Sequence alignment for CL0114

PF09011

B6KTZ4_TOXGO/9-86--------------------------------------------------------------------------------
A2E233_TRIVA/26-97--------------------------------------------------------------------------------
C3Z277_BRAFL/6-77--------------------------------------------------------------------------------
A7YYD4_DANRE/6-79--------------------------------------------------------------------------------
D2HQ61_AILME/6-79--------------------------------------------------------------------------------
MAEL_XENTR/2-73--------------------------------------------------------------------------------
Q66IA8_DANRE/6-79--------------------------------------------------------------------------------
B3XZN8_9BIVA/16-88--------------------------------------------------------------------------------
MAEL_HUMAN/2-73--------------------------------------------------------------------------------
B3S6M5_TRIAD/36-107--------------------------------------------------------------------------------

PF00505

MTMC3_SCHPO/103-171--------------------------------------------------------------------------------
HMGH_IIV6/54-122--------------------------------------------------------------------------------
YF98_SCHPO/195-263--------------------------------------------------------------------------------
NHP6A_YEAST/21-89--------------------------------------------------------------------------------
UBF1_HUMAN/112-180--------------------------------------------------------------------------------
HMGL_SOYBN/44-113--------------------------------------------------------------------------------
HMGL_TRYBR/118-186--------------------------------------------------------------------------------
LEF1_MOUSE/297-365--------------------------------------------------------------------------------
FPR1_PODAS/169-237--------------------------------------------------------------------------------
MATB_NEUCS/116-184--------------------------------------------------------------------------------
HMGL_IPONI/36-105--------------------------------------------------------------------------------
HMGL_VICFA/45-114--------------------------------------------------------------------------------
HMGL_WHEAT/42-111--------------------------------------------------------------------------------
HMG1A_CHITE/5-71--------------------------------------------------------------------------------
HMG_TETPY/11-79--------------------------------------------------------------------------------
HMGB_TETTH/18-86--------------------------------------------------------------------------------
TFAM_MOUSE/49-117--------------------------------------------------------------------------------
NHP1_BABBO/23-93--------------------------------------------------------------------------------
HMGH_STRPU/100-168--------------------------------------------------------------------------------
SRY_GORGO/60-128--------------------------------------------------------------------------------
SOX2_CHICK/39-107--------------------------------------------------------------------------------
SOX9_CHICK/106-174--------------------------------------------------------------------------------
HMGB1_RAT/95-163--------------------------------------------------------------------------------
TFAM_HUMAN/50-118--------------------------------------------------------------------------------
ABF2_YEAST/43-111--------------------------------------------------------------------------------
MAT2_COCHE/131-199--------------------------------------------------------------------------------
SSRP1_DROME/555-621--------------------------------------------------------------------------------
SOX4_HUMAN/59-127--------------------------------------------------------------------------------
SMR2_PODAS/161-229--------------------------------------------------------------------------------
SSRP1_HUMAN/547-615--------------------------------------------------------------------------------
MATD_NEUCR/147-215--------------------------------------------------------------------------------

PF08073

Q7PZN7_ANOGA/152-206--------------------------------------------------------------------------------
CHD3_HUMAN/147-201--------------------------------------------------------------------------------
CHDM_DROME/136-190--------------------------------------------------------------------------------
CHD3_CAEEL/96-150--------------------------------------------------------------------------------
Q7ZWN3_XENLA/147-201--------------------------------------------------------------------------------

PF04690

YAB1_ARATH/16-189PDHFSPSDHLCYVQCNFCQTILAVNVPYTSLFKTVTVRCGCCTNLLS..VNMRS....YVLPASNQLQLQLGPHSYFNPQ
YAB3_ARATH/16-201PDHFSSTDQLCYVHCSFCDTVLAVSVPPSSLFKTVTVRCGHCSNLLSVTVSMRA....LLLPSVSNLGHSFLPPPPPPPP
YAB4_ARATH/12-183NHLFDLPGQICHVQCGFCTTILLVSVPFTSLSMVVTVRCGHCTSLLSVNLMKASFIPLHLLASLSHLDETGKEE......
YAB1_ORYSJ/1-157MSVQFTSEHVCYVNCNYCNTILVVNVPNNCSYNIVTVRCGHCTMVLSMDLAPFH....QARTVQDH..............
YAB2_ARATH/1-160MSVDFSSERVCYVHCSFCTTILAVSVPYASLFTLVTVRCGHCTNLLSLNIGVSL....HQTSAPP...............
YAB2_ORYSJ/3-161AQIVPAPEHVCYVHCNFCNTIFAVSVPSNSMLNIVTVRCGHCTSLLSVNLRGLV....QALPAEDH..............

PF14887

Q07G04_XENTR/201-285--------------------------------------------------------------------------------
Q60460_CRIGR/442-526--------------------------------------------------------------------------------
Q4T4S3_TETNG/484-569--------------------------------------------------------------------------------
C0H9W0_SALSA/436-525--------------------------------------------------------------------------------

PF06382

Q9VAF7_DROME/1-125------------------------------------------------------------M...................
Q8MZC5_DROME/1-187------------------------------------------------------------MANVKIQAPTFGAGEQVSLG
Q9V3S3_DROME/1-146------------------------------------------------------------MSSNNVNECKSLWNGIISIS

PF06244

Q4Z043_PLABA/97-260------------------TQAQILQRLIEEKKKEMKDEKKKTENTNIH..EMELEDNLNHIIRDEMGNYDECINGKKKKK
Q9GUM1_CAEEL/95-217------------------TRAHIHIRKEDEERINRELEEKRKQEAQK...IEVAGDLLVENLNKLEVEEGE.........
C124B_XENLA/95-210------------------TRAQIEETLCKEEKHKDAPEKPKTHL......EIPLEE..NVNRRVLEEGEVE.........
Q4SFG3_TETNG/96-215------------------TRAQIEEALQAEQLKQEQLELKPKVMTHL...EVPLEE..NINRVVPDEGTVE.........
CC124_MOUSE/95-209------------------TRAQIEDSLRREQRAEPVEKAKSHL.......ELPLEE..NLNRRLQEEGSVE.........
CC124_PONAB/96-215------------------TRAQIEDTLRRDHQLREAPDTAEKAKSHL...EVPLEE..NVNRRVLEEGSVE.........
Q01JB1_ORYSA/104-232------------------TEAELARRREDERLRLEREAEAAKKRAARTAEEEEYERVVLVANTNRDDSIIE.........
Q8VYC9_ARATH/102-227------------------TEAELIRRREEDQVALAKKAEDSKKKQTRMAGEDEYEKMVLVTNTNRDDSLIE.........
CC124_DANRE/94-209------------------TRAQIEETLQSKQNVKEIKEKEKSHL......DVPLEE..NVNRIVPEEGTVE.........
Q16YV3_AEDAE/92-208------------------TRAQIDAEVEKRNRAIETVNNPPKP.......VVPKTPAIEENLNRMMAETEV.........
Q9VE08_DROME/92-212------------------NRQMILEEMEKKQRVIEAINEANKPMAAR...VVVQ.NHIEENLNRSMADTDV.........
Q5DAC0_SCHJA/96-212------------------TQTQIAEARRKLEAQLLALNQTSQKSEPP.........ELAPNPNRIETDELE.........
CC124_SCHPO/79-179------------------SKKAAKKNSSLDAFLNETPQTASYS.....................................
Q4X4X0_PLACH/118-278------------------TQAQILQRLIEEKKKEMKDEKKKTGNVNVH..EMELEDNINHIIRDEMNNYDECINGKKIIK

PF09011

B6KTZ4_TOXGO/9-86-----------------------------------------------------------AKRSRAAPSAYFLFAKKEQAT
A2E233_TRIVA/26-97-----------------------------------------------------------PPKPKRPPNAYNLYYLEMQPK
C3Z277_BRAFL/6-77-----------------------------------------------------------KNKPQR..NGFWVYMQEMIPE
A7YYD4_DANRE/6-79-----------------------------------------------------------VNKPKGKTSAYAFFVQTCRDE
D2HQ61_AILME/6-79-----------------------------------------------------------PKKPKGKMSAYAFFVQTCREE
MAEL_XENTR/2-73-----------------------------------------------------------PNK.KAARNAYFFFALDMIPE
Q66IA8_DANRE/6-79-----------------------------------------------------------PGKPKGKMSAYAYFVKTCREE
B3XZN8_9BIVA/16-88-----------------------------------------------------------PNKPKRSTSAYFYFLGKMRED
MAEL_HUMAN/2-73-----------------------------------------------------------PNR.KASRNAYYFFVQEKIPE
B3S6M5_TRIAD/36-107-----------------------------------------------------------PKKPKRARNSYLMYMTDRWNQ

PF00505

MTMC3_SCHPO/103-171--------------------------------------------------------------TPRPPNAFILYRKEKHAT
HMGH_IIV6/54-122--------------------------------------------------------------PKRNKSSYLFFCQEIRPS
YF98_SCHPO/195-263--------------------------------------------------------------KITDTMLFNHFSSIQKPK
NHP6A_YEAST/21-89--------------------------------------------------------------PKRALSAYMFFANENRDI
UBF1_HUMAN/112-180--------------------------------------------------------------PKKPLTPYFRFFMEKRAK
HMGL_SOYBN/44-113--------------------------------------------------------------PKRPPSAFFVFMEEFRKV
HMGL_TRYBR/118-186--------------------------------------------------------------PKPAVSSYLLFVADQREE
LEF1_MOUSE/297-365--------------------------------------------------------------IKKPLNAFMLYMKEMRAN
FPR1_PODAS/169-237--------------------------------------------------------------IPRPPNAYILYRKDQQAA
MATB_NEUCS/116-184--------------------------------------------------------------IPRPPNAYILYRKDHHRE
HMGL_IPONI/36-105--------------------------------------------------------------PKRPPSAFFVFMEDFRKT
HMGL_VICFA/45-114--------------------------------------------------------------PKRPPSAFFVFMADFREQ
HMGL_WHEAT/42-111--------------------------------------------------------------PKRAPSAFFVFMGEFREE
HMG1A_CHITE/5-71--------------------------------------------------------------PKRPLSAYMLWLNSARES
HMG_TETPY/11-79--------------------------------------------------------------PKRPLSAFFLFKQHNYDQ
HMGB_TETTH/18-86--------------------------------------------------------------PKRPQTGFFIYKSEVFAK
TFAM_MOUSE/49-117--------------------------------------------------------------PKKPMSSYLRFSTEQLPK
NHP1_BABBO/23-93--------------------------------------------------------------PKRALSSYMFFAKEKRVE
HMGH_STRPU/100-168--------------------------------------------------------------PKRNLSAFFIFSGENRAA
SRY_GORGO/60-128--------------------------------------------------------------VKRPMNAFIVWSRDQRRK
SOX2_CHICK/39-107--------------------------------------------------------------VKRPMNAFMVWSRGQRRK
SOX9_CHICK/106-174--------------------------------------------------------------VKRPMNAFMVWAQAARRK
HMGB1_RAT/95-163--------------------------------------------------------------PKRPPSAFFLFCSEYRPK
TFAM_HUMAN/50-118--------------------------------------------------------------PKKPVSSYLRFSKEQLPI
ABF2_YEAST/43-111--------------------------------------------------------------PKRPTSAYFLYLQDHRSQ
MAT2_COCHE/131-199--------------------------------------------------------------APRPMNCWIIFRDAMHKH
SSRP1_DROME/555-621--------------------------------------------------------------PKRATTAFMLWLNDTRES
SOX4_HUMAN/59-127--------------------------------------------------------------IKRPMNAFMVWSQIERRK
SMR2_PODAS/161-229--------------------------------------------------------------IRRPRNQFIIYRQWMSAR
SSRP1_HUMAN/547-615--------------------------------------------------------------PKRPMSAYMLWLNASREK
MATD_NEUCR/147-215--------------------------------------------------------------TSRPRNQFVLYYQWLLDT

PF08073

Q7PZN7_ANOGA/152-206------------------------------------------------------VKIEYTEEDFENLVTFKMFQTHVRPI
CHD3_HUMAN/147-201------------------------------------------------------VEHVFSEEDYHTLTNYKAFSQFMRPL
CHDM_DROME/136-190------------------------------------------------------VEIEYSEEELQSLTTYKAFMHHVRPI
CHD3_CAEEL/96-150------------------------------------------------------VDVDYEQEEFQSITNLKNFSSLVKPY
Q7ZWN3_XENLA/147-201------------------------------------------------------IDHVFTEDDYRTLTNYKAFSQFVRPL

PF04690

YAB1_ARATH/16-189D.ILEELRDAPSNMNMMMMNQHPTMNDIPSFM.........DLHQQHEIPKAPP.VNRPPEKRQRVPSAYNRFIKEEIQR
YAB3_ARATH/16-201PNLLEEMRSGGQNINMNMMMSHHASAHHPNEHLVMATRNGRSVDHLQEMPRPPP.ANRPPEKRQRVPSAYNRFIKEEIQR
YAB4_ARATH/12-183..VAATDGVEEEAWKVNQEKENSPTTLVSS...........SDNEDEDVSRVYQVVNKPPEKRQRAPSAYNCFIKEEIRR
YAB1_ORYSJ/1-157..QVQNRGFQGNNFGSYDIASRNQRTSTAMYPM........PTSQQQVSP......IRPPEKRQRVPSAYNRFIKEEIQR
YAB2_ARATH/1-160..IHQDLQPHRQHTTSLVTRKDCASSSRSTNNL........SENIDREAPRMPP..IRPPEKRQRVPSAYNRFIKEEIQR
YAB2_ORYSJ/3-161..LQDNLKMHNMSFRENYSEYGSSSRYGRVPMMF.......SKNDTEHMLH.....VRPPEKRQRVPSAYNRFIKEEIRR

PF14887

Q07G04_XENTR/201-285-----------------------------------------------------------AKLPETPKTAEEIWQQSVIGD
Q60460_CRIGR/442-526-----------------------------------------------------------GKLPESPKRAEEIWQQSVIGD
Q4T4S3_TETNG/484-569-----------------------------------------------------------SRLPDPPKTAQEIWQQSVIGD
C0H9W0_SALSA/436-525-----------------------------------------------------------TKLPETPKTAEEMWQQGVVGD

PF06382

Q9VAF7_DROME/1-125...........................................GRKRGRKEYCPPIYKRQKVARVTNNGYLNFMTEYKKR
Q8MZC5_DROME/1-187GQGLTDIPSTRHANIISVKIRFRVKTVTGAFWEIQSLHKIQRMGRKRGRKEYCPPIYKRQKVARVTNNGYLNFMTEYKKR
Q9V3S3_DROME/1-146AK...DESPKGLTEMCNHPIR.RAPQKCKPMKSCAKPRRKAACAKATRPKVKCAPRQKCSKQGPVTNNAYLNFVRSFRKK

PF06244

Q4Z043_PLABA/97-260NNILHSFIIYFKYINILNLNLWRMITSYYIIFYFCLATGIDNIINSLG........NVSFEKTKKVKAAYKKYEEENLPL
Q9GUM1_CAEEL/95-217....................................ARNVDDALKVLGEEKAL...DDDKHPEKRMRAAYLAFEEARLPE
C124B_XENLA/95-210....................................ARTVEDAIAALSIGK.....ELDRHPERRMKAAFTAFEEINMPL
Q4SFG3_TETNG/96-215....................................ARTIEDAIAALSTGPE....DQDHHPERRMKAAFSAYEEANMPR
CC124_MOUSE/95-209....................................ARTVEDAIAVLSVAE.....EADRHPERRMRAAFTAFEEVQLPR
CC124_PONAB/96-215....................................ARTIEDAIAVLSVAEE....AADRHPERRQRAAFTAFEEAQLPR
Q01JB1_ORYSA/104-232....................................ARSVDEAIARMSLVDSEGALPADKHPERRLKASFKAFEEAELPK
Q8VYC9_ARATH/102-227....................................AHTVDEALARITVSDNL...PVDRHPEKRLKASFKAYEEVELPR
CC124_DANRE/94-209....................................ARTIEDAIAVLSTKE.....DLDRHPERRMKAAYTAFEEANMPR
Q16YV3_AEDAE/92-208....................................AQTIDQAIAVLNVKD.....GEDRHPEKRMKAAFKAYEDEQLPI
Q9VE08_DROME/92-212....................................ASNIDEAIVVLSVNDS....EEDKHPEKRMRAAYKTFEANNLPR
Q5DAC0_SCHJA/96-212....................................ARTVKEAISILSVNNEG...DGDRHPEKRLKAAYQAFEERMMPH
CC124_SCHPO/79-179....................................ARNIDDALDLLSLNNSSSKDKIDRHPERRFKAALTEYKQSRLPE
Q4X4X0_PLACH/118-278KMMIFYIFVCSLNYNVWRMVRVIYYVFIFYFCL...ATGIDNIISSLG........NVSFEKTKKVKAAYKKYEEENLPL

PF09011

B6KTZ4_TOXGO/9-86IRQQLANESGRE..RIPLGEVQKALSEKWRNISSAEREAYYE--------------EAREKKQ-----------------
A2E233_TRIVA/26-97MKAE......NP..LIGGNDVSKLIGQQWGALSDEQKKPYIE--------------KANEIRE-----------------
C3Z277_BRAFL/6-77YKRQ.....GYQ.MPNGMADVVKLAHPSWKAMPEMEKQEYER--------------QAKELKK-----------------
A7YYD4_DANRE/6-79HKRK......GPDVPVNFSEFSKKCSERWKSLNASDKVKFED--------------MAKADKV-----------------
D2HQ61_AILME/6-79HKKK......NPEVPVNFAEFSKKCSERWKTMSGKEKSKFDE--------------MAKADKV-----------------
MAEL_XENTR/2-73LRRR.....GLQ..VSGVREAIPLCSEDWALLSADQKEAYAE--------------KARLLKN-----------------
Q66IA8_DANRE/6-79HNKK......NPGVTVNFSEFSKKCSERWKTMSPKEKTKFED--------------LAKQDKA-----------------
B3XZN8_9BIVA/16-88AKSS.....GKP..ITKIAEFTKESSAKWAKMTDKDKEPFNK--------------KAAADKK-----------------
MAEL_HUMAN/2-73LRRR.....GLP..VARVADAIPYCSSDWALLREEEKEKYAE--------------MAREWRA-----------------
B3S6M5_TRIAD/36-107AKES......GQ..VPEIREFTEESSSNWRNMSEEEKEEYHQ--------------RAQIDRN-----------------

PF00505

MTMC3_SCHPO/103-171LLKS------NPSIN..NSQVSKLVGEMWRNESKEVRMRYFK--------------MSEFYKA-----------------
HMGH_IIV6/54-122IVAE------MPDIK..PNQVMVHLGKKWSELPLEDRKKYDV--------------MAVEDRK-----------------
YF98_SCHPO/195-263LKAE------GSTLK..GQALKKTLEDTWNNLTEEEKKPYHE--------------GLLAARE-----------------
NHP6A_YEAST/21-89VRSE------NPDIT..FGQVGKKLGEKWKALTPEEKQPYEA--------------KAQADKK-----------------
UBF1_HUMAN/112-180YAKL------HPEMS..NLDLTKILSKKYKELPEKKKMKYIQ--------------DFQREKQ-----------------
HMGL_SOYBN/44-113FNKE------HPENK.AVSAVGKAAGAKWKTMSDAEKAPYVA--------------KSEKRKV-----------------
HMGL_TRYBR/118-186LKAK------NPGMQ..NTAILQTLGKMWSDASDDVKEHYRK--------------KAEEDKA-----------------
LEF1_MOUSE/297-365VVAE------CTLKE..SAAINQILGRRWHALSREEQAKYYE--------------LARKERQ-----------------
FPR1_PODAS/169-237LKAA------NPGIP..NNDISVMTGGMWKKESPEVRAEYQR--------------RASEIKA-----------------
MATB_NEUCS/116-184IREQ------NPGLH..NNEISVIVGNMWRDEQPHIREKYFN--------------MSNEIKT-----------------
HMGL_IPONI/36-105YKEK------HPNNK.SVAVVGKAGGDKWKQLTAAEKAPFIS--------------KAEKRKQ-----------------
HMGL_VICFA/45-114YKKD------HPNNK.SVAAVGKACGEEWKSLSEEEKAPYVD--------------RALKKKE-----------------
HMGL_WHEAT/42-111FKQK------NPKNK.SVAAVGKAAGERWKSLSESEKAPYVA--------------KANKLKG-----------------
HMG1A_CHITE/5-71IKKE------NPDFK..VTEIAKKGGELWRGM..KDKSEWEA--------------KAAKMKE-----------------
HMG_TETPY/11-79VKKE------NPNAK..ITELTSMIAEKWKHVTEKEKKKYEG--------------LQQEAKA-----------------
HMGB_TETTH/18-86RRTE------CPTLK..VPEIVSKISEEYKALPEKEKQKYEE--------------AYRKEKA-----------------
TFAM_MOUSE/49-117FKAK------HPDAK..LSELVRKIAALWRELPEAEKKVYEA--------------DFKAEWK-----------------
NHP1_BABBO/23-93IIAE------NPEIAKDVAAIGKMIGAAWNALSDEEKKPYER--------------MSDEDRV-----------------
HMGH_STRPU/100-168IKSV------HPNWS..VGDIAKELAVRWRAMTAGEKIPFDK--------------GAAKDKE-----------------
SRY_GORGO/60-128MALE------NPRMR..NSEISKQLGYQWKMLTEAEKWPFFQ--------------EAQKLQA-----------------
SOX2_CHICK/39-107MAQE------NPKMH..NSEISKRLGAEWKLLSEAEKRPFID--------------EAKRLRA-----------------
SOX9_CHICK/106-174LADQ------YPHLH..NAELSKTLGKLWRLLNESEKRPFVE--------------EAERLRV-----------------
HMGB1_RAT/95-163IKGE------HPGLS..IGDVAKKLGEMWNNTAADDKQPYEK--------------KAAKLKE-----------------
TFAM_HUMAN/50-118FKAQ------NPDAK..TTELIRRIAQRWRELPDSKKKIYQD--------------AYRAEWQ-----------------
ABF2_YEAST/43-111FVKE------NPTLR..PAEISKIAGEKWQNLEADIKEKYIS--------------ERKKLYS-----------------
MAT2_COCHE/131-199LKAE------FPHLT..IQEISTRCSHIWHNLSPEAKKPWQD--------------AAQSAKE-----------------
SSRP1_DROME/555-621IKRE------NPGIK..VTEIAKKGGEMWKEL..KDKSKWED--------------AAAKDKQ-----------------
SOX4_HUMAN/59-127IMEQ------SPDMH..NAEISKRLGKRWKLLKDSDKIPFIR--------------EAERLRL-----------------
SMR2_PODAS/161-229LHED------NPGLT..AGAISSIVAKAWKGETPQVKAHFKA--------------LAVEEDR-----------------
SSRP1_HUMAN/547-615IKSD------HPGIS..ITDLSKKAGEIWKGMSKEKKEEWDR--------------KAEDARR-----------------
MATD_NEUCR/147-215LFSE------DPSLS..ARNISQIVAGLWNSEHPAAKARFRE--------------LAEMEVH-----------------

PF08073

Q7PZN7_ANOGA/152-206LTKE------NPRVP--MAKLMMLVAAKWREFCTLNP-------------------------------------------
CHD3_HUMAN/147-201IAKK------NPKIP--MSKMMTILGAKWREFSANNP-------------------------------------------
CHDM_DROME/136-190LQKE------NPKIA--APKLVMLVAAKWREFCESNP-------------------------------------------
CHD3_CAEEL/96-150ILKV------NPGTN--VTKMYPLFQVKYKEFQDHMT-------------------------------------------
Q7ZWN3_XENLA/147-201IAAK------NPKIA--VSKMMMVLGAKWREFSTNNP-------------------------------------------

PF04690

YAB1_ARATH/16-189IKAG------NPDIS--HREAFSAAAKNWAHFPHIHFGL-----------------------------------------
YAB3_ARATH/16-201IKAG------NPDIS--HREAFSAAAKNWAHFPHIHFGL-----------------------------------------
YAB4_ARATH/12-183LKAQ------NPSMA--HKEAFSLAAKNWAHFPPAHNKR-----------------------------------------
YAB1_ORYSJ/1-157IKTS------NPEIS--HREAFSAAAKNWAHLPRLHFGL-----------------------------------------
YAB2_ARATH/1-160IKAC------NPEIS--HREAFSTAAKNWAHFPHIHFGL-----------------------------------------
YAB2_ORYSJ/3-161IKAN------NPDIS--HREAFSTAAKNWAHFPNIHFGL-----------------------------------------

PF14887

Q07G04_XENTR/201-285YLAR---------FKNDRAKALKCMEATWLNMEKKEKIMWIK--------------KAAEDQK-----------------
Q60460_CRIGR/442-526YLAR---------FKNDRVKALKAMEMTWNNMEKKEKLMWIK--------------KAAEDQK-----------------
Q4T4S3_TETNG/484-569YMAR---------FKSDRSKAQKAMEATWSNMEKKEKIMWIK--------------KAAEDQK-----------------
C0H9W0_SALSA/436-525YLAK---------YRSDRKKTQSAMESAWKAMEKKEKIPWIK--------------KAAEDQK-----------------

PF06382

Q9VAF7_DROME/1-125FYGL------SP------QDMVHYAAKQWTQLSMAEKEAFKSKKPSTITLKSPAQYVACEMKSDVAGGQQSSCQRQSPSA
Q8MZC5_DROME/1-187FYGL------SP------QDMVHYAAKQWTQLSMAEKEAFKSKKPSTITLKSPAQYVACEMKSDVAGGQQSSCQRQSPSA
Q9V3S3_DROME/1-146HCNL------KP------RELIAKAAKAWARLSENRKDRYRR..............MACKVTT.................

PF06244

Q4Z043_PLABA/97-260VKEE------YKNLK--LSQYKQILWKKFKKSADNPMNQK----------------------------------------
Q9GUM1_CAEEL/95-217LKLN------HPTFR--LSQLKQILKKEWQKSPENPLNAR----------------------------------------
C124B_XENLA/95-210LKQE------NPNMR--LSQLKQLLKKEWMKSPENPMNQK----------------------------------------
Q4SFG3_TETNG/96-215LKKE------NPNMR--LSQLKQQLKKEWMKAPENPLNQR----------------------------------------
CC124_MOUSE/95-209LKQE------NPNMR--LSQLKQLLKKEWLRSPDNPMNQR----------------------------------------
CC124_PONAB/96-215LKQE------NPNMR--LSQLKQLLKKEWLRSPDNPMNQR----------------------------------------
Q01JB1_ORYSA/104-232LKEE------KPGLT--LNQYKDMIWKLWKKSPDNPLNQV----------------------------------------
Q8VYC9_ARATH/102-227LKSE------KPGLT--HTQYKDLIWKMWKKSPDNPLNQA----------------------------------------
CC124_DANRE/94-209VKME------NPNMR--LSQLKQQLKKEWTKSPENPLNQR----------------------------------------
Q16YV3_AEDAE/92-208MKQE------YPSLK--LSQLKQMIFKEWQKSPQNPMNQK----------------------------------------
Q9VE08_DROME/92-212IKAE------NPSLR--MSQWKQLLMKEWNKSPDNPFNQA----------------------------------------
Q5DAC0_SCHJA/96-212LKAE------NPSMR--HSQLKQLLFKMFQTSPENPKNHQ----------------------------------------
CC124_SCHPO/79-179LRKE------QPGLR--LNQYEDIMYKEFQKHPDNPFNKM----------------------------------------
Q4X4X0_PLACH/118-278VKEE------YKNLK--LSQYKQILWKKFKKSADNPMNQK----------------------------------------

PF09011

B6KTZ4_TOXGO/9-86---EYQ------QEALWHD---------------
A2E233_TRIVA/26-97---QFR------RENPNWH---------------
C3Z277_BRAFL/6-77---SAS------ATAGRLD---------------
A7YYD4_DANRE/6-79---RYD------REMKTYV---------------
D2HQ61_AILME/6-79---RYD------REMKDYG---------------
MAEL_XENTR/2-73---DPD------STSTYND---------------
Q66IA8_DANRE/6-79---RYD------QEMMHYN---------------
B3XZN8_9BIVA/16-88---RYD------AEMAVYK---------------
MAEL_HUMAN/2-73---AQG------KDPGPSE---------------
B3S6M5_TRIAD/36-107---RFS------REMMTYN---------------

PF00505

MTMC3_SCHPO/103-171---QHQ------KMYPGYK---------------
HMGH_IIV6/54-122---RYL------ASKEANK---------------
YF98_SCHPO/195-263---KAR------EARRRRS---------------
NHP6A_YEAST/21-89---RYE------SEKELYN---------------
UBF1_HUMAN/112-180---EFE------RNLARFR---------------
HMGL_SOYBN/44-113---EYE------KNMRAYN---------------
HMGL_TRYBR/118-186---RFR------REVDEYK---------------
LEF1_MOUSE/297-365---LHM------QLYPGWS---------------
FPR1_PODAS/169-237---KLM------SAHPHYR---------------
MATB_NEUCS/116-184---RLL------LENPDYR---------------
HMGL_IPONI/36-105---EYE------KNLQAYN---------------
HMGL_VICFA/45-114---EYE------ITLQAYN---------------
HMGL_WHEAT/42-111---EYN------KAIAAYN---------------
HMG1A_CHITE/5-71---EYE------KAMKEFE---------------
HMG_TETPY/11-79---KYE------KDMQAYE---------------
HMGB_TETTH/18-86---TYD------KQNDQWK---------------
TFAM_MOUSE/49-117---AYK------EAVSKYK---------------
NHP1_BABBO/23-93---RYE------REKAEYA---------------
HMGH_STRPU/100-168---RYI------KAMAEYK---------------
SRY_GORGO/60-128---MHR------EKYPNYK---------------
SOX2_CHICK/39-107---LHM------KEHPDYK---------------
SOX9_CHICK/106-174---QHK------KDHPDYK---------------
HMGB1_RAT/95-163---KYE------KDIAAYR---------------
TFAM_HUMAN/50-118---VYK------EEISRFK---------------
ABF2_YEAST/43-111---EYQ------KAKKEFD---------------
MAT2_COCHE/131-199---EHL------RQHPNYK---------------
SSRP1_DROME/555-621---RYH------DEMRNYK---------------
SOX4_HUMAN/59-127---KHM------ADYPDYK---------------
SMR2_PODAS/161-229---KHK------LAYPGYR---------------
SSRP1_HUMAN/547-615---DYE------KAMKEYE---------------
MATD_NEUCR/147-215---RHR------AENPHLY---------------

PF08073

Q7PZN7_ANOGA/152-206----------------------------------
CHD3_HUMAN/147-201----------------------------------
CHDM_DROME/136-190----------------------------------
CHD3_CAEEL/96-150----------------------------------
Q7ZWN3_XENLA/147-201----------------------------------

PF04690

YAB1_ARATH/16-189----------------------------------
YAB3_ARATH/16-201----------------------------------
YAB4_ARATH/12-183----------------------------------
YAB1_ORYSJ/1-157----------------------------------
YAB2_ARATH/1-160----------------------------------
YAB2_ORYSJ/3-161----------------------------------

PF14887

Q07G04_XENTR/201-285---RYE......RELSDMRSAPTPT.TAGKKVKF
Q60460_CRIGR/442-526---RYE......RELSEMRAPPAAT.NSSKKMKF
Q4T4S3_TETNG/484-569---RYE......RELYEMRSPAAAAIASGKKMKF
C0H9W0_SALSA/436-525---RYEVQYRPVRELLEMRTAQAGA..GQRKPKF

PF06382

Q9VAF7_DROME/1-125RLRESERRSSRSKTLCRSA---------------
Q8MZC5_DROME/1-187RLRESERRSSRSKTLCRSA---------------
Q9V3S3_DROME/1-146....SERH..KRRRICQQY---------------

PF06244

Q4Z043_PLABA/97-260----------------------------------
Q9GUM1_CAEEL/95-217----------------------------------
C124B_XENLA/95-210----------------------------------
Q4SFG3_TETNG/96-215----------------------------------
CC124_MOUSE/95-209----------------------------------
CC124_PONAB/96-215----------------------------------
Q01JB1_ORYSA/104-232----------------------------------
Q8VYC9_ARATH/102-227----------------------------------
CC124_DANRE/94-209----------------------------------
Q16YV3_AEDAE/92-208----------------------------------
Q9VE08_DROME/92-212----------------------------------
Q5DAC0_SCHJA/96-212----------------------------------
CC124_SCHPO/79-179----------------------------------
Q4X4X0_PLACH/118-278----------------------------------

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window