------------------------------------
TOXA_CLODI/576-757---NLFSKNP----------------------------------------------------------------------
TOXB_CLODI/574-755---NLFAKTP----------------------------------------------------------------------
Q2KX68_BORA1/2483-2627---RLADKHP----------------------------------------------------------------------
Q2SAY5_HAHCH/1-160---NLYRKHP----------------------------------------------------------------------
Q46149_CLONO/581-762---NVFGKNP----------------------------------------------------------------------
Q46342_CLOSO/574-755---NLFSKDP----------------------------------------------------------------------
Q7N1Z0_PHOLL/2456-2614---NLAGKHP----------------------------------------------------------------------
Q7N726_PHOLL/2997-3151---NLASKHR----------------------------------------------------------------------
Q7VV06_BORPE/2551-2702---ALFHKHA----------------------------------------------------------------------
Q7VV06_BORPE/2959-3112---ALHGKHP----------------------------------------------------------------------
Q7VV06_BORPE/3397-3549---RLFRKHA----------------------------------------------------------------------
Q7VV06_BORPE/3808-3959---RLFRKHA----------------------------------------------------------------------

PF13900

B4E0H0_HUMAN/45-92---VTQAGVL----------------------------------------------------------------------
Q7Z4P3_HUMAN/54-101---VAQAGVQ----------------------------------------------------------------------
Q6ZTF6_HUMAN/58-105---VAQAGVQ----------------------------------------------------------------------
B9NCR3_POPTR/128-175---VAQAGVQ----------------------------------------------------------------------
CN165_HUMAN/57-104---VAQTGVH----------------------------------------------------------------------
Q9P195_HUMAN/6-53---VAQTGVH----------------------------------------------------------------------
B3KRW9_HUMAN/44-91---AAQAGMQ----------------------------------------------------------------------
Q6ZS53_HUMAN/79-126---VAQAGVQ----------------------------------------------------------------------
Q6ZNG3_HUMAN/65-112---CHQAGVQ----------------------------------------------------------------------
B7Z559_HUMAN/16-63---VAQAGVQ----------------------------------------------------------------------
Q9BGW3_MACFA/24-71---VGQAGVQ----------------------------------------------------------------------
Q6ZNU7_HUMAN/32-79---VAQTGVQ----------------------------------------------------------------------
B9NCR2_POPTR/11-60---VEQAGVQ----------------------------------------------------------------------
Q6ZNZ6_HUMAN/6-53---CCPGWSA----------------------------------------------------------------------
Q8N287_HUMAN/31-78---VGQAGVQ----------------------------------------------------------------------
Q95KE1_MACFA/88-135---VSQAGVQ----------------------------------------------------------------------
Q9UI48_HUMAN/14-61---FAQAGVQ----------------------------------------------------------------------
Q9H5D5_HUMAN/64-111---VPKAGVQ----------------------------------------------------------------------
Q9NR08_HUMAN/145-192---SLRAGMQ----------------------------------------------------------------------
Q6ZSG7_HUMAN/16-63---VTQAGVQ----------------------------------------------------------------------
B9NF68_POPTR/42-89---DTQAGVQ----------------------------------------------------------------------
Q9P147_HUMAN/36-83---VAQAGVQ----------------------------------------------------------------------
Q6ZQR8_HUMAN/34-81---VAQAGAQ----------------------------------------------------------------------
C9JL81_HUMAN/280-327---VVQTRVQ----------------------------------------------------------------------
Q96ID7_HUMAN/6-53---VAQAGVQ----------------------------------------------------------------------
Q5T5H1_HUMAN/139-186---VAQAGVQ----------------------------------------------------------------------
B7Z2Z5_HUMAN/303-350---CRQAGVQ----------------------------------------------------------------------
C9JQS0_HUMAN/70-117---VAQAGVQ----------------------------------------------------------------------
Q4R5J6_MACFA/21-68---VIQSGVQ----------------------------------------------------------------------
Q9NX85_HUMAN/34-81---VAQAGVQ----------------------------------------------------------------------
B4XZE4_HUMAN/24-71---VAHAGVQ----------------------------------------------------------------------
Q6STG2_HUMAN/10-57---VPHAGVQ----------------------------------------------------------------------
Q96LS9_HUMAN/23-70---GARVGVQ----------------------------------------------------------------------
Q6ZTX9_HUMAN/54-102---VTQVGVQ----------------------------------------------------------------------
Q9P191_HUMAN/17-60---VIRL...----------------------------------------------------------------------

PF00656

Q7Q803_ANOGA/54-306---.......----------------------------------------------------------------------
Q7QGM9_ANOGA/35-227---......I----------------------------------------------------------------------
Q7PV92_ANOGA/14-237---.......----------------------------------------------------------------------
Q70VV0_PICAB/3-415---.....VL----------------------------------------------------------------------
CASP4_MOUSE/132-369---.......----------------------------------------------------------------------
CASP5_HUMAN/193-430---.......----------------------------------------------------------------------
MCA1_KLULA/138-430---.......----------------------------------------------------------------------
MCA9_ARATH/10-321---.......----------------------------------------------------------------------
MCA1_ARATH/80-362---.......----------------------------------------------------------------------
MCA1_DEBHA/146-437---.....IL----------------------------------------------------------------------
MCA7_ARATH/3-401---LIDTDES----------------------------------------------------------------------
Q7Q1E0_ANOGA/62-291---.......----------------------------------------------------------------------
Q89XE4_BRAJA/58-278---.......----------------------------------------------------------------------
Q6N5Q1_RHOPA/33-253---.......----------------------------------------------------------------------
Q9ZSP8_HEVBR/3-415---.....VL----------------------------------------------------------------------
Q89FZ4_BRAJA/32-256---.......----------------------------------------------------------------------
Q6QN97_PIG/259-484---.......----------------------------------------------------------------------
Q7Q4X6_ANOGA/73-309---.......----------------------------------------------------------------------
Q6E5N8_ICTPU/119-362---.......----------------------------------------------------------------------
Q6AKF4_DESPS/28-248---.......----------------------------------------------------------------------
O42284_CHICK/42-279---.......----------------------------------------------------------------------
Q7QKT2_ANOGA/35-260---.......----------------------------------------------------------------------
Q6N0T4_RHOPA/30-251---.......----------------------------------------------------------------------
Q9NHF9_DROME/56-302---.......----------------------------------------------------------------------
Q89HT8_BRAJA/51-272---.......----------------------------------------------------------------------
Q87Z21_PSESM/2-225---.....VS----------------------------------------------------------------------
CASP1_PIG/163-400---.......----------------------------------------------------------------------
CASP3_XENLA/56-280---.......----------------------------------------------------------------------
Q9I8J3_DANRE/238-473---.......----------------------------------------------------------------------
Q9GV88_HYDVU/84-316---.......----------------------------------------------------------------------
MCA4_ARATH/3-416---.....VL----------------------------------------------------------------------
CASP2_RAT/200-445---.......----------------------------------------------------------------------
Q9IB64_XENLA/261-494---.......----------------------------------------------------------------------
MCA2_ARATH/116-414---.....ML----------------------------------------------------------------------
Q9Y1U6_PRIPA/173-413---.......----------------------------------------------------------------------
CASPD_BOVIN/136-373---.......----------------------------------------------------------------------
CASPE_MOUSE/22-256---.......----------------------------------------------------------------------
MCA1_ASHGO/154-449---.....IL----------------------------------------------------------------------
PCP_DICDI/188-405---......V----------------------------------------------------------------------
Q8ITP2_BRAFL/151-396---.......----------------------------------------------------------------------
Q7WDK3_BORBR/552-800---.....TT----------------------------------------------------------------------
Q98UI8_DANRE/48-280---.......----------------------------------------------------------------------
ICE_DROME/94-328---.......----------------------------------------------------------------------
Q7PZJ9_ANOGA/20-250---.......----------------------------------------------------------------------
Q9NBW3_DROME/38-248---.......----------------------------------------------------------------------
MCA5_ARATH/3-408---.....EL----------------------------------------------------------------------
O88550_RAT/68-301---.......----------------------------------------------------------------------
Q9DDJ2_DANRE/174-400---.......----------------------------------------------------------------------
Q985X8_RHILO/35-256---.......----------------------------------------------------------------------
CASP1_SPOFR/61-293---.......----------------------------------------------------------------------
CASP1_FELCA/161-406---.......----------------------------------------------------------------------
Q9IB66_XENLA/58-298---.......----------------------------------------------------------------------
CFLAR_HUMAN/252-477---.......----------------------------------------------------------------------
CASP1_MOUSE/162-398---.......----------------------------------------------------------------------
CASP2_CHICK/171-416---.......----------------------------------------------------------------------
CASP1_DROME/79-313---.......----------------------------------------------------------------------
Q9DDL2_DANRE/323-560---.......----------------------------------------------------------------------
MCA1_SCHPO/130-422---.....IM----------------------------------------------------------------------
Q8JIS8_ORYLA/58-285---.......----------------------------------------------------------------------
Q89IK1_BRAJA/30-253---.......----------------------------------------------------------------------
O93415_CHICK/57-299---.......----------------------------------------------------------------------
Q89MV1_BRAJA/176-400---......R----------------------------------------------------------------------
Q8IEW1_9TRYP/63-322---.....IL----------------------------------------------------------------------
Q98IJ9_RHILO/30-261---.......----------------------------------------------------------------------
Q9TZP5_CAEEL/26-261---.......----------------------------------------------------------------------
Q7RFI8_PLAYO/964-1364---.....LL----------------------------------------------------------------------
MCA1_YARLI/168-458---.....IL----------------------------------------------------------------------
MCA1_CANGA/98-389---.....ML----------------------------------------------------------------------
Q8I6Y2_GEOCY/158-414---.......----------------------------------------------------------------------
Q98IJ6_RHILO/11-238---.......----------------------------------------------------------------------
CASP1_HUMAN/163-400---.......----------------------------------------------------------------------
Q9I9L7_DANRE/145-379---.......----------------------------------------------------------------------
Q8YS65_NOSS1/4-245---.....FS----------------------------------------------------------------------
Q8ITP3_BRAFL/87-323---.......----------------------------------------------------------------------
Q98G71_RHILO/26-252---.......----------------------------------------------------------------------
Q74F93_GEOSL/6-270---......M----------------------------------------------------------------------
CFLAR_MOUSE/257-481---.......----------------------------------------------------------------------
MCA6_ARATH/3-366---.....ML----------------------------------------------------------------------
Q8T8E8_9TRYP/84-341---....LMD----------------------------------------------------------------------
CAS1A_XENLA/144-382---.......----------------------------------------------------------------------
CED3_CAEEL/243-494---.......----------------------------------------------------------------------
Q53839_STRCH/9-268---....TVV----------------------------------------------------------------------
Q6DCI2_XENLA/78-314---.......----------------------------------------------------------------------
B5VS82_YEAS6/157-450---.....IL----------------------------------------------------------------------
Q6N329_RHOPA/73-298---.......----------------------------------------------------------------------
Q6NTR7_XENLA/280-494---.......----------------------------------------------------------------------
Q7NPG1_GLOVI/7-278---.......----------------------------------------------------------------------
CASP8_HUMAN/234-476---.......----------------------------------------------------------------------
Q98CE0_RHILO/5-238---.......----------------------------------------------------------------------
Q82I86_STRAW/5-276---.......----------------------------------------------------------------------
CASP1_CANFA/163-400---.......----------------------------------------------------------------------
Q9I8S9_ONCMY/57-297---.......----------------------------------------------------------------------
CASP9_HUMAN/161-413---.......----------------------------------------------------------------------
CASP6_MOUSE/28-270---.......----------------------------------------------------------------------
Q8T8E6_9TRYP/84-343---.....IL----------------------------------------------------------------------
Q6NBN5_RHOPA/57-277---.......----------------------------------------------------------------------
Q9IB63_XENLA/144-396---.......----------------------------------------------------------------------
Q89XG2_BRAJA/27-248---.......----------------------------------------------------------------------
Q90WU1_CHICK/237-479---.......----------------------------------------------------------------------
Q9GV89_HYDVU/93-318---.......----------------------------------------------------------------------
Q6PAD9_XENLA/268-495---.......----------------------------------------------------------------------
ICENC_DROME/196-443---.......----------------------------------------------------------------------
Q98JS7_RHILO/35-253---.......----------------------------------------------------------------------
CASP8_MOUSE/236-478---.......----------------------------------------------------------------------
Q89KP2_BRAJA/86-307---.......----------------------------------------------------------------------
Q86FL0_ANOST/52-286---.......----------------------------------------------------------------------
P74453_SYNY3/40-299---.....AG----------------------------------------------------------------------
CASPC_MOUSE/176-415---.......----------------------------------------------------------------------
MCA8_ARATH/3-378---.....IM----------------------------------------------------------------------
Q8JG42_TAKRU/51-279---.......----------------------------------------------------------------------
Q90WU0_CHICK/148-400---.......----------------------------------------------------------------------
Q89HP3_BRAJA/336-569---.......----------------------------------------------------------------------
Q8I749_SUBDO/254-491---.......----------------------------------------------------------------------
O93417_CHICK/53-281---.......----------------------------------------------------------------------
CASPE_HUMAN/18-241---.......----------------------------------------------------------------------

PF14538

A2DJF0_TRIVA/81-229---HAKWSTQ----------------------------------------------------------------------
A2DYB3_TRIVA/11-163---...CPCE----------------------------------------------------------------------
A2DYM2_TRIVA/66-217---KKQLRFF----------------------------------------------------------------------
A2E336_TRIVA/52-203---......I----------------------------------------------------------------------
A2EZ34_TRIVA/86-237---RKVLRMF----------------------------------------------------------------------
A2F8U1_TRIVA/62-211---...MALA----------------------------------------------------------------------
A2F9H3_TRIVA/30-182---...CPCD----------------------------------------------------------------------
A2FJN8_TRIVA/40-192---...CSAD----------------------------------------------------------------------
A2G2E2_TRIVA/83-230---ISKTRDS----------------------------------------------------------------------
A2G590_TRIVA/29-181---...CPAE----------------------------------------------------------------------
A2GCD5_TRIVA/96-248---RQKIRFF----------------------------------------------------------------------
A8Q911_MALGO/109-262---...TRYK----------------------------------------------------------------------
A9TBL2_PHYPA/90-243---...ARYK----------------------------------------------------------------------
A9V5A2_MONBE/627-778---...AKFR----------------------------------------------------------------------
B0CNS4_LACBS/33-186---...IGYK----------------------------------------------------------------------
B0ENS2_ENTDS/37-190---...SKIE----------------------------------------------------------------------
B0WBU4_CULQU/24-183---YFRSRFR----------------------------------------------------------------------
B0WR30_CULQU/146-268---...LRKK----------------------------------------------------------------------
B3RPQ9_TRIAD/42-195---...ARYK----------------------------------------------------------------------
B4R5C8_DROSI/213-366---...ARYK----------------------------------------------------------------------
B6JY50_SCHJY/122-275---...TRYR----------------------------------------------------------------------
B7PLB3_IXOSC/91-248---...ARYK----------------------------------------------------------------------
B8CBK6_THAPS/255-410---..KLKYR----------------------------------------------------------------------
B8P5W0_POSPM/106-259---...ITFK----------------------------------------------------------------------
C4LXC3_ENTHI/41-195---...VSTE----------------------------------------------------------------------
C5KFU4_PERM5/815-945---.....CR----------------------------------------------------------------------
D0N306_PHYIT/11-164---...ARYK----------------------------------------------------------------------
D2VMD1_NAEGR/143-295---...ARYK----------------------------------------------------------------------
D8LUT8_BLAHO/28-155---.....FK----------------------------------------------------------------------
D8RG53_SELML/71-224---...ARYK----------------------------------------------------------------------
D8T9J0_SELML/49-198---...ALYN----------------------------------------------------------------------
E1ZHR5_CHLVA/131-284---...AKYK----------------------------------------------------------------------
E3Q6X3_COLGM/216-369---...TRYK----------------------------------------------------------------------
E4XFS5_OIKDI/47-229---..SDAYK----------------------------------------------------------------------
E4ZUC8_LEPMJ/159-315---...TRYK----------------------------------------------------------------------
E5SIN8_TRISP/43-196---...ARYK----------------------------------------------------------------------
E6R3W2_CRYGW/91-244---...VKYK----------------------------------------------------------------------
E7F7S1_DANRE/56-209---...ARYK----------------------------------------------------------------------
E7LNC0_TRYCR/61-219---...V.FK----------------------------------------------------------------------
E9BHG6_LEIDB/113-280---...VGVM----------------------------------------------------------------------
E9CIT6_CAPO3/726-879---...ARYK----------------------------------------------------------------------
F0W2J7_9STRA/129-282---...ARYR----------------------------------------------------------------------
F0XXV0_AURAN/11-165---...ARYR----------------------------------------------------------------------
F0ZAV4_DICPU/114-267---...ARYK----------------------------------------------------------------------
F1KR12_ASCSU/48-201---...ARYK----------------------------------------------------------------------
Q0CHB3_ASPTN/188-344---...TRYK----------------------------------------------------------------------
Q6BQ71_DEBHA/64-218---...TRYK----------------------------------------------------------------------
RTOR1_ARATH/103-256---...ARYK----------------------------------------------------------------------

PF01650

VPEG_ARATH/59-330---G.VPKDY----------------------------------------------------------------------
A0CQC7_PARTE/19-285---G.CVIDY----------------------------------------------------------------------
A2FXM6_TRIVA/13-267---GRANVKY----------------------------------------------------------------------
O24539_VICNA/53-325---G.VPKDY----------------------------------------------------------------------
HGLB_SCHMA/37-291---G.VVIDY----------------------------------------------------------------------
HGLB_SCHJA/31-285---G.VVIDY----------------------------------------------------------------------
VPE_VICSA/56-325---G.VPKDY----------------------------------------------------------------------
Q02SI3_PSEAB/341-579---A......----------------------------------------------------------------------
Q08BI0_DANRE/27-278---S.VPLDY----------------------------------------------------------------------
Q0MYV8_EMIHU/33-301---G.CKIDY----------------------------------------------------------------------
Q22P32_TETTS/20-285---G.CKIDY----------------------------------------------------------------------
Q22P33_TETTS/20-285---G.CKIDY----------------------------------------------------------------------
Q2M438_PHYIN/25-298---G.CNIDF----------------------------------------------------------------------
Q2UVF3_HAECO/29-287---G.VVIDY----------------------------------------------------------------------
Q4K5F2_PSEF5/335-570---A......----------------------------------------------------------------------
Q4RED0_TETNG/30-283---G.VPKDY----------------------------------------------------------------------
Q4UU48_XANC8/124-392---T......----------------------------------------------------------------------
Q6EHZ7_TRIVA/12-258---GSSKINY----------------------------------------------------------------------
Q6FEB2_ACIAD/229-477---A......----------------------------------------------------------------------
Q6L4R2_ORYSJ/41-319---G.VPKDY----------------------------------------------------------------------
Q6NYJ7_DANRE/32-288---G.VLKDY----------------------------------------------------------------------
Q6PRC7_IXORI/38-293---G.VPKDY----------------------------------------------------------------------
Q711M2_FASHE/21-278---G.VKIDY----------------------------------------------------------------------
Q84LM2_ORYSJ/62-334---G.VPKDY----------------------------------------------------------------------
Q852T1_TOBAC/49-320---G.VPKDY----------------------------------------------------------------------
Q86TV2_HUMAN/29-286---G.VPKDY----------------------------------------------------------------------
Q88QE3_PSEPK/400-640---A......----------------------------------------------------------------------
Q8LGK2_ARATH/46-316---G.VPKDY----------------------------------------------------------------------
Q949L7_BETVU/51-321---G.VPKDY----------------------------------------------------------------------
Q9LLQ4_SESIN/54-326---G.VPKDY----------------------------------------------------------------------
Q9LWZ3_ORYSJ/41-304---G.VPKDY----------------------------------------------------------------------
Q9SBX2_MAIZE/45-317---G.VPKDY----------------------------------------------------------------------
Q9SMD0_SOLLC/39-316---G.VPKDY----------------------------------------------------------------------
Q9XG75_TOBAC/40-306---G.VPKDY----------------------------------------------------------------------

PF03415

Q8A866_BACTN/37-399---TYDAQ.N----------------------------------------------------------------------
Q9WZB1_THEMA/121-462---TMGIDFN----------------------------------------------------------------------
Q8XM44_CLOPE/59-508---TSNYEAN----------------------------------------------------------------------
Q9X1S5_THEMA/586-937---PADAEID----------------------------------------------------------------------
Q9WYY6_THEMA/5-301---ETFDEIN----------------------------------------------------------------------
CLOS_CLOHI/60-510---TSKYEAN----------------------------------------------------------------------
Q8TIY6_METAC/66-593---RAYPHAN----------------------------------------------------------------------

PF12770

A0LJ53_SYNFM/581-921..............................ESASAGSGFMELRTAGYTEMMKGIF..QELP-------------------
A0LQE8_SYNFM/635-947.........................................................RALP-------------------
A0YK41_LYNSP/3523-3818.........................................................NDLP-------------------
A0YW51_LYNSP/1488-1787.........................................................EPLP-------------------
A0YZ16_LYNSP/128-434.........................................................NPLP-------------------
A1BCK0_CHLPD/513-826.........................................................GDLD-------------------
A1BEL3_CHLPD/43-361.........................................................LQIE-------------------
A1BEL6_CHLPD/46-364.........................................................LEIE-------------------
A3WDM2_9SPHN/678-1006............................................SSDPCAWGLNT..WRDP-------------------
A4HBL7_LEIBR/1053-1432...............................................TLFCTAFP..PNTD-------------------
A8L4T6_FRASN/741-1051.........................................................DPLP-------------------
A8YIK9_MICAE/645-974...........................................LTRSIDLSEFTF..PGLP-------------------
A9WBC0_CHLAA/673-929.........................................................GMLA-------------------
A9WER9_CHLAA/54-394..................................................WQLSP..FDRP-------------------
A9WF91_CHLAA/60-360.........................................................ERFG-------------------
B0C874_ACAM1/207-507.........................................................SPLP-------------------
B2IXC0_NOSP7/1396-1691.........................................................EPLP-------------------
B2IZZ4_NOSP7/695-973.........................................................SFLK-------------------
B2JAK0_NOSP7/526-830............................................IFNGRKHQLNF..SRLP-------------------
B2JAM9_NOSP7/866-1190...............................KNPNFTELNTLAMRRSSCDSNFSF..PRLE-------------------
B3QB04_RHOPT/774-1131............................TLTRGGPLKRRNSPKLDGVDSAELGLL..PRLP-------------------
B4JKU3_DROGR/1402-1700...............................................ALAERWGWAGAESP-------------------
B4VHH6_9CYAN/1150-1443.........................................................NPLP-------------------
B4VJ14_9CYAN/646-949...........................................DIRFIDLSQITF..APLP-------------------
B4VJ30_9CYAN/3784-4081.........................................................SPLP-------------------
B4VLG1_9CYAN/97-405.........................................................LELA-------------------
B4VLY5_9CYAN/1558-1850.........................................................NPLK-------------------
B4VPE9_9CYAN/1179-1471.........................................................NPLP-------------------
B4VQD3_9CYAN/1443-1735.........................................................NPLP-------------------
B4VQK8_9CYAN/1658-1953.........................................................EQLP-------------------
B4VTQ2_9CYAN/1746-2036.........................................................KPLP-------------------
B4VXN8_9CYAN/1368-1663.........................................................QELP-------------------
B4VXQ8_9CYAN/1752-2046.........................................................PPLP-------------------
B4VYA5_9CYAN/647-942.........................................................GALP-------------------
B4WMI9_9SYNE/695-1035.......................................NIDRSRRSVDASGLVF..SPLP-------------------
B6C3H2_9GAMM/45-361.........................................................PQLP-------------------
B8G8X7_CHLAD/58-398..................................................WGLAT..FDRK-------------------
B8GD94_CHLAD/102-415.........................................................AGIP-------------------
C3Z401_BRAFL/1278-1602...............................................SVLERWSY..DPLP-------------------
F0SR63_PLABD/137-574VEIWSHGQTRTAQIPSPAAGQPFGIQYHRIPANRLLEAERRVNDRVSELQRKAVW..NELP-------------------
P72963_SYNY3/155-456.........................................................SPLP-------------------
P73032_SYNY3/1449-1747.........................................................NPLP-------------------
P74108_SYNY3/591-904....................................PDNLPVDLELSARDAGVYF..DRLP-------------------
Q01RE6_SOLUE/865-1136....................................................SRL..PYLE-------------------
Q024J7_SOLUE/541-814.....................................................AF..PALT-------------------
Q025F1_SOLUE/607-877.........................................................ANLP-------------------
Q028B5_SOLUE/667-935.........................................................VQLP-------------------
Q02DA1_SOLUE/510-786..................................................MAKAF..PPLP-------------------
Q10YT7_TRIEI/1003-1309..........................................KSKGRFGVSDLGL..SGLP-------------------
Q10YU6_TRIEI/544-838.........................................................DDLP-------------------
Q112V9_TRIEI/62-390.........................................................SGLS-------------------
Q113D1_TRIEI/130-430.................................................VAYLNT..KDLP-------------------
Q113U8_TRIEI/3002-3297.........................................................NPLP-------------------
Q115J8_TRIEI/1466-1777.........................................................PDLY-------------------
Q117G6_TRIEI/881-1206..........................................ERGFNKTSSNIVL..GRLL-------------------
Q119J2_TRIEI/1474-1770.........................................................TPLP-------------------
Q16H64_AEDAE/1315-1614...............................................SLSETWGW..SESP-------------------
Q2G6U6_NOVAD/692-1020...........................................AVADECDWPLAT..WQNP-------------------
Q2S6G2_SALRD/540-844........................................PSSRADTTAASSLSL..PPLP-------------------
Q2W535_MAGSA/875-1218..................................SAGNDVQSSVRGMSGMRGLKF..DPLP-------------------
Q38C46_TRYB2/1044-1397...............................................LMSHLLFP..LDAH-------------------
Q3AQG5_CHLCH/44-362.........................................................LQIE-------------------
Q4C5K3_CROWT/405-717.........................................................EDLF-------------------
Q4S217_TETNG/1205-1537...............................................SVMDRWLW..GPLP-------------------
Q55594_SYNY3/165-457.........................................................EPLP-------------------
Q5LLA3_SILPO/680-970.........................................................VSAT-------------------
Q64CV3_9ARCH/59-374.........................................................YPVL-------------------
Q7NCT1_GLOVI/600-923.................................DYGAETRLEENLRSPALTGFTV..RPLP-------------------
Q7NF67_GLOVI/550-854.......................................AGKIDTRAGKFDALGF..AALP-------------------
Q7NFD7_GLOVI/666-979........................................TAPSTRSGSLGQLQV..GPLP-------------------
Q7NIF7_GLOVI/691-997.......................................RSAPSLRSADLAELRV..EGLP-------------------
Q7NJE3_GLOVI/660-988..............................GESTGAAAARWGENLRSAALTGFTV..RPLP-------------------
Q7NLR0_GLOVI/653-961.....................................ERKRSAEPVAADLGKLRY..DPLP-------------------
Q7NVB0_CHRVO/67-386.........................................................PGLP-------------------
Q82I85_STRAW/1175-1481.........................................................GDLH-------------------
Q82L10_STRAW/969-1256.........................................................APLA-------------------
Q8DGG5_THEEB/541-835.............................................HALDGRGLTF..TPLP-------------------
Q8DH74_THEEB/570-891.......................................QRGVNPRSLDLRSLTF..TELP-------------------
Q8DHI1_THEEB/67-394...............................................VVFSPMVYQSLKSP-------------------
Q8DIE5_THEEB/1127-1420.........................................................SPLP-------------------
Q8YZU5_NOSS1/56-340................................................KIDNKVF..PELA-------------------
TTC28_HUMAN/1390-1713...............................................AVMDRWLW..GPMP-------------------

PF03568

Q75EJ0_ASHGO/1148-1552------------------------------------------GFCGFFSQKQLD..KNHFA-------------------
ESPL1_HUMAN/1716-2069------------------------------------------CWKGLLLP.......SSEE-------------------
BIMB_EMENI/1605-2004------------------------------------------GFRGIFSPIPLC..EKSLA-------------------
Q6V3V9_DROVI/167-544------------------------------------------PYSYVFLGKRYP..SAAVQ-------------------
Q6ZHH8_ORYSJ/451-870------------------------------------------PWKCLLLG......YDLTD-------------------
Q6FTE1_CANGA/1147-1548------------------------------------------GLSGILNGLYCD..KDALL-------------------
Q8SRL6_ENCCU/365-731------------------------------------------..............IRTLE-------------------
Q7RB01_PLAYO/620-1007------------------------------------------PFNDKNNPNVLQILKKKNE-------------------
ESPL1_MOUSE/1712-2065------------------------------------------CWRGLLL.......PCSAD-------------------
Q6NR96_XENLA/1471-1824------------------------------------------CWKVLLS.......CPSSS-------------------
ESP1_YEAST/1171-1571------------------------------------------GVQGFFSPEVVD..NSLFE-------------------
Q6CQQ7_KLULA/1114-1517------------------------------------------GFKGVFNPRIVD..QQQFE-------------------
Q23491_CAEEL/745-1104------------------------------------------AAASLLLPSGRL..GPNAT-------------------
Q6CCJ0_YARLI/1206-1588------------------------------------------GFLGILGETV....GSGCE-------------------
O82745_ARATH/1299-1653------------------------------------------PWRCLLLG......EWSNY-------------------
CUT1_SCHPO/1379-1770------------------------------------------GFKGIFNPHKID..TSLFA-------------------
Q9VRN6_DROME/169-538------------------------------------------PYSFLFFGKRYD..CTVVQ-------------------
Q6V3V6_DROWI/170-538------------------------------------------PYAFLFLGKRYA..TKSVT-------------------

PF01364

KGP83_PORGN/244-595---------------------------------------------------------ASSP-------------------
D1JG83_9ARCH/891-1295---------------------------------------------------------GLDV-------------------
A2U064_9FLAO/401-768---------------------------------------------------------VSTI-------------------
Q7MTE2_PORGI/239-573---------------------------------------------------------CESK-------------------
D3HWT0_9BACT/400-777---------------------------------------------------------VSNA-------------------
Q5S3Q9_9FLAO/543-910---------------------------------------------------------AKDI-------------------
A9DMD5_9FLAO/555-923---------------------------------------------------------ILDA-------------------
B0VGA8_CLOAI/228-563---------------------------------------------------------AENI-------------------
B7B5I7_9PORP/382-753---------------------------------------------------------IRTV-------------------
B8FFM0_DESAA/254-600---------------------------------------------------------ASDS-------------------
A3U7G6_CROAH/540-908---------------------------------------------------------ADTP-------------------
D2QSX9_SPILD/414-786---------------------------------------------------------AKSV-------------------
A3HW99_9BACT/398-769---------------------------------------------------------AKNS-------------------
B0VHP2_CLOAI/234-563---------------------------------------------------------AQTV-------------------
A8ZUB1_DESOH/278-656---------------------------------------------------------AENA-------------------
B0VIM2_CLOAI/182-528---------------------------------------------------------FADA-------------------
Q2Z0E1_9BACT/643-1013---------------------------------------------------------VRSS-------------------
B3QXR8_CHLT3/734-1131---------------------------------------------------------ARSL-------------------
C2MCN4_9PORP/405-781---------------------------------------------------------IRTL-------------------
A4A325_9PLAN/24-399---------------------------------------------------------VRTP-------------------
A7NR84_ROSCS/499-867---------------------------------------------------------AKSV-------------------
Q11Q36_CYTH3/558-932---------------------------------------------------------IGSA-------------------
Q7MX16_PORGI/272-637---------------------------------------------------------VTNA-------------------
A0B5K7_METTP/796-1154---------------------------------------------------------GLSV-------------------
D0MH89_RHOM4/586-975---------------------------------------------------------VQTP-------------------
A8UH97_9FLAO/539-910---------------------------------------------------------VENV-------------------
B8KYL6_9GAMM/364-704---------------------------------------------------------AGSP-------------------
B8FIK5_DESAA/1139-1542---------------------------------------------------------VRNA-------------------
Q11US7_CYTH3/392-767---------------------------------------------------------ARTN-------------------
C6W101_DYAFD/326-680---------------------------------------------------------ALNA-------------------
A5FJM8_FLAJ1/544-914---------------------------------------------------------VSDN-------------------
Q7UG73_RHOBA/51-444---------------------------------------------------------VRSA-------------------
A3J247_9FLAO/540-919---------------------------------------------------------VSSV-------------------
A9WIM0_CHLAA/500-869---------------------------------------------------------VKTA-------------------
B0VHE7_CLOAI/227-554---------------------------------------------------------VTST-------------------
C6VT06_DYAFD/394-758---------------------------------------------------------ANTN-------------------
C6X3N8_FLAB3/546-921---------------------------------------------------------AANI-------------------
A0LQH1_SYNFM/790-1132---------------------------------------------------------ATDA-------------------
A1ZVJ9_9BACT/406-774---------------------------------------------------------VKTL-------------------
B0VHF1_CLOAI/214-595---------------------------------------------------------YNSD-------------------
B0VIE7_CLOAI/193-598---------------------------------------------------------TNSA-------------------
C6W3P4_DYAFD/414-806---------------------------------------------------------ATNN-------------------
B2RGP6_PORG3/408-787---------------------------------------------------------VRTP-------------------
D2QJ99_SPILD/409-770---------------------------------------------------------AGTP-------------------
A9B5Q8_HERA2/466-850---------------------------------------------------------AKTS-------------------
D2QFF3_SPILD/397-745---------------------------------------------------------ATTN-------------------
B0VH03_CLOAI/589-939---------------------------------------------------------VKNT-------------------
D2R2P5_PIRSD/21-411---------------------------------------------------------ADTP-------------------
C6W0Z3_DYAFD/393-758---------------------------------------------------------VKSR-------------------
A3XQP5_LEEBM/552-929---------------------------------------------------------ADTP-------------------
C9RIY0_FIBSS/581-957---------------------------------------------------------VTTV-------------------
Q2PY26_9BACT/412-780---------------------------------------------------------VNTL-------------------
Q26FX7_FLABB/537-909---------------------------------------------------------VSDV-------------------
B0VJT2_CLOAI/236-566---------------------------------------------------------VENL-------------------
C6BTD6_DESAD/56-402---------------------------------------------------------ARDC-------------------
D2QE53_SPILD/328-1007---------------------------------------------------------VTSG-------------------
A2BK55_HYPBU/159-551---------------------------------------------------------FTDA-------------------
B0VHP1_CLOAI/283-636---------------------------------------------------------ATSV-------------------
Q1Q1Y4_9BACT/620-970---------------------------------------------------------AQTI-------------------
C7PNY3_CHIPD/396-764---------------------------------------------------------VQQP-------------------
Q6LFY5_PHOPR/224-617---------------------------------------------------------GDTE-------------------
B3QVL4_CHLT3/688-1063---------------------------------------------------------VQSA-------------------
A9B187_HERA2/552-907---------------------------------------------------------ARSL-------------------
B3C566_9BACE/537-910---------------------------------------------------------VRTA-------------------
B0VJY1_CLOAI/655-1014---------------------------------------------------------IWKE-------------------
B8G4Y1_CHLAD/584-1054---------------------------------------------------------LTDP-------------------
A1ZEG7_9BACT/410-775---------------------------------------------------------TRLA-------------------
B0VF22_CLOAI/223-583---------------------------------------------------------AETQ-------------------
A0LKV0_SYNFM/924-1265---------------------------------------------------------VSTV-------------------
A8ZTD5_DESOH/257-648---------------------------------------------------------VDTL-------------------
A9B8S0_HERA2/477-840---------------------------------------------------------ATTV-------------------
C3JBB2_9PORP/421-799---------------------------------------------------------IRTL-------------------
C9SW40_VERA1/279-917---------------------------------------------------------VETA-------------------
C9LI59_9BACT/509-899---------------------------------------------------------CYDA-------------------
B5ICF9_ACIB4/214-642---------------------------------------------------------VN.P-------------------
Y048_ARCFU/22-377---------------------------------------------------------AGSE-------------------
A3I371_9BACT/360-725---------------------------------------------------------IINK-------------------

PF11713

A0AED2_YEREN/2138-2301---------------------------------------------------------N.SV-------------------
A0KHZ7_AERHH/3609-3767---------------------------------------------------------DRSL-------------------
A1EPL5_VIBCL/3469-3627---------------------------------------------------------ESSV-------------------
A2PYQ6_CLOPF/575-753---------------------------------------------------------SNSI-------------------
A3UPN6_VIBSP/3781-3944---------------------------------------------------------DSTV-------------------
A4TI66_YERPP/771-929---------------------------------------------------------NKSI-------------------
A4TI66_YERPP/1083-1262---------------------------------------------------------KNSI-------------------
A5KV80_9GAMM/1072-1230---------------------------------------------------------DKTV-------------------
A5L6I6_9GAMM/693-849---------------------------------------------------------KNSV-------------------
A5L6I6_9GAMM/1529-1710---------------------------------------------------------FNTV-------------------
A5L6I6_9GAMM/1908-2074---------------------------------------------------------GKGV-------------------
TOXA_CLODI/576-757---------------------------------------------------------KNSI-------------------
TOXB_CLODI/574-755---------------------------------------------------------YDSV-------------------
Q2KX68_BORA1/2483-2627---------------------------------------------------------ANTE-------------------
Q2SAY5_HAHCH/1-160---------------------------------------------------------DKSE-------------------
Q46149_CLONO/581-762---------------------------------------------------------NKSI-------------------
Q46342_CLOSO/574-755---------------------------------------------------------YSSI-------------------
Q7N1Z0_PHOLL/2456-2614---------------------------------------------------------DSSV-------------------
Q7N726_PHOLL/2997-3151---------------------------------------------------------KSSV-------------------
Q7VV06_BORPE/2551-2702---------------------------------------------------------EQSD-------------------
Q7VV06_BORPE/2959-3112---------------------------------------------------------ANSN-------------------
Q7VV06_BORPE/3397-3549---------------------------------------------------------GNAS-------------------
Q7VV06_BORPE/3808-3959---------------------------------------------------------ATSL-------------------

PF13900

B4E0H0_HUMAN/45-92--------------------------------------------------------------------------------
Q7Z4P3_HUMAN/54-101--------------------------------------------------------------------------------
Q6ZTF6_HUMAN/58-105--------------------------------------------------------------------------------
B9NCR3_POPTR/128-175--------------------------------------------------------------------------------
CN165_HUMAN/57-104--------------------------------------------------------------------------------
Q9P195_HUMAN/6-53--------------------------------------------------------------------------------
B3KRW9_HUMAN/44-91--------------------------------------------------------------------------------
Q6ZS53_HUMAN/79-126--------------------------------------------------------------------------------
Q6ZNG3_HUMAN/65-112--------------------------------------------------------------------------------
B7Z559_HUMAN/16-63--------------------------------------------------------------------------------
Q9BGW3_MACFA/24-71--------------------------------------------------------------------------------
Q6ZNU7_HUMAN/32-79--------------------------------------------------------------------------------
B9NCR2_POPTR/11-60--------------------------------------------------------------------------------
Q6ZNZ6_HUMAN/6-53--------------------------------------------------------------------------------
Q8N287_HUMAN/31-78--------------------------------------------------------------------------------
Q95KE1_MACFA/88-135--------------------------------------------------------------------------------
Q9UI48_HUMAN/14-61--------------------------------------------------------------------------------
Q9H5D5_HUMAN/64-111--------------------------------------------------------------------------------
Q9NR08_HUMAN/145-192--------------------------------------------------------------------------------
Q6ZSG7_HUMAN/16-63--------------------------------------------------------------------------------
B9NF68_POPTR/42-89--------------------------------------------------------------------------------
Q9P147_HUMAN/36-83--------------------------------------------------------------------------------
Q6ZQR8_HUMAN/34-81--------------------------------------------------------------------------------
C9JL81_HUMAN/280-327--------------------------------------------------------------------------------
Q96ID7_HUMAN/6-53--------------------------------------------------------------------------------
Q5T5H1_HUMAN/139-186--------------------------------------------------------------------------------
B7Z2Z5_HUMAN/303-350--------------------------------------------------------------------------------
C9JQS0_HUMAN/70-117--------------------------------------------------------------------------------
Q4R5J6_MACFA/21-68--------------------------------------------------------------------------------
Q9NX85_HUMAN/34-81--------------------------------------------------------------------------------
B4XZE4_HUMAN/24-71--------------------------------------------------------------------------------
Q6STG2_HUMAN/10-57--------------------------------------------------------------------------------
Q96LS9_HUMAN/23-70--------------------------------------------------------------------------------
Q6ZTX9_HUMAN/54-102--------------------------------------------------------------------------------
Q9P191_HUMAN/17-60--------------------------------------------------------------------------------

PF00656

Q7Q803_ANOGA/54-306---------------------------------------------------------Y.DD...................
Q7QGM9_ANOGA/35-227---------------------------------------------------------N.EN...................
Q7PV92_ANOGA/14-237---------------------------------------------------------M.DD...................
Q70VV0_PICAB/3-415---------------------------------------------------------I.DTDDS................
CASP4_MOUSE/132-369---------------------------------------------------------K.EE...................
CASP5_HUMAN/193-430---------------------------------------------------------.EKN...................
MCA1_KLULA/138-430---------------------------------------------------------I.VMLNDDT..............
MCA9_ARATH/10-321---------------------------------------------------------I.EVLTDEP..............
MCA1_ARATH/80-362---------------------------------------------------------I.LMLTEEE..............
MCA1_DEBHA/146-437---------------------------------------------------------T.DDQNQ................
MCA7_ARATH/3-401---------------------------------------------------------Y.TQ...................
Q7Q1E0_ANOGA/62-291---------------------------------------------------------Y.PD...................
Q89XE4_BRAJA/58-278---------------------------------------------------------V.ED...................
Q6N5Q1_RHOPA/33-253---------------------------------------------------------A.RD...................
Q9ZSP8_HEVBR/3-415---------------------------------------------------------I.DIDES................
Q89FZ4_BRAJA/32-256---------------------------------------------------------A.AN...................
Q6QN97_PIG/259-484---------------------------------------------------------F.LY...................
Q7Q4X6_ANOGA/73-309---------------------------------------------------------F.KD...................
Q6E5N8_ICTPU/119-362---------------------------------------------------------H.KN...................
Q6AKF4_DESPS/28-248---------------------------------------------------------K.VN...................
O42284_CHICK/42-279---------------------------------------------------------H.ED...................
Q7QKT2_ANOGA/35-260---------------------------------------------------------L.SD...................
Q6N0T4_RHOPA/30-251---------------------------------------------------------G.ED...................
Q9NHF9_DROME/56-302---------------------------------------------------------F.DD...................
Q89HT8_BRAJA/51-272---------------------------------------------------------A.TD...................
Q87Z21_PSESM/2-225---------------------------------------------------------NEQD...................
CASP1_PIG/163-400---------------------------------------------------------R.EN...................
CASP3_XENLA/56-280---------------------------------------------------------C.ND...................
Q9I8J3_DANRE/238-473---------------------------------------------------------R.ND...................
Q9GV88_HYDVU/84-316---------------------------------------------------------L.NN...................
MCA4_ARATH/3-416---------------------------------------------------------I.DTDES................
CASP2_RAT/200-445---------------------------------------------------------L.YD...................
Q9IB64_XENLA/261-494---------------------------------------------------------H.RD...................
MCA2_ARATH/116-414---------------------------------------------------------T.EEEAD................
Q9Y1U6_PRIPA/173-413---------------------------------------------------------H.EN...................
CASPD_BOVIN/136-373---------------------------------------------------------E.EK...................
CASPE_MOUSE/22-256---------------------------------------------------------K.RD...................
MCA1_ASHGO/154-449---------------------------------------------------------T.DDQHD................
PCP_DICDI/188-405---------------------------------------------------------WLID...................
Q8ITP2_BRAFL/151-396---------------------------------------------------------L.KD...................
Q7WDK3_BORBR/552-800---------------------------------------------------------P.QQ...................
Q98UI8_DANRE/48-280---------------------------------------------------------Y.ND...................
ICE_DROME/94-328---------------------------------------------------------Y.KD...................
Q7PZJ9_ANOGA/20-250---------------------------------------------------------F.CD...................
Q9NBW3_DROME/38-248---------------------------------------------------------I.SN...................
MCA5_ARATH/3-408---------------------------------------------------------I.DTDES................
O88550_RAT/68-301---------------------------------------------------------Y.ND...................
Q9DDJ2_DANRE/174-400---------------------------------------------------------Y.RN...................
Q985X8_RHILO/35-256---------------------------------------------------------A.RD...................
CASP1_SPOFR/61-293---------------------------------------------------------F.PN...................
CASP1_FELCA/161-406---------------------------------------------------------K.EE...................
Q9IB66_XENLA/58-298---------------------------------------------------------Y.YN...................
CFLAR_HUMAN/252-477---------------------------------------------------------F.LH...................
CASP1_MOUSE/162-398---------------------------------------------------------K.EN...................
CASP2_CHICK/171-416---------------------------------------------------------F.HD...................
CASP1_DROME/79-313---------------------------------------------------------H.KD...................
Q9DDL2_DANRE/323-560---------------------------------------------------------L.LD...................
MCA1_SCHPO/130-422---------------------------------------------------------T.DTASN................
Q8JIS8_ORYLA/58-285---------------------------------------------------------Y.ND...................
Q89IK1_BRAJA/30-253---------------------------------------------------------G.ID...................
O93415_CHICK/57-299---------------------------------------------------------F.DD...................
Q89MV1_BRAJA/176-400---------------------------------------------------------AQLD...................
Q8IEW1_9TRYP/63-322---------------------------------------------------------V.DDRRFP...............
Q98IJ9_RHILO/30-261---------------------------------------------------------G.VD...................
Q9TZP5_CAEEL/26-261---------------------------------------------------------Y.DN...................
Q7RFI8_PLAYO/964-1364---------------------------------------------------------I.DSFPSNAYIYDDFDMNRTKYI
MCA1_YARLI/168-458---------------------------------------------------------T.DDQRD................
MCA1_CANGA/98-389---------------------------------------------------------T.DDQRE................
Q8I6Y2_GEOCY/158-414---------------------------------------------------------K.DN...................
Q98IJ6_RHILO/11-238---------------------------------------------------------G.FD...................
CASP1_HUMAN/163-400---------------------------------------------------------K.KN...................
Q9I9L7_DANRE/145-379---------------------------------------------------------R.PN...................
Q8YS65_NOSS1/4-245---------------------------------------------------------D.DSPNFG...............
Q8ITP3_BRAFL/87-323---------------------------------------------------------F.DN...................
Q98G71_RHILO/26-252---------------------------------------------------------G.ND...................
Q74F93_GEOSL/6-270---------------------------------------------------------T.KA...................
CFLAR_MOUSE/257-481---------------------------------------------------------F.LF...................
MCA6_ARATH/3-366---------------------------------------------------------I.DTDSS................
Q8T8E8_9TRYP/84-341---------------------------------------------------------T.DDPRF................
CAS1A_XENLA/144-382---------------------------------------------------------H.TN...................
CED3_CAEEL/243-494---------------------------------------------------------K.DN...................
Q53839_STRCH/9-268---------------------------------------------------------T.NP...................
Q6DCI2_XENLA/78-314---------------------------------------------------------Y.NN...................
B5VS82_YEAS6/157-450---------------------------------------------------------T.DDQND................
Q6N329_RHOPA/73-298---------------------------------------------------------A.SD...................
Q6NTR7_XENLA/280-494---------------------------------------------------------D.RY...................
Q7NPG1_GLOVI/7-278---------------------------------------------------------..QQLRTL...............
CASP8_HUMAN/234-476---------------------------------------------------------H.DD...................
Q98CE0_RHILO/5-238---------------------------------------------------------E.TN...................
Q82I86_STRAW/5-276---------------------------------------------------------..GE...................
CASP1_CANFA/163-400---------------------------------------------------------K.RK...................
Q9I8S9_ONCMY/57-297---------------------------------------------------------F.DN...................
CASP9_HUMAN/161-413---------------------------------------------------------K.GD...................
CASP6_MOUSE/28-270---------------------------------------------------------F.ND...................
Q8T8E6_9TRYP/84-343---------------------------------------------------------V.DEDNFP...............
Q6NBN5_RHOPA/57-277---------------------------------------------------------I.ED...................
Q9IB63_XENLA/144-396---------------------------------------------------------K.DN...................
Q89XG2_BRAJA/27-248---------------------------------------------------------G.EN...................
Q90WU1_CHICK/237-479---------------------------------------------------------Y.KD...................
Q9GV89_HYDVU/93-318---------------------------------------------------------C.NN...................
Q6PAD9_XENLA/268-495---------------------------------------------------------V.EN...................
ICENC_DROME/196-443---------------------------------------------------------Y.GN...................
Q98JS7_RHILO/35-253---------------------------------------------------------F.YD...................
CASP8_MOUSE/236-478---------------------------------------------------------Y.DD...................
Q89KP2_BRAJA/86-307---------------------------------------------------------A.RD...................
Q86FL0_ANOST/52-286---------------------------------------------------------F.NN...................
P74453_SYNY3/40-299---------------------------------------------------------L.DPQ..................
CASPC_MOUSE/176-415---------------------------------------------------------K.EN...................
MCA8_ARATH/3-378---------------------------------------------------------I.DTDKS................
Q8JG42_TAKRU/51-279---------------------------------------------------------H.ND...................
Q90WU0_CHICK/148-400---------------------------------------------------------L.RN...................
Q89HP3_BRAJA/336-569---------------------------------------------------------G.VD...................
Q8I749_SUBDO/254-491---------------------------------------------------------V.EN...................
O93417_CHICK/53-281---------------------------------------------------------N.ND...................
CASPE_HUMAN/18-241---------------------------------------------------------K.RD...................

PF14538

A2DJF0_TRIVA/81-229---------------------------------------------------------TSRS-------------------
A2DYB3_TRIVA/11-163---------------------------------------------------------MIVD-------------------
A2DYM2_TRIVA/66-217---------------------------------------------------------FQVA-------------------
A2E336_TRIVA/52-203---------------------------------------------------------ISNE-------------------
A2EZ34_TRIVA/86-237---------------------------------------------------------FQVA-------------------
A2F8U1_TRIVA/62-211---------------------------------------------------------ARVN-------------------
A2F9H3_TRIVA/30-182---------------------------------------------------------FAVD-------------------
A2FJN8_TRIVA/40-192---------------------------------------------------------IVVD-------------------
A2G2E2_TRIVA/83-230---------------------------------------------------------LNVG-------------------
A2G590_TRIVA/29-181---------------------------------------------------------IFVD-------------------
A2GCD5_TRIVA/96-248---------------------------------------------------------FSIA-------------------
A8Q911_MALGO/109-262---------------------------------------------------------QYLD-------------------
A9TBL2_PHYPA/90-243---------------------------------------------------------VSLD-------------------
A9V5A2_MONBE/627-778---------------------------------------------------------QAPD-------------------
B0CNS4_LACBS/33-186---------------------------------------------------------YILD-------------------
B0ENS2_ENTDS/37-190---------------------------------------------------------PCCD-------------------
B0WBU4_CULQU/24-183---------------------------------------------------------SLPD-------------------
B0WR30_CULQU/146-268---------------------------------------------------------TLKN-------------------
B3RPQ9_TRIAD/42-195---------------------------------------------------------QSLD-------------------
B4R5C8_DROSI/213-366---------------------------------------------------------KCND-------------------
B6JY50_SCHJY/122-275---------------------------------------------------------HYLD-------------------
B7PLB3_IXOSC/91-248---------------------------------------------------------LSLD-------------------
B8CBK6_THAPS/255-410---------------------------------------------------------RAID-------------------
B8P5W0_POSPM/106-259---------------------------------------------------------PLLD-------------------
C4LXC3_ENTHI/41-195---------------------------------------------------------GLWD-------------------
C5KFU4_PERM5/815-945---------------------------------------------------------VCPD-------------------
D0N306_PHYIT/11-164---------------------------------------------------------QSLD-------------------
D2VMD1_NAEGR/143-295---------------------------------------------------------QCLD-------------------
D8LUT8_BLAHO/28-155---------------------------------------------------------SLND-------------------
D8RG53_SELML/71-224---------------------------------------------------------LALD-------------------
D8T9J0_SELML/49-198---------------------------------------------------------LRLD-------------------
E1ZHR5_CHLVA/131-284---------------------------------------------------------MHLD-------------------
E3Q6X3_COLGM/216-369---------------------------------------------------------QYLD-------------------
E4XFS5_OIKDI/47-229---------------------------------------------------------QKIF-------------------
E4ZUC8_LEPMJ/159-315---------------------------------------------------------LLLD-------------------
E5SIN8_TRISP/43-196---------------------------------------------------------QALD-------------------
E6R3W2_CRYGW/91-244---------------------------------------------------------AFLD-------------------
E7F7S1_DANRE/56-209---------------------------------------------------------QSLD-------------------
E7LNC0_TRYCR/61-219---------------------------------------------------------RAVD-------------------
E9BHG6_LEIDB/113-280---------------------------------------------------------RVVE-------------------
E9CIT6_CAPO3/726-879---------------------------------------------------------PSLD-------------------
F0W2J7_9STRA/129-282---------------------------------------------------------QSLD-------------------
F0XXV0_AURAN/11-165---------------------------------------------------------QLLD-------------------
F0ZAV4_DICPU/114-267---------------------------------------------------------QCLD-------------------
F1KR12_ASCSU/48-201---------------------------------------------------------NAND-------------------
Q0CHB3_ASPTN/188-344---------------------------------------------------------QYLD-------------------
Q6BQ71_DEBHA/64-218---------------------------------------------------------QSLD-------------------
RTOR1_ARATH/103-256---------------------------------------------------------VQLD-------------------

PF01650

VPEG_ARATH/59-330---------------------------------------------------------TGDD-------------------
A0CQC7_PARTE/19-285---------------------------------------------------------SKTD-------------------
A2FXM6_TRIVA/13-267---------------------------------------------------------TAGK-------------------
O24539_VICNA/53-325---------------------------------------------------------NGDF-------------------
HGLB_SCHMA/37-291---------------------------------------------------------RGKN-------------------
HGLB_SCHJA/31-285---------------------------------------------------------KGKK-------------------
VPE_VICSA/56-325---------------------------------------------------------TGAE-------------------
Q02SI3_PSEAB/341-579---------------------------------------------------------.VRT-------------------
Q08BI0_DANRE/27-278---------------------------------------------------------TGNK-------------------
Q0MYV8_EMIHU/33-301---------------------------------------------------------SGSM-------------------
Q22P32_TETTS/20-285---------------------------------------------------------QGED-------------------
Q22P33_TETTS/20-285---------------------------------------------------------QGND-------------------
Q2M438_PHYIN/25-298---------------------------------------------------------RGVE-------------------
Q2UVF3_HAECO/29-287---------------------------------------------------------KDKS-------------------
Q4K5F2_PSEF5/335-570---------------------------------------------------------.AQT-------------------
Q4RED0_TETNG/30-283---------------------------------------------------------TGDD-------------------
Q4UU48_XANC8/124-392---------------------------------------------------------.LAA-------------------
Q6EHZ7_TRIVA/12-258---------------------------------------------------------AHNS-------------------
Q6FEB2_ACIAD/229-477---------------------------------------------------------.LNR-------------------
Q6L4R2_ORYSJ/41-319---------------------------------------------------------TGDD-------------------
Q6NYJ7_DANRE/32-288---------------------------------------------------------IGDD-------------------
Q6PRC7_IXORI/38-293---------------------------------------------------------TGDL-------------------
Q711M2_FASHE/21-278---------------------------------------------------------SGLQ-------------------
Q84LM2_ORYSJ/62-334---------------------------------------------------------TGHQ-------------------
Q852T1_TOBAC/49-320---------------------------------------------------------TGHH-------------------
Q86TV2_HUMAN/29-286---------------------------------------------------------TGED-------------------
Q88QE3_PSEPK/400-640---------------------------------------------------------.AAT-------------------
Q8LGK2_ARATH/46-316---------------------------------------------------------TKEA-------------------
Q949L7_BETVU/51-321---------------------------------------------------------TGED-------------------
Q9LLQ4_SESIN/54-326---------------------------------------------------------TGEQ-------------------
Q9LWZ3_ORYSJ/41-304---------------------------------------------------------NGND-------------------
Q9SBX2_MAIZE/45-317---------------------------------------------------------TGRD-------------------
Q9SMD0_SOLLC/39-316---------------------------------------------------------TGKD-------------------
Q9XG75_TOBAC/40-306---------------------------------------------------------TGKD-------------------

PF03415

Q8A866_BACTN/37-399---------------------------------------------------------SVDV-------------------
Q9WZB1_THEMA/121-462---------------------------------------------------------SGSY-------------------
Q8XM44_CLOPE/59-508---------------------------------------------------------MGDA-------------------
Q9X1S5_THEMA/586-937---------------------------------------------------------SGNI-------------------
Q9WYY6_THEMA/5-301---------------------------------------------------------SGDP-------------------
CLOS_CLOHI/60-510---------------------------------------------------------MGDP-------------------
Q8TIY6_METAC/66-593---------------------------------------------------------MGDD-------------------

PF12770

A0LJ53_SYNFM/581-921---------------------------------------------------------------DTEDE.A------RE-I
A0LQE8_SYNFM/635-947---------------------------------------------------------------SVRYE.L------HS-I
A0YK41_LYNSP/3523-3818---------------------------------------------------------------AVSAE.V------NI-I
A0YW51_LYNSP/1488-1787---------------------------------------------------------------AVPIE.L------NL-I
A0YZ16_LYNSP/128-434---------------------------------------------------------------AVPVE.L------SN-I
A1BCK0_CHLPD/513-826---------------------------------------------------------------FSELE.C------AW-V
A1BEL3_CHLPD/43-361---------------------------------------------------------------EEQAGVL------EA-L
A1BEL6_CHLPD/46-364---------------------------------------------------------------VEQGRVL------EA-L
A3WDM2_9SPHN/678-1006---------------------------------------------------------------IDPGE.L------FF-A
A4HBL7_LEIBR/1053-1432---------------------------------------------------------------RSEQEGA------AV-V
A8L4T6_FRASN/741-1051---------------------------------------------------------------GAQVE.T------DI-V
A8YIK9_MICAE/645-974---------------------------------------------------------------GTEEE.A------KA-I
A9WBC0_CHLAA/673-929---------------------------------------------------------------AVQRE.I------NA-I
A9WER9_CHLAA/54-394---------------------------------------------------------------ATERDFR------QR-F
A9WF91_CHLAA/60-360---------------------------------------------------------------LAPVDVA------GE-L
B0C874_ACAM1/207-507---------------------------------------------------------------SVAVE.I------PA-L
B2IXC0_NOSP7/1396-1691---------------------------------------------------------------AVPLE.L------ST-L
B2IZZ4_NOSP7/695-973---------------------------------------------------------------GVKPE.L------KQ-V
B2JAK0_NOSP7/526-830---------------------------------------------------------------GTETE.V------KS-I
B2JAM9_NOSP7/866-1190---------------------------------------------------------------GTHTE.A------TN-I
B3QB04_RHOPT/774-1131---------------------------------------------------------------DTSDE.L------KS-I
B4JKU3_DROGR/1402-1700---------------------------------------------------------------AALQE.A------AM-V
B4VHH6_9CYAN/1150-1443---------------------------------------------------------------AVPVE.L------ST-I
B4VJ14_9CYAN/646-949---------------------------------------------------------------GTAEE.A------EA-I
B4VJ30_9CYAN/3784-4081---------------------------------------------------------------AVPLE.L------QT-I
B4VLG1_9CYAN/97-405---------------------------------------------------------------QEAAHLQ------EE-L
B4VLY5_9CYAN/1558-1850---------------------------------------------------------------AVPVE.L------AA-I
B4VPE9_9CYAN/1179-1471---------------------------------------------------------------AVPVE.L------SA-I
B4VQD3_9CYAN/1443-1735---------------------------------------------------------------AVPLE.L------SA-I
B4VQK8_9CYAN/1658-1953---------------------------------------------------------------AAAAE.V------SI-L
B4VTQ2_9CYAN/1746-2036---------------------------------------------------------------AVPVE.L------EA-I
B4VXN8_9CYAN/1368-1663---------------------------------------------------------------YVPLE.L------ST-I
B4VXQ8_9CYAN/1752-2046---------------------------------------------------------------AVPNE.L------QI-I
B4VYA5_9CYAN/647-942---------------------------------------------------------------TVATE.L------KI-I
B4WMI9_9SYNE/695-1035---------------------------------------------------------------GTAQE.A------EA-I
B6C3H2_9GAMM/45-361---------------------------------------------------------------YTSLE.V------AR-I
B8G8X7_CHLAD/58-398---------------------------------------------------------------ATEQDFK------LR-F
B8GD94_CHLAD/102-415---------------------------------------------------------------PELRQLE------RS-V
C3Z401_BRAFL/1278-1602---------------------------------------------------------------AAEQE.S------RI-I
F0SR63_PLABD/137-574---------------------------------------------------------------GTRAE.I------LA-I
P72963_SYNY3/155-456---------------------------------------------------------------AVPVE.L------EN-I
P73032_SYNY3/1449-1747---------------------------------------------------------------AAAVE.V------DT-I
P74108_SYNY3/591-904---------------------------------------------------------------YTEQE.A------EQ-L
Q01RE6_SOLUE/865-1136---------------------------------------------------------------NAERE.A------SD-V
Q024J7_SOLUE/541-814---------------------------------------------------------------NAPAE.I------AA-V
Q025F1_SOLUE/607-877---------------------------------------------------------------NAARE.V------QT-L
Q028B5_SOLUE/667-935---------------------------------------------------------------AARRE.V------EG-L
Q02DA1_SOLUE/510-786---------------------------------------------------------------GTMRE.G------QA-V
Q10YT7_TRIEI/1003-1309---------------------------------------------------------------GTEEE.V------KA-I
Q10YU6_TRIEI/544-838---------------------------------------------------------------NVKQE.L------ES-I
Q112V9_TRIEI/62-390---------------------------------------------------------------DVEYYEV------HK-Y
Q113D1_TRIEI/130-430---------------------------------------------------------------EVEQE.K------EI-I
Q113U8_TRIEI/3002-3297---------------------------------------------------------------AVPVE.L------EI-I
Q115J8_TRIEI/1466-1777---------------------------------------------------------------GQDLGII------SI-I
Q117G6_TRIEI/881-1206---------------------------------------------------------------KTADE.V------KA-I
Q119J2_TRIEI/1474-1770---------------------------------------------------------------GVLVE.L------KA-I
Q16H64_AEDAE/1315-1614---------------------------------------------------------------ASLQE.A------AM-V
Q2G6U6_NOVAD/692-1020---------------------------------------------------------------ISADE.L------YY-A
Q2S6G2_SALRD/540-844---------------------------------------------------------------GVQSE.I------NA-L
Q2W535_MAGSA/875-1218---------------------------------------------------------------GAEKE.G------QL-I
Q38C46_TRYB2/1044-1397---------------------------------------------------------------RSESE.G------AV-V
Q3AQG5_CHLCH/44-362---------------------------------------------------------------VEQAAVL------EA-L
Q4C5K3_CROWT/405-717---------------------------------------------------------------YGGLE.V------EI-I
Q4S217_TETNG/1205-1537---------------------------------------------------------------SAQEE.A------LW-L
Q55594_SYNY3/165-457---------------------------------------------------------------GVALE.I------AN-I
Q5LLA3_SILPO/680-970---------------------------------------------------------------EEIAKLR------KA-I
Q64CV3_9ARCH/59-374---------------------------------------------------------------EFEKE.E------DT-F
Q7NCT1_GLOVI/600-923---------------------------------------------------------------GAKVE.A------AA-V
Q7NF67_GLOVI/550-854---------------------------------------------------------------ATAKE.V------AA-L
Q7NFD7_GLOVI/666-979---------------------------------------------------------------GSLQE.A------KV-L
Q7NIF7_GLOVI/691-997---------------------------------------------------------------GSAKE.A------AA-L
Q7NJE3_GLOVI/660-988---------------------------------------------------------------GAERE.A------RA-V
Q7NLR0_GLOVI/653-961---------------------------------------------------------------ATAEE.A------EA-I
Q7NVB0_CHRVO/67-386---------------------------------------------------------------AIPAE.A------HL-L
Q82I85_STRAW/1175-1481---------------------------------------------------------------YAGEE.A------DA-V
Q82L10_STRAW/969-1256---------------------------------------------------------------RTVTEAT------EA-V
Q8DGG5_THEEB/541-835---------------------------------------------------------------GTAEE.A------QA-L
Q8DH74_THEEB/570-891---------------------------------------------------------------GTATE.V------KT-L
Q8DHI1_THEEB/67-394---------------------------------------------------------------AAQHERV------RI-L
Q8DIE5_THEEB/1127-1420---------------------------------------------------------------AVPVE.V------SQ-I
Q8YZU5_NOSS1/56-340---------------------------------------------------------------YFPIE.Y------TA-I
TTC28_HUMAN/1390-1713---------------------------------------------------------------SAEEE.A------YM-V

PF03568

Q75EJ0_ASHGO/1148-1552---------------------------------------------------------------LFKLGFQ------KV-L
ESPL1_HUMAN/1716-2069---------------------------------------------------------------PGPAQEA------SR-L
BIMB_EMENI/1605-2004---------------------------------------------------------------RFASAFE------NI-L
Q6V3V9_DROVI/167-544---------------------------------------------------------------QQTKAVY------GR-V
Q6ZHH8_ORYSJ/451-870---------------------------------------------------------------QHIEEAL------TN-L
Q6FTE1_CANGA/1147-1548---------------------------------------------------------------EFQSKIT------AI-L
Q8SRL6_ENCCU/365-731---------------------------------------------------------------RFAILRP------ST-L
Q7RB01_PLAYO/620-1007---------------------------------------------------------------KPTSANN------EL-S
ESPL1_MOUSE/1712-2065---------------------------------------------------------------PSLAQEA------SK-L
Q6NR96_XENLA/1471-1824---------------------------------------------------------------EAVAEEF------NR-L
ESP1_YEAST/1171-1571---------------------------------------------------------------KFKDKFY------EI-L
Q6CQQ7_KLULA/1114-1517---------------------------------------------------------------IFKKGFQ------SI-L
Q23491_CAEEL/745-1104---------------------------------------------------------------ALAIKMY------NM-A
Q6CCJ0_YARLI/1206-1588---------------------------------------------------------------SFAKSFN------RI-L
O82745_ARATH/1299-1653---------------------------------------------------------------KLPDSAQ------KK-L
CUT1_SCHPO/1379-1770---------------------------------------------------------------KFSSQFQ------NI-I
Q9VRN6_DROME/169-538---------------------------------------------------------------KQIKATY------TR-V
Q6V3V6_DROWI/170-538---------------------------------------------------------------KLSQQIF------RE-V

PF01364

KGP83_PORGN/244-595---------------------------------------------------------------EELTNII------DK-V
D1JG83_9ARCH/891-1295---------------------------------------------------------------YDASAVT------AR-T
A2U064_9FLAO/401-768---------------------------------------------------------------AEASVVV------DK-I
Q7MTE2_PORGI/239-573---------------------------------------------------------------EDLKTQI------DR-T
D3HWT0_9BACT/400-777---------------------------------------------------------------EDAKIMV------DK-T
Q5S3Q9_9FLAO/543-910---------------------------------------------------------------LQAQQIV------DK-I
A9DMD5_9FLAO/555-923---------------------------------------------------------------NQAKEMV------DK-T
B0VGA8_CLOAI/228-563---------------------------------------------------------------SQLDVLF------TK-I
B7B5I7_9PORP/382-753---------------------------------------------------------------EQATQMV------DK-V
B8FFM0_DESAA/254-600---------------------------------------------------------------DTMKKIC------AR-A
A3U7G6_CROAH/540-908---------------------------------------------------------------QLARTLV------DK-I
D2QSX9_SPILD/414-786---------------------------------------------------------------EEARTVV------DK-L
A3HW99_9BACT/398-769---------------------------------------------------------------QHLADYL------SK-A
B0VHP2_CLOAI/234-563---------------------------------------------------------------AELETQV------TR-S
A8ZUB1_DESOH/278-656---------------------------------------------------------------AELSNFF------SK-T
B0VIM2_CLOAI/182-528---------------------------------------------------------------SEFITMI------NK-T
Q2Z0E1_9BACT/643-1013---------------------------------------------------------------SELSTII------DK-I
B3QXR8_CHLT3/734-1131---------------------------------------------------------------SDISAYL------EK-L
C2MCN4_9PORP/405-781---------------------------------------------------------------EEAEAVV------DK-I
A4A325_9PLAN/24-399---------------------------------------------------------------EQLKIVV------AK-I
A7NR84_ROSCS/499-867---------------------------------------------------------------AEVQLLV------AK-I
Q11Q36_CYTH3/558-932---------------------------------------------------------------AQGDMIV------SK-L
Q7MX16_PORGI/272-637---------------------------------------------------------------HELHNLI------EK-T
A0B5K7_METTP/796-1154---------------------------------------------------------------YDVSQMV------AR-T
D0MH89_RHOM4/586-975---------------------------------------------------------------EEAQQVL------DK-I
A8UH97_9FLAO/539-910---------------------------------------------------------------QRAKEMV------DK-I
B8KYL6_9GAMM/364-704---------------------------------------------------------------EELDRMV------NK-V
B8FIK5_DESAA/1139-1542---------------------------------------------------------------DQASAYI------NK-L
Q11US7_CYTH3/392-767---------------------------------------------------------------SEVLGYL------EK-V
C6W101_DYAFD/326-680---------------------------------------------------------------QQLLHYL------LK-V
A5FJM8_FLAJ1/544-914---------------------------------------------------------------TQAQEIV------NK-V
Q7UG73_RHOBA/51-444---------------------------------------------------------------EQLASVI------GR-I
A3J247_9FLAO/540-919---------------------------------------------------------------SQANEMV------DK-V
A9WIM0_CHLAA/500-869---------------------------------------------------------------EELRRLV------AK-M
B0VHE7_CLOAI/227-554---------------------------------------------------------------ADLDVIL------AK-I
C6VT06_DYAFD/394-758---------------------------------------------------------------QQIMDYL------EK-V
C6X3N8_FLAB3/546-921---------------------------------------------------------------SEAKLLI------DK-T
A0LQH1_SYNFM/790-1132---------------------------------------------------------------SQLTAYV------AK-L
A1ZVJ9_9BACT/406-774---------------------------------------------------------------EEAANVV------TK-L
B0VHF1_CLOAI/214-595---------------------------------------------------------------AEIANFL------NK-L
B0VIE7_CLOAI/193-598---------------------------------------------------------------ANVTEIA------NR-I
C6W3P4_DYAFD/414-806---------------------------------------------------------------AQALAYL------RK-V
B2RGP6_PORG3/408-787---------------------------------------------------------------AEARIAV------DK-T
D2QJ99_SPILD/409-770---------------------------------------------------------------QEVMNYL------NK-V
A9B5Q8_HERA2/466-850---------------------------------------------------------------TEVSNLI------NK-I
D2QFF3_SPILD/397-745---------------------------------------------------------------DQVLTYL------DK-V
B0VH03_CLOAI/589-939---------------------------------------------------------------NELNIML------QN-F
D2R2P5_PIRSD/21-411---------------------------------------------------------------AELAQMV------AK-I
C6W0Z3_DYAFD/393-758---------------------------------------------------------------EEAKIVV------DK-L
A3XQP5_LEEBM/552-929---------------------------------------------------------------LLAKTAV------DK-I
C9RIY0_FIBSS/581-957---------------------------------------------------------------QEFEDYI------DK-A
Q2PY26_9BACT/412-780---------------------------------------------------------------SEAKSVV------DK-V
Q26FX7_FLABB/537-909---------------------------------------------------------------ISAREMV------DK-V
B0VJT2_CLOAI/236-566---------------------------------------------------------------SQFLVVL------NK-I
C6BTD6_DESAD/56-402---------------------------------------------------------------AEAESVA------AK-Y
D2QE53_SPILD/328-1007---------------------------------------------------------------AEAAAFV------DK-V
A2BK55_HYPBU/159-551---------------------------------------------------------------LSLSMYV------NS-L
B0VHP1_CLOAI/283-636---------------------------------------------------------------AEVTNQV------NK-T
Q1Q1Y4_9BACT/620-970---------------------------------------------------------------EQAEDII------NK-V
C7PNY3_CHIPD/396-764---------------------------------------------------------------SQAEVVV------NK-I
Q6LFY5_PHOPR/224-617---------------------------------------------------------------SQITTMV------NR-S
B3QVL4_CHLT3/688-1063---------------------------------------------------------------DEAALAV------DR-I
A9B187_HERA2/552-907---------------------------------------------------------------SDVEHVV------AK-I
B3C566_9BACE/537-910---------------------------------------------------------------AEAKATV------DK-T
B0VJY1_CLOAI/655-1014---------------------------------------------------------------QQILDYA------AK-A
B8G4Y1_CHLAD/584-1054---------------------------------------------------------------QAVRRTL------AN-S
A1ZEG7_9BACT/410-775---------------------------------------------------------------SQVLNYL------NK-V
B0VF22_CLOAI/223-583---------------------------------------------------------------TEFNNMF------RK-I
A0LKV0_SYNFM/924-1265---------------------------------------------------------------EQMESMA------DK-I
A8ZTD5_DESOH/257-648---------------------------------------------------------------DQAIKRV------ED-I
A9B8S0_HERA2/477-840---------------------------------------------------------------EDVTALI------AK-Q
C3JBB2_9PORP/421-799---------------------------------------------------------------GEAKAAV------DK-T
C9SW40_VERA1/279-917---------------------------------------------------------------AEANTFV------NK-T
C9LI59_9BACT/509-899---------------------------------------------------------------ETAKMLV------DK-T
B5ICF9_ACIB4/214-642---------------------------------------------------------------LTANKVV------NK-I
Y048_ARCFU/22-377---------------------------------------------------------------DEAEKVL------GK-I
A3I371_9BACT/360-725---------------------------------------------------------------EEANLVV------DK-I

PF11713

A0AED2_YEREN/2138-2301---------------------------------------------------------------HVKLDKQ......GR-Y
A0KHZ7_AERHH/3609-3767---------------------------------------------------------------VVQLDAD......GN-Y
A1EPL5_VIBCL/3469-3627---------------------------------------------------------------VVQLDSD......GN-Y
A2PYQ6_CLOPF/575-753---------------------------------------------------------------LVQ...E......IN-N
A3UPN6_VIBSP/3781-3944---------------------------------------------------------------VVQLDSD......GN-Y
A4TI66_YERPP/771-929---------------------------------------------------------------VLQFDAR.....SSE-A
A4TI66_YERPP/1083-1262---------------------------------------------------------------IIQLDVD......NN-H
A5KV80_9GAMM/1072-1230---------------------------------------------------------------IVQLDKD......GK-Y
A5L6I6_9GAMM/693-849---------------------------------------------------------------VVQLDAE......GK-Y
A5L6I6_9GAMM/1529-1710---------------------------------------------------------------VIHLPFDANGRATGD-F
A5L6I6_9GAMM/1908-2074---------------------------------------------------------------VIGIDSK......GV-Y
TOXA_CLODI/576-757---------------------------------------------------------------IIQRNMN......ES-A
TOXB_CLODI/574-755---------------------------------------------------------------LFQKNIE......DS-E
Q2KX68_BORA1/2483-2627---------------------------------------------------------------LRQWLAS......GE-T
Q2SAY5_HAHCH/1-160---------------------------------------------------------------LVEYDVA......SK-T
Q46149_CLONO/581-762---------------------------------------------------------------LIQGVDD......FA-N
Q46342_CLOSO/574-755---------------------------------------------------------------LYQKNIE......GS-E
Q7N1Z0_PHOLL/2456-2614---------------------------------------------------------------VIQLDAN......GK-Y
Q7N726_PHOLL/2997-3151---------------------------------------------------------------VVKLDSN......GK-Y
Q7VV06_BORPE/2551-2702---------------------------------------------------------------WYRQADD......GS-L
Q7VV06_BORPE/2959-3112---------------------------------------------------------------WYLQTRD......GG-L
Q7VV06_BORPE/3397-3549---------------------------------------------------------------WYSQDAS......GQ-L
Q7VV06_BORPE/3808-3959---------------------------------------------------------------WYGQTLE......GT-L

PF13900

B4E0H0_HUMAN/45-92--------------------------------------------------------------------------------
Q7Z4P3_HUMAN/54-101--------------------------------------------------------------------------------
Q6ZTF6_HUMAN/58-105--------------------------------------------------------------------------------
B9NCR3_POPTR/128-175--------------------------------------------------------------------------------
CN165_HUMAN/57-104--------------------------------------------------------------------------------
Q9P195_HUMAN/6-53--------------------------------------------------------------------------------
B3KRW9_HUMAN/44-91--------------------------------------------------------------------------------
Q6ZS53_HUMAN/79-126--------------------------------------------------------------------------------
Q6ZNG3_HUMAN/65-112--------------------------------------------------------------------------------
B7Z559_HUMAN/16-63--------------------------------------------------------------------------------
Q9BGW3_MACFA/24-71--------------------------------------------------------------------------------
Q6ZNU7_HUMAN/32-79--------------------------------------------------------------------------------
B9NCR2_POPTR/11-60--------------------------------------------------------------------------------
Q6ZNZ6_HUMAN/6-53--------------------------------------------------------------------------------
Q8N287_HUMAN/31-78--------------------------------------------------------------------------------
Q95KE1_MACFA/88-135--------------------------------------------------------------------------------
Q9UI48_HUMAN/14-61--------------------------------------------------------------------------------
Q9H5D5_HUMAN/64-111--------------------------------------------------------------------------------
Q9NR08_HUMAN/145-192--------------------------------------------------------------------------------
Q6ZSG7_HUMAN/16-63--------------------------------------------------------------------------------
B9NF68_POPTR/42-89--------------------------------------------------------------------------------
Q9P147_HUMAN/36-83--------------------------------------------------------------------------------
Q6ZQR8_HUMAN/34-81--------------------------------------------------------------------------------
C9JL81_HUMAN/280-327--------------------------------------------------------------------------------
Q96ID7_HUMAN/6-53--------------------------------------------------------------------------------
Q5T5H1_HUMAN/139-186--------------------------------------------------------------------------------
B7Z2Z5_HUMAN/303-350--------------------------------------------------------------------------------
C9JQS0_HUMAN/70-117--------------------------------------------------------------------------------
Q4R5J6_MACFA/21-68--------------------------------------------------------------------------------
Q9NX85_HUMAN/34-81--------------------------------------------------------------------------------
B4XZE4_HUMAN/24-71--------------------------------------------------------------------------------
Q6STG2_HUMAN/10-57--------------------------------------------------------------------------------
Q96LS9_HUMAN/23-70--------------------------------------------------------------------------------
Q6ZTX9_HUMAN/54-102--------------------------------------------------------------------------------
Q9P191_HUMAN/17-60--------------------------------------------------------------------------------

PF00656

Q7Q803_ANOGA/54-306...............................................................LTRKEIK------QV.L
Q7QGM9_ANOGA/35-227...............................................................KTKAEVT------RK.M
Q7PV92_ANOGA/14-237...............................................................PNRKQLL------SA.L
Q70VV0_PICAB/3-415............................................................YPQPTGANVR------RA.L
CASP4_MOUSE/132-369...............................................................LTAEGME------SE.M
CASP5_HUMAN/193-430...............................................................LTARDME------SV.L
MCA1_KLULA/138-430.........................................................TDPVRVPTKANML------RA.M
MCA9_ARATH/10-321..........................................................ESKVKPTGANIK------AA.L
MCA1_ARATH/80-362.........................................................TDPYRIPTKQNMR------MA.L
MCA1_DEBHA/146-437...........................................................RARIPTKENII------RA.M
MCA7_ARATH/3-401...............................................................PTGKNIR------QA.L
Q7Q1E0_ANOGA/62-291...............................................................FKLEEIK------SV.I
Q89XE4_BRAJA/58-278...............................................................ATKDDMV------RA.V
Q6N5Q1_RHOPA/33-253...............................................................LDGDTLR------GA.F
Q9ZSP8_HEVBR/3-415............................................................YIQPTGKNIR------RV.L
Q89FZ4_BRAJA/32-256...............................................................LAQNEMR------TA.I
Q6QN97_PIG/259-484...............................................................LKVEQIS------KI.L
Q7Q4X6_ANOGA/73-309...............................................................LKLRDLQ------KE.V
Q6E5N8_ICTPU/119-362...............................................................QTAEQMK------DL.L
Q6AKF4_DESPS/28-248...............................................................ADQEGFE------ES.V
O42284_CHICK/42-279...............................................................KTSQEMT------TV.M
Q7QKT2_ANOGA/35-260...............................................................KTTVEIR------HA.L
Q6N0T4_RHOPA/30-251...............................................................LSGDAMR------RA.F
Q9NHF9_DROME/56-302...............................................................LTFSEIN------DT.L
Q89HT8_BRAJA/51-272...............................................................LTQNDML------RV.V
Q87Z21_PSESM/2-225...............................................................VTSESLI------NA.I
CASP1_PIG/163-400...............................................................LTASDMA------IE.L
CASP3_XENLA/56-280...............................................................QKSSDII------GR.L
Q9I8J3_DANRE/238-473...............................................................LEAWAIK------DE.I
Q9GV88_HYDVU/84-316...............................................................PKSTDVL------NI.L
MCA4_ARATH/3-416............................................................STQPTGKNIR------RA.L
CASP2_RAT/200-445...............................................................QTAQEMQ------EK.L
Q9IB64_XENLA/261-494...............................................................LTAANIQ------KT.L
MCA2_ARATH/116-414...........................................................PMRWPTKNNIT------MA.M
Q9Y1U6_PRIPA/173-413...............................................................LTGKELH------NN.I
CASPD_BOVIN/136-373...............................................................LTARDME------SV.L
CASPE_MOUSE/22-256...............................................................PTAQQFL------EE.L
MCA1_ASHGO/154-449...........................................................PVRIPTKANIL------RA.M
PCP_DICDI/188-405...............................................................SDLRTFY------DK.W
Q8ITP2_BRAFL/151-396...............................................................KEITEIR------QI.L
Q7WDK3_BORBR/552-800...............................................................TSRASLI------ES.L
Q98UI8_DANRE/48-280...............................................................QTVAQIM------QV.L
ICE_DROME/94-328...............................................................CRYKDIL------RT.I
Q7PZJ9_ANOGA/20-250...............................................................KTKHEIR------DA.L
Q9NBW3_DROME/38-248...............................................................PALPDVK------NK.V
MCA5_ARATH/3-408............................................................STKPTGKNIR------RA.L
O88550_RAT/68-301...............................................................CSCAKMQ------DL.L
Q9DDJ2_DANRE/174-400...............................................................LSGKDIR------RA.V
Q985X8_RHILO/35-256...............................................................VDQESLR------GA.Y
CASP1_SPOFR/61-293...............................................................LKSEEIN------KF.I
CASP1_FELCA/161-406...............................................................LTAKDME------SE.L
Q9IB66_XENLA/58-298...............................................................LRTMDVL------EK.I
CFLAR_HUMAN/252-477...............................................................LSMHGIS------QI.L
CASP1_MOUSE/162-398...............................................................LTALEMV------KE.V
CASP2_CHICK/171-416...............................................................QSAEEME------SA.L
CASP1_DROME/79-313...............................................................CKLRDIL------KH.V
Q9DDL2_DANRE/323-560...............................................................LNWQEMH------SA.V
MCA1_SCHPO/130-422...........................................................QRAIPTRQNML------DA.M
Q8JIS8_ORYLA/58-285...............................................................QTVDQMK------KL.F
Q89IK1_BRAJA/30-253...............................................................LRQADMQ------DL.T
O93415_CHICK/57-299...............................................................LKAEDVL------KK.V
Q89MV1_BRAJA/176-400...............................................................LDKGAMD------IA.V
Q8IEW1_9TRYP/63-322..........................................................NFTAMPTRENII------KY.M
Q98IJ9_RHILO/30-261...............................................................QDNAGMH------GL.I
Q9TZP5_CAEEL/26-261...............................................................LKSSEIL------ET.V
Q7RFI8_PLAYO/964-1364NEKNNYTYNEEKKEKKYLFNLFNKKNIYDNKEVSNDYENNNSCVDVDIKNVDLSSKNIDFSLWPTRINIL------KA.V
MCA1_YARLI/168-458...........................................................QRSIPTKQNIL------QA.C
MCA1_CANGA/98-389...........................................................MVKIPLKENII------RA.M
Q8I6Y2_GEOCY/158-414...............................................................LTGKAMT------RE.F
Q98IJ6_RHILO/11-238...............................................................LTKQQTQ------VT.V
CASP1_HUMAN/163-400...............................................................LTASDMT------TE.L
Q9I9L7_DANRE/145-379...............................................................LSAKEMD------EA.I
Q8YS65_NOSS1/4-245..........................................................VSSTRPTRTHLR------RV.L
Q8ITP3_BRAFL/87-323...............................................................LPCRKIL------SV.L
Q98G71_RHILO/26-252...............................................................LGKRELE------RS.I
Q74F93_GEOSL/6-270...............................................................ATRAKVI------DA.I
CFLAR_MOUSE/257-481...............................................................PKSHDIT------QI.V
MCA6_ARATH/3-366............................................................SIKPTGKNIR------QA.L
Q8T8E8_9TRYP/84-341...........................................................NAIKPTRANIL------QH.M
CAS1A_XENLA/144-382...............................................................LTKTEMV------KV.M
CED3_CAEEL/243-494...............................................................LTGRGML------LT.I
Q53839_STRCH/9-268...............................................................CQSSEFI------DP.V
Q6DCI2_XENLA/78-314...............................................................KSCEEME------NL.L
B5VS82_YEAS6/157-450...........................................................LVRVPTRANMI------RA.M
Q6N329_RHOPA/73-298...............................................................LGQTELR------TK.V
Q6NTR7_XENLA/280-494...............................................................CNVEHLE------SI.L
Q7NPG1_GLOVI/7-278...........................................................YDAEATIKNVT------DG.L
CASP8_HUMAN/234-476...............................................................CTVEQIY------EI.L
Q98CE0_RHILO/5-238...............................................................RDLRRMR------RA.L
Q82I86_STRAW/5-276...............................................................ATVAAVE------DAVV
CASP1_CANFA/163-400...............................................................LTAKGME------SV.L
Q9I8S9_ONCMY/57-297...............................................................LKVEEVL------DQ.I
CASP9_HUMAN/161-413...............................................................LTAKKMV------LA.L
CASP6_MOUSE/28-270...............................................................LRAEELL------LK.I
Q8T8E6_9TRYP/84-343..........................................................GRTDQPTRDNIV------RY.M
Q6NBN5_RHOPA/57-277...............................................................ASRDEIL------RA.V
Q9IB63_XENLA/144-396...............................................................LTGQAMH------DH.L
Q89XG2_BRAJA/27-248...............................................................LTGDGMR------RA.F
Q90WU1_CHICK/237-479...............................................................CTAEEIR------NI.V
Q9GV89_HYDVU/93-318...............................................................LKREDII------NI.V
Q6PAD9_XENLA/268-495...............................................................LGSEEIR------DR.I
ICENC_DROME/196-443...............................................................VNQDQFF------KL.L
Q98JS7_RHILO/35-253...............................................................VKKSAEK------DL.N
CASP8_MOUSE/236-478...............................................................CTANEIH------EI.L
Q89KP2_BRAJA/86-307...............................................................LDGDTLR------KS.F
Q86FL0_ANOST/52-286...............................................................LDKKDLL------DE.L
P74453_SYNY3/40-299..............................................................GITLSALE------ILFD
CASPC_MOUSE/176-415...............................................................LTAQEME------TE.L
MCA8_ARATH/3-378............................................................CIQPTGKNIC------DE.L
Q8JG42_TAKRU/51-279...............................................................QTVNQMK------QL.L
Q90WU0_CHICK/148-400...............................................................LKAQEID------VE.L
Q89HP3_BRAJA/336-569...............................................................LDRAAMQ------KM.T
Q8I749_SUBDO/254-491...............................................................ISSSEMN------KVML
O93417_CHICK/53-281...............................................................LSSRDIF------KL.L
CASPE_HUMAN/18-241...............................................................PTAEQFQ------EE.L

PF14538

A2DJF0_TRIVA/81-229---------------------------------------------------------------QVELNFS------SP-I
A2DYB3_TRIVA/11-163---------------------------------------------------------------PSAQNVL------AM-L
A2DYM2_TRIVA/66-217---------------------------------------------------------------PSIEKLQ------N.-I
A2E336_TRIVA/52-203---------------------------------------------------------------KYFTRIP------CY-L
A2EZ34_TRIVA/86-237---------------------------------------------------------------PTIDKLS------N.-A
A2F8U1_TRIVA/62-211---------------------------------------------------------------PTINDFK------NS-L
A2F9H3_TRIVA/30-182---------------------------------------------------------------PSAQTVL------TL-L
A2FJN8_TRIVA/40-192---------------------------------------------------------------PPVKDAL------DM-M
A2G2E2_TRIVA/83-230---------------------------------------------------------------LSFKKLQ------E.-R
A2G590_TRIVA/29-181---------------------------------------------------------------PPGNKIS------EV-I
A2GCD5_TRIVA/96-248---------------------------------------------------------------PNADRLN------N.-L
A8Q911_MALGO/109-262---------------------------------------------------------------PIVEETK------RF-C
A9TBL2_PHYPA/90-243---------------------------------------------------------------PTVEDVK------KL-C
A9V5A2_MONBE/627-778---------------------------------------------------------------PTLDEVK------RL-C
B0CNS4_LACBS/33-186---------------------------------------------------------------PSVEDLR------RF-C
B0ENS2_ENTDS/37-190---------------------------------------------------------------PTYEDVR------RL-S
B0WBU4_CULQU/24-183---------------------------------------------------------------VCVTDLR------SA-C
B0WR30_CULQU/146-268---------------------------------------------------------------PMPEELR------RV-C
B3RPQ9_TRIAD/42-195---------------------------------------------------------------PTVEEVK------KL-C
B4R5C8_DROSI/213-366---------------------------------------------------------------PTVDDVK------KL-C
B6JY50_SCHJY/122-275---------------------------------------------------------------PSIEETK------KL-C
B7PLB3_IXOSC/91-248---------------------------------------------------------------PTVEEVK------KL-C
B8CBK6_THAPS/255-410---------------------------------------------------------------PTVEIVK------DL-C
B8P5W0_POSPM/106-259---------------------------------------------------------------PAYDDLR------KY-C
C4LXC3_ENTHI/41-195---------------------------------------------------------------PSIEKVK------KA-C
C5KFU4_PERM5/815-945---------------------------------------------------------------PTPDHLR------RV-C
D0N306_PHYIT/11-164---------------------------------------------------------------PTVEKIR------EL-C
D2VMD1_NAEGR/143-295---------------------------------------------------------------PTVEDVK------KT-C
D8LUT8_BLAHO/28-155---------------------------------------------------------------PCLNSVE------SA-I
D8RG53_SELML/71-224---------------------------------------------------------------PTADEVK------KL-C
D8T9J0_SELML/49-198---------------------------------------------------------------STVDEVK------KL-C
E1ZHR5_CHLVA/131-284---------------------------------------------------------------PTTEDVK------KL-A
E3Q6X3_COLGM/216-369---------------------------------------------------------------PSVEETK------KF-C
E4XFS5_OIKDI/47-229---------------------------------------------------------------QNIDNMV------RI-T
E4ZUC8_LEPMJ/159-315---------------------------------------------------------------PTTEETR------KY-T
E5SIN8_TRISP/43-196---------------------------------------------------------------PTVDDVR------RL-C
E6R3W2_CRYGW/91-244---------------------------------------------------------------PSIEDTK------KN-C
E7F7S1_DANRE/56-209---------------------------------------------------------------PTVDEVK------KL-C
E7LNC0_TRYCR/61-219---------------------------------------------------------------AHLEEAK------HL-M
E9BHG6_LEIDB/113-280---------------------------------------------------------------ASLEVSK------SA-L
E9CIT6_CAPO3/726-879---------------------------------------------------------------PTVDDIK------RL-C
F0W2J7_9STRA/129-282---------------------------------------------------------------PTVDETK------QL-C
F0XXV0_AURAN/11-165---------------------------------------------------------------PTADELR------RL-C
F0ZAV4_DICPU/114-267---------------------------------------------------------------PTVEEVK------KL-C
F1KR12_ASCSU/48-201---------------------------------------------------------------PTVEDVR------RL-C
Q0CHB3_ASPTN/188-344---------------------------------------------------------------PSVDETK------KF-C
Q6BQ71_DEBHA/64-218---------------------------------------------------------------PCVEDVK------RF-C
RTOR1_ARATH/103-256---------------------------------------------------------------PTVDEVR------KL-C

PF01650

VPEG_ARATH/59-330---------------------------------------------------------------VNVDNLF------AVIL
A0CQC7_PARTE/19-285---------------------------------------------------------------VNPANFL------NVLK
A2FXM6_TRIVA/13-267---------------------------------------------------------------VTATNFY------KVLT
O24539_VICNA/53-325---------------------------------------------------------------VTAENFY------AVIL
HGLB_SCHMA/37-291---------------------------------------------------------------VNSKTFL------KVLK
HGLB_SCHJA/31-285---------------------------------------------------------------VNPKTFL------QVLK
VPE_VICSA/56-325---------------------------------------------------------------VHADNFY------AALL
Q02SI3_PSEAB/341-579---------------------------------------------------------------LAER...------....
Q08BI0_DANRE/27-278---------------------------------------------------------------VKSKNFL------AVLR
Q0MYV8_EMIHU/33-301---------------------------------------------------------------VTPETFV------KVLT
Q22P32_TETTS/20-285---------------------------------------------------------------VTPKNYM------SVLT
Q22P33_TETTS/20-285---------------------------------------------------------------VTPKNYM------SVLT
Q2M438_PHYIN/25-298---------------------------------------------------------------VTPETFL------NVLT
Q2UVF3_HAECO/29-287---------------------------------------------------------------VTPSNFL------AILQ
Q4K5F2_PSEF5/335-570---------------------------------------------------------------LAER...------....
Q4RED0_TETNG/30-283---------------------------------------------------------------VTPENFL------AVLK
Q4UU48_XANC8/124-392---------------------------------------------------------------IGKR...------....
Q6EHZ7_TRIVA/12-258---------------------------------------------------------------VTADQFY------TVLT
Q6FEB2_ACIAD/229-477---------------------------------------------------------------IGQQ...------....
Q6L4R2_ORYSJ/41-319---------------------------------------------------------------VNVNNFL------AVLL
Q6NYJ7_DANRE/32-288---------------------------------------------------------------VTPENFL------AVLK
Q6PRC7_IXORI/38-293---------------------------------------------------------------VTPKNFL------SILQ
Q711M2_FASHE/21-278---------------------------------------------------------------TSVNT