Sequence alignment for CL0095

PF06866

Q898W9_CLOTE/5-163MVHYNDPLAYKI------------------------------------------------------------------MG
Q8R6L8_THETN/3-170FINIEDKNAFEN------------------------------------------------------------------FY
Q8EKU9_OCEIH/15-178RLHYKENN....------------------------------------------------------------------LP
Q8RCE8_THETN/5-162RLRYNEEKASFQ------------------------------------------------------------------IA
Q8XIE2_CLOPE/5-164KIYYKNYLAYYE------------------------------------------------------------------IS
Q899R5_CLOTE/6-172IINSNSKSAIIT------------------------------------------------------------------LR
YYAC_BACSU/17-181YVSHTDAAAAKQ------------------------------------------------------------------IQ
Q97HP9_CLOAB/17-181FSYNVDKENIEH------------------------------------------------------------------WI
Q97CW9_CLOAB/6-171VFNVDDSNILYS------------------------------------------------------------------FS
Q8XH36_CLOPE/6-172YINSLDPKASFK------------------------------------------------------------------IR
Q97F84_CLOAB/5-164KAFYNLPMAYYR------------------------------------------------------------------LS
Q97HQ0_CLOAB/4-165EKYYYEKNIQEE------------------------------------------------------------------FF
Q9K5N4_BACHD/15-179RVHMDDPQASDQ------------------------------------------------------------------LV

PF03418

GPR_BACMQ/17-370AVEAKDIALENQPKPNNQSEIKGVIVKEKEEQGVKISMVEITEEGAEAIGKKKGRYVTLESVGIREQDTEKQEAMEEVFA
GPR_BACSU/18-368AVETKEAMANQQAVPTK..EIKGFIEKERDHGGIKIRTVDVTKEGAELSGKKEGRYLTLEAQGIRENDSEMQEKVSAVFA

PF01750

HYCI_ECOLI/20-142PLLAEKCAA..APKG......NWVVIDGGS------------------------------------------------AP
HUPD_BRAJA/27-156VRAVEEFHRRYAVPD......NVTILDGGT------------------------------------------------QG
HYBD_ECOLI/20-148VRIVEALEQRYILPD......YVEILDGGT------------------------------------------------AG
O66898_AQUAE/19-146VRTVEELQRRYEFPE......NVKVLDGGT------------------------------------------------LG
FRXA_PYRFU/8-132IKIGRELKRQGYKVE...........ELGT------------------------------------------------DI
O26832_METTH/37-160PYLASLIQEAMEERG.......HLVINAGT------------------------------------------------VP
HYDD_WOLSU/1-132MHLSNLLKVNYRFEGP....HQVDVIDGGT------------------------------------------------LA
Y631_METJA/32-161IYVVKKLMRYFGEEKEFINIKNLYLINAGT------------------------------------------------VP
O25351_HELPY/22-151VHLAHYLKKNFSFFP......SVDIIDGGT------------------------------------------------MA
Y253_METJA/23-151CEVVSKLEKMNLPD.......NVEVIDAGA------------------------------------------------SG
HOXM_CUPNH/19-148VRCIETLQQRYQFAP......QVCLVDGGT------------------------------------------------QG
Q00396_METVO/35-169VHVIEKLQDLLTDE...E.KGHVALVDAGA------------------------------------------------GA
O28893_ARCFU/21-148IRVVEELKRRRLPKN.......VTVMDGGT------------------------------------------------GS
HYAD_ECOLI/23-152VRVAERLYAHYHWPE......YVEIVDGGT------------------------------------------------QG
O28900_ARCFU/15-130VKVAEMAKKAGFDAL.............AA------------------------------------------------FP
HOXM_AZOVI/23-152VRCVELLNERYRFPD......GVRLMDGGT------------------------------------------------QG
O58407_PYRHO/20-146IKVGKILKERGYRVE...........ELGT------------------------------------------------DV
Q50252_METMZ/25-156LKVIEILKKEEFKELEG.....LDIEDAGV------------------------------------------------CG
Q00392_METVO/26-163YHMIKRLNELKEQYPILN.SEKIQLIDAGT------------------------------------------------GA
FRHD_METTH/24-153PEVIKALEEYFKDRE..K.PDNVMFIDAGT------------------------------------------------GG
HUPD_THIRO/24-153VRAVEALQRHWVMSS......NVQLLDGGT------------------------------------------------QG
O58707_PYRHO/20-142ILVYEMLKGKIRDEA.......LLINCGNV------------------------------------------------PE
HUPD_RHILV/32-161VRAVEAFHKAYELSD......NVTILDGGT------------------------------------------------QG
O33166_METBA/25-151PAVV...EK.LKDLK..L.PENVTVVDAGL------------------------------------------------GG
O69401_DESGI/25-152VRLVEHLEARYDFSE......QVTLFDGGT------------------------------------------------LG
FRHD_METJA/45-179VHVIEKLNKILTDK...E.KQKIALVDAGA------------------------------------------------GA
HUPD_RHOCA/26-155VRCVERMAETHALPA......NVRLLDGGT------------------------------------------------QG

PF06866

Q898W9_CLOTE/5-163ETLSNFL.......NNNTIIVCVGTDKCIGDSLGPITGTIL-------------KEKNFP.LPVFGTVENPIHALNIKVK
Q8R6L8_THETN/3-170RTFQFYFKNLYKEPYREIILLCIGTDRSTGDSLGPLTGHKL-------------KPLLRNKAHVFGTLEDPLHAKNIIDV
Q8EKU9_OCEIH/15-178SLMCQHIMNWFPYQPREYVAVFIGTDRSTGDALGPLAGMYF-------------QSYKPRHIRVYGTIHEPVHAVNLEES
Q8RCE8_THETN/5-162NFLSRHL.......LPETVFLCIGTDRFITDSLGPIVGNLI-------------SGSLPPIYYVYGTLKNPVHAINLEEN
Q8XIE2_CLOPE/5-164NFLKNHI.......DEKTIIVCIGTDKCIGDCLGPLVGTLL-------------KEKFFP.LKVFGTLDSPIHALNLDKK
Q899R5_CLOTE/6-172DTLCGYITPVLAS.GKHIILLCIGSDRSTGDSLGPLVGHNL-------------KFLSRNNFHVFGNLEMPVHAKNLHQI
YYAC_BACSU/17-181TILSSSLRKAA...GKPIVVVCIGTDRSTGDSLGPLVGMKL-------------KQMQLTRFHVYGTLSDPVHAVNMKDK
Q97HP9_CLOAB/17-181SAILFQVLKD....KEDIVILSLGVDTLVGDSLGPLVGSIL-------------KRNGIP..NVYGTLDRTVNASNIIKI
Q97CW9_CLOAB/6-171NYLSSEIKSIAV..NRDIVFLCIGTDRSTGDSLGPMVGYKL-------------TKFHKNNLIVFGTLQEPVHAKNLCNT
Q8XH36_CLOPE/6-172DYLCRELSPVIKE.NRPIVFICIGSDRSTGDALGPLIGEKI-------------KFLSKNNIFIYGTLEETVHAGNLKET
Q97F84_CLOAB/5-164NFLKHYI.......DDNTIIICIGTDRCIGDCLGPMVGTML-------------KEKFFP.LNVYGTISEPIHALNIDKK
Q97HQ0_CLOAB/4-165KFLYSMTGK.....KEEIVVICIGDPVFEGNILAPLVGTLL-------------HERNIP..NVYGTLKEPVYEINIKEI
Q9K5N4_BACHD/15-179EQLLTHVSSYR...HRELVIVCIGTDRSTGDALGPIVGTAL-------------TKECLNCFHVYGTLADPVHAVNLEEK

PF03418

GPR_BACMQ/17-370KELNFFIKSLNIPDDASCLVVGLGNLSVTPDALGPKAVDNLLITRHLFELQPESVQDGFRPVSAIVPGVMGMTGIETSDI
GPR_BACSU/18-368EEFSAFLENLNISKDASCLIVGLGNWNVTPDALGPMAVENLLVTRHLFKLQPENVQEGYRPVSAFAPGVMGITGIETSDI

PF01750

HYCI_ECOLI/20-142ENDIVAIRELR..PTRLLIVDATDM.GLNPGEIRIIDPDDI-------------------A...EMFM.MTTHNMPLNYL
HUPD_BRAJA/27-156LYLVNYLEE....ADRLIVFDAIDY.GLEPGRLKLVRDDEV-------------------PR.FTGAKKMSLHQTGFQEV
HYBD_ECOLI/20-148MELLGDMAN....RDHLIIADAIVSKKNAPGTMMILRDEEV-------------------PA.LFTNK.ISPHQLGLADV
O66898_AQUAE/19-146IDLLYHIEG....TEKLLIIDAVLG.GKKPGTFYKIKNENV-------------------KK.YFKSK.VSMHELGIQEV
FRXA_PYRFU/8-132FSLMRVYNG....ENKVIIVDAVLG..EIPGKVVYFKGEDI-------------------FK.KLRAEIRSAHFMGAVEG
O26832_METTH/37-160ENFTGKIRSER..PSHILIVDAVEMR.EEPGTVRLIERDSI-------------------S.....EYSISTHAMPLSFL
HYDD_WOLSU/1-132QLLIPLITS....YDYVIVIDCVDAGGGKIGEVYFFDFDNV-------------------P..NVITWQGSAHEVEMLQT
Y631_METJA/32-161DFFTDILKEIK..PTHILIIDCALM.DKDVGEVKIIKEDEI-------------------IN.....YSFSTHTLPLSII
O25351_HELPY/22-151QQLIPLITS....YEKVLILDCVSAEGVEIGSVYAFDFKDA-------------------P..KEITWAGSAHEVEMLHT
Y253_METJA/23-151AYYLMTLVDED..IKKIIVVDAIDF.DLEPGTIKKIDVDEL-------------------PN.IKKYS.FDAHNVPLAPF
HOXM_CUPNH/19-148LYLIHHVQA....ASRLLIFDAIDY.GLPPGTLRIIEDEAV-------------------PK.FLGAKKMSLHQTGFQEV
Q00396_METVO/35-169PQQVLTLIDESSKVKNITVVDVIDY.GLEPGTIEILTKENL-------------------PN..PEHTRVDSHEWPLSTT
O28893_ARCFU/21-148FDLVNYFFF....YDVVVIVDAVNF.GGKPGRVYRLPVERV-------------------LK.RKIAS...IHDLDIFYA
HYAD_ECOLI/23-152LNLLGYVES....ASHLLILDAIDY.GLEPGTLRTYAGERI-------------------PA.YLSAKKMSLHQNSFSEV
O28900_ARCFU/15-130LDLPEMLEG....YDFAIVVDVLLG..KKTGEIHLLSVEDL-------------------KA..R..KVFTSHSIGVMEA
HOXM_AZOVI/23-152IYLVQHVQQ....ADCLIVFDAVDY.GLAPGTLKIVRDDEV-------------------PR.FMGAKRMSLHQTGFQDV
O58407_PYRHO/20-146FLLQRRYKG....EDRVIIVDAILS..DESGKVVHLKGEEI-------------------FQ.KLKAEIRSAHFMGAIEG
Q50252_METMZ/25-156LDLLNLLDG....ARKVIIVDAILA.GSPAGSVHRIEGRDL-------------------LKNAEFLPLISVHDLTITDV
Q00392_METVO/26-163FSLYFIINRWRTPLKKIVIADIIDY.GLEPGTLKKLCVEDI-------------------PN.LPKYH.VDAHDMPLAGM
FRHD_METTH/24-153PHFVFSLPH.EE.WKKMIVVDVVEF.NAEPGTLRKFDVTEI-------------------PK..GSYE..NMHTWPVSQP
HUPD_THIRO/24-153IYLVDRVRK....ADVLVVFDAVDY.GLPPGTMKRVEDDEV-------------------PR.FLGAKKMSLHQTGFQEV
O58707_PYRHO/20-142NYIGKIIDAD...PDLVILVDAVHF.GGKPGELVIVDPEET-------------------LG.....EAFSTHSLPLKVL
HUPD_RHILV/32-161LYLVQFVNE....HDRLIVFDAIDY.GLEPGTMKVVEDDEV-------------------PK.FTGAKKMSLHQTGFQEV
O33166_METBA/25-151PHFVFTLLNPES.TKTLIIVDIADF.GGEPGELRWLSVDEL-------------------PV..GSYR..DAHSWDLTEP
O69401_DESGI/25-152MRLMGPIME....CDLLIVLDAVLG.GDEPGAMYRLTGDDL-------------------RK.SLAFKN.SMHQTDLVDT
FRHD_METJA/45-179PQQVLTLIDENSKTKKIIVVDVIDW.GIKPGEIKIIEKDEL-------------------PN..PKYHRLDSHDWPLAPL
HUPD_RHOCA/26-155LYLLPFLEE....AEALIVFDAVDF.GFTPGTLVTMRDDDV-------------------PA.FMGAKKMSLHQTGFQDV

PF06866

Q898W9_CLOTE/5-163MSEIASLYPNHNIIGIDACLGES..NNIGFIQSRNYPIYPGKGVGKK------------LPHVGNHSIVGIVDS-TEINI
Q8R6L8_THETN/3-170LKEIRNTFYMPFTIAIDASLGSL..KHVGHISIGKGPIKPGAGVSKE------------LPPVGDMFVTGIVNI-SGFME
Q8EKU9_OCEIH/15-178LERIDKLHNNPFIIAIDACLGRS..TSIGHIITEKKSLQPGTALNKT------------LPAVGDVSITGVVNV-SGFME
Q8RCE8_THETN/5-162LRYIKKKHPYSKIIAVDASLGEE..ENIGKISIKKSPIHPGKGVGKI------------LPPVGDLSIVGIVDS-FHAKD
Q8XIE2_CLOPE/5-164ITEILKTYPGYKILAIDACLGDS..NSIGEIHARNEPIHPGKGVGKS------------LRSVGDMSIIAIVDS-SENID
Q899R5_CLOTE/6-172LKYINKKFDDPYIIAVDACLGHI..QNIGKVFVEDKPLKPGSAVNKD------------LPPVGNLSITGIVNI-SGTLE
YYAC_BACSU/17-181INDIHKLHKNPFVIAVDACLGRV..KSVGSFQIGDGPLKPGAGVQKD------------LPEVGDLHINGIVNV-SGFME
Q97HP9_CLOAB/17-181LDEIHERFKNPYILVVDAAVTAE..NNINDIVLRNGGFTPGFGVYRQ------------LPTVGDFSLVGVVNK-EDERE
Q97CW9_CLOAB/6-171MDIIKTKYENPFIIAIDACLGST..KTVGNIVIQNTPLSPGSAMNKS------------LPTVGDLSITGIVNV-SGPFD
Q8XH36_CLOPE/6-172VKIIKSKHKKPFIIAIDACLGAV..DNVGHVLIEKRPLKPGIALNKD------------LPEVGDLSILGIVNI-SGSLE
Q97F84_CLOAB/5-164LYKIKKDHTNSTIIGIDACLGDT..ENIGEIQVRDYAIHPGKGVGKS------------LPDVGEVSIVGIVDS-CESSE
Q97HQ0_CLOAB/4-165YNKILKKYDNPYIILVASSFPVDFHDEREVIVLKNDPYEIQTASGS.------------.LKLGNASFIVVFDL-EDS..
Q9K5N4_BACHD/15-179LKLIEKKHRRPFIIAIDACLGKL..SSVGKVSLAAGPVQPGAAVNKK------------LPAVGDVHLTGIVNI-GGMME

PF03418

GPR_BACMQ/17-370IFGVVKKVNPDFIIAIDALAARSIERVNATIQISDSGIHPGSGVGNKRKEISYETLGIPVIAIGIPTVVDAVSITSDTID
GPR_BACSU/18-368IKGVIEQSKPDFVIAIDALAARAVERVNTTIQISDTGIHPGSGVGNKRKDLSKDTLGVPVIAIGVPTVVDAVTIASDTVD

PF01750

HYCI_ECOLI/20-142IDQLKEDIG...EVIFLGIQPDI----------VGF....YYPMTQP------------IKDAVETVYQRLEGW------
HUPD_BRAJA/27-156ISAADLLGRCPKHLVLIGCQPLD----------LED...WGGPLTPP------------VRDQIAPSIDLACQV------
HYBD_ECOLI/20-148LSALRFTGEFPKKLTLVGVIPES----------LEP....HIGLTPT------------VEAMIEPALEQVLAA------
O66898_AQUAE/19-146LALLEVLEKPIKEIVVLGLEPKS----------LEV....STELTPE------------IQEKIPLLVEEALSQ------
FRXA_PYRFU/8-132LKLLLEVDERLKNAELHFVGVTI----------KEP..KLGLELSEE------------VKRAIPRAMELILSI------
O26832_METTH/37-160VRYLEDQG..AYRIALMGVQPEN----------LEF....GTGLSPA------------VEDAVHDLAGMIISA------
HYDD_WOLSU/1-132LRMTEVNGDLPPVKIVGVIPSII----------GSE...TAFDLSKE------------VAEASVTMEKIVLNH------
Y631_METJA/32-161VKYLKKFIN..AEIIILGIQPKI----------IDF.....CPISEE------------VKLSGDKLVNTLIEI------
O25351_HELPY/22-151LRLTEFLGDLPKTFIVGLVPFVI----------GSE...TTFKLSSK------------ILNALETALKAIETQ------
Y253_METJA/23-151LKDLHNK.GIEVVVIGCQGKEFT----------MPD...IKPGLSEE------------VAKAVDKAIEIILGE------
HOXM_CUPNH/19-148LLLAQLTGQYPQQVVLIGCQPEE----------LED...YGGSLRRV------------MKAAVEDAVEKGADL------
Q00396_METVO/35-169LNRVCTENDIKYKVIGCQAKYVS----------EPD...VVLELCEE------------VENAVDDAVKIILSD------
O28893_ARCFU/21-148ISAMSAIQAMPRVILIGAEVKNL----------AEF.SEMSSEAEEA------------VKKVVKRIVKLVTPS------
HYAD_ECOLI/23-152LALADIRGHLPAHIALVGLQPAM----------LDD...YGGSLSEL------------AREQLPAAEQAALAQ------
O28900_ARCFU/15-130IMLGFEYAEMP.EILIVAVEVGE----------KDD.....GALEKA------------LSVVMDVIAYEMCRR------
HOXM_AZOVI/23-152LALAAFSGAYPRELLLIGVQPEE----------LED...FGGSLREP------------VRAQLEPALRVALEF------
O58407_PYRHO/20-146LRLLIELDERLRRAELHFIGITI----------REENIKPNLELSEE------------ARKAIPKALEVIERI------
Q50252_METMZ/25-156LMIGEQVQTLPEIVVIGIEIGSR----------ATE...ITREISPD------------VFKGVDKAIRLIRKE------
Q00392_METVO/26-163LREINDDYGIEIVVIGCQQKRVT----------APD...ILLELSEE------------VTNSIDDAVKMVVDE------
FRHD_METTH/24-153LHELSEK..IDVVVIGCKPKEIS----------APN...VEMGLTPP------------VKKAIPRAIQMILDE------
HUPD_THIRO/24-153LALAAMLGDYPKHLLLIGVQPVE----------LDD...FGGSLRPQ------------IKERITPAIEMALEY------
O58707_PYRHO/20-142TKFIREN..TRAKVLLLGCQPRN----------VEF....LGVVSEE------------VKAAAERATNYIVRL------
HUPD_RHILV/32-161LSAADFMGHYPERLTLIGCQPLD----------LED...WGGPLTAP------------VRGVIPAAIETAVRV------
O33166_METBA/25-151LQYIKDD..IRIRVLACQKKYVS----------SPE...MVIGITDE------------VQRAIPDAVSEILKE------
O69401_DESGI/25-152LIFCQLAGHCPEAVIIG.MEPFD----------YET...MHPEISPL------------AQERLPLMAEVALKE------
FRHD_METJA/45-179LREVAEKYNIEVKVVGCQAKYIS----------EPD...VYIGLSEE------------VEKAVDKAVEIILRE------
HUPD_RHOCA/26-155IATAQLMGYCPSRMTLIGCQPVE----------LED...YGGSLRPA------------VAGQIDFAIAEAVRE------

PF06866

Q898W9_CLOTE/5-163FN....NNSIRLN-------------------------------------------------------------------
Q8R6L8_THETN/3-170YM...VLQNTRLR-------------------------------------------------------------------
Q8EKU9_OCEIH/15-178HS...ILQNTRLS-------------------------------------------------------------------
Q8RCE8_THETN/5-162LN......SIRLG-------------------------------------------------------------------
Q8XIE2_CLOPE/5-164LF...TSRPIRLS-------------------------------------------------------------------
Q899R5_CLOTE/6-172FM...VLQNTRLF-------------------------------------------------------------------
YYAC_BACSU/17-181YF...VLQNTRLN-------------------------------------------------------------------
Q97HP9_CLOAB/17-181HNLIELLKKCRFD-------------------------------------------------------------------
Q97CW9_CLOAB/6-171FM...VLQSTRLY-------------------------------------------------------------------
Q8XH36_CLOPE/6-172FM...VLQNTRLY-------------------------------------------------------------------
Q97F84_CLOAB/5-164LF...TNRNIRLN-------------------------------------------------------------------
Q97HQ0_CLOAB/4-165YCKVNFIEKLGIR-------------------------------------------------------------------
Q9K5N4_BACHD/15-179YF...VLQNTRLH-------------------------------------------------------------------

PF03418

GPR_BACMQ/17-370FILKHFGREMKEQGKPSKSLLPSGMTFGEKKKLTEDDLPNEEQRQTYLGMIGTLPDEEKRRLIHEVLAPLGHNLMVTPKE
GPR_BACSU/18-368YILKHFGREMKDN.RPSRSLVPAGMTFGKKKVLTEDDLPDQKQRQSFLGIVGTLQEDEKRQLIHEVLSPLGHNLMVTPKE

PF01750

HYCI_ECOLI/20-142--------------------------------------------------------------------------------
HUPD_BRAJA/27-156--------------------------------------------------------------------------------
HYBD_ECOLI/20-148--------------------------------------------------------------------------------
O66898_AQUAE/19-146--------------------------------------------------------------------------------
FRXA_PYRFU/8-132--------------------------------------------------------------------------------
O26832_METTH/37-160--------------------------------------------------------------------------------
HYDD_WOLSU/1-132--------------------------------------------------------------------------------
Y631_METJA/32-161--------------------------------------------------------------------------------
O25351_HELPY/22-151--------------------------------------------------------------------------------
Y253_METJA/23-151--------------------------------------------------------------------------------
HOXM_CUPNH/19-148--------------------------------------------------------------------------------
Q00396_METVO/35-169--------------------------------------------------------------------------------
O28893_ARCFU/21-148--------------------------------------------------------------------------------
HYAD_ECOLI/23-152--------------------------------------------------------------------------------
O28900_ARCFU/15-130--------------------------------------------------------------------------------
HOXM_AZOVI/23-152--------------------------------------------------------------------------------
O58407_PYRHO/20-146--------------------------------------------------------------------------------
Q50252_METMZ/25-156--------------------------------------------------------------------------------
Q00392_METVO/26-163--------------------------------------------------------------------------------
FRHD_METTH/24-153--------------------------------------------------------------------------------
HUPD_THIRO/24-153--------------------------------------------------------------------------------
O58707_PYRHO/20-142--------------------------------------------------------------------------------
HUPD_RHILV/32-161--------------------------------------------------------------------------------
O33166_METBA/25-151--------------------------------------------------------------------------------
O69401_DESGI/25-152--------------------------------------------------------------------------------
FRHD_METJA/45-179--------------------------------------------------------------------------------
HUPD_RHOCA/26-155--------------------------------------------------------------------------------

PF06866

Q898W9_CLOTE/5-163---FILNMAKSISHS-------------------
Q8R6L8_THETN/3-170---TVMKMADIIAAG-------------------
Q8EKU9_OCEIH/15-178---VVMDMAKQVSSI-------------------
Q8RCE8_THETN/5-162---FIYEIAETIANG-------------------
Q8XIE2_CLOPE/5-164---FILDMSKVIVDS-------------------
Q899R5_CLOTE/6-172---TVMQLAELISNG-------------------
YYAC_BACSU/17-181---LVMNMANVLAEG-------------------
Q97HP9_CLOAB/17-181---EVLKLARIISKI-------------------
Q97CW9_CLOAB/6-171---SVLKLADIISRG-------------------
Q8XH36_CLOPE/6-172---TVMLLANAISNG-------------------
Q97F84_CLOAB/5-164---LIFEMSKVIVQT-------------------
Q97HQ0_CLOAB/4-165---KIYKYSEAIFKT-------------------
Q9K5N4_BACHD/15-179---TVMQLADTISSS-------------------

PF03418

GPR_BACMQ/17-370VDMFIEDMANVVAGGLNAALHHEVDQENFGAYTH
GPR_BACSU/18-368VDSFIDDMANVLANGLNTALHEKVSQENKGSYNH

PF01750

HYCI_ECOLI/20-142----------------------------------
HUPD_BRAJA/27-156----------------------------------
HYBD_ECOLI/20-148----------------------------------
O66898_AQUAE/19-146----------------------------------
FRXA_PYRFU/8-132----------------------------------
O26832_METTH/37-160----------------------------------
HYDD_WOLSU/1-132----------------------------------
Y631_METJA/32-161----------------------------------
O25351_HELPY/22-151----------------------------------
Y253_METJA/23-151----------------------------------
HOXM_CUPNH/19-148----------------------------------
Q00396_METVO/35-169----------------------------------
O28893_ARCFU/21-148----------------------------------
HYAD_ECOLI/23-152----------------------------------
O28900_ARCFU/15-130----------------------------------
HOXM_AZOVI/23-152----------------------------------
O58407_PYRHO/20-146----------------------------------
Q50252_METMZ/25-156----------------------------------
Q00392_METVO/26-163----------------------------------
FRHD_METTH/24-153----------------------------------
HUPD_THIRO/24-153----------------------------------
O58707_PYRHO/20-142----------------------------------
HUPD_RHILV/32-161----------------------------------
O33166_METBA/25-151----------------------------------
O69401_DESGI/25-152----------------------------------
FRHD_METJA/45-179----------------------------------
HUPD_RHOCA/26-155----------------------------------

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window