Sequence alignment for CL0121

PF00031

CYTN_HUMAN/32-127------------------GGIYNADL..NDEWVQR------ALHFAISEYNKAT.K-----------DDYYRRPLRVLRA
FETAF_PROFL/147-239------------------PILLPPNN....PHVVD------SVEYVLNKHNEKL..-----------SGHIYEVLEISRG
CYT1_ORYSJ/48-135------------------GGVEPVGN.ENDLHLVD------LARFAVTEHNKKA..-----------.NSLLEFEKLVSV
FETUA_BOVIN/150-239------------------PLLAPLND....SRVVH------AVEVALATFNAES..-----------NGSYLQLVEISRA
FETUA_HUMAN/150-239------------------PLLAPLND....TRVVH------AAKAALAAFNAQN..-----------NGSNFQLEEISRA
KNG1_BOVIN/265-359------------------GCPKPIPV..DSPDLEE------PLSHSIAKLNAEH.D-----------GAFYFKIDTVKKA
CYTM_SOLTU/99-187------------------GGIVNVPN.PNNTKFQE------LARFAIQDYNKKQ..-----------.NAHLEFVENLNV
CYTB_BOVIN/4-92------------------GGTSATQP..ATAETQA------IADKVKSQLEEKE..-----------.NKKFPVFKALEF
CYTC_MOUSE/31-126------------------GAPEEADA..NEEGVRR------ALDFAVSEYNKGS.N-----------DAYHSRAIQVVRA
CYTA_RAT/10-97------------------GGVSEAKP..ATPEIQE------VADKVKRQLEEKT..-----------.NEKYEKFKVVEY
CYTM_SOLTU/288-375------------------GGIINVPN.PNSPEFQD------LARFAVQDYNNTQ..-----------.NAHLEFVENLNV
CYTC_BOVIN/40-135------------------GGLMEADV..NEEGVQE------ALSFAVSEFNKRS.N-----------DAYQSRVVRVVRA
KNG1_BOVIN/22-115------------------SQEIDCND....QDVFK------AVDAALTKYNSEN.K-----------SGNQFVLYRITEV
CYTM_SOLTU/665-752------------------GGIIIVPF.PNSPEFQD------LARFAVQDFNKKE..-----------.NGHLEFVENLNV
FETUA_PIG/147-236------------------PLLAPLND....SRVVH------AAESALAAFNAQS..-----------NGSYLQLVEISRA
FETUA_MOUSE/150-239------------------PLLTPFND....TNVVH------TVNTALAAFNTQN..-----------NGTYFKLVEISRA
KNG1_RAT/266-360------------------GCPRNIPV..DSPELKE------ALGHSIAQLNAEN.N-----------HTFYFKIDTVKKA
CYT3_MOUSE/10-97------------------GGLSEARP..ATPEIQM------IADKVRPLLEEQT..-----------.NEKYEKFEAVEY
CST8_MOUSE/35-128------------------FGSINISN....ANVKQ------CVWFAMKEYNKES.E-----------DKYVFLVDKILHA
CYTB_RAT/4-92------------------GAPSATMP..ATTETQE------IADKVKSQLEEKA..-----------.NQKFDVFKAISF
CYTM_SOLTU/5-92------------------GGLVDVPF.ENKVEFDD------LARFAVQDYNQKN..-----------.DSSLEFKKVLNV
CYTX_ONCVO/53-148------------------GGWEDRDP..KDEEILE------LLPSILMKVNEQS.N-----------DEYHLMPIKLLKV
KNG1_HUMAN/144-238------------------GCVHPIST..QSPDLEP------ILRHGIQYFNNNT.Q-----------HSSLFMLNEVKRA
CYT2_MOUSE/10-97------------------GGLSEARP..ATSEIQE------IADKVRPLLEEKT..-----------.NEKYEKFKAIEY
CYTA_HUMAN/4-92------------------GGLSEAKP..ATPEIQE------IVDKVKPQLEEKT..-----------.NETYGKLEAVQY
CYT_CHICK/32-127------------------GAPVPVDE..NDEGLQR------ALQFAMAEYNRAS.N-----------DKYSSRVVRVISA
KNG1_BOVIN/143-237------------------GCVHPIST..KSPDLEP------VLRYAIQYFNNNT.S-----------HSHLFDLKEVKRA
CYTC_HUMAN/37-132------------------GGPMDASV..EEEGVRR------ALDFAVGEYNKAS.N-----------DMYHSRALQVVRA
KNG1_RAT/23-116------------------AQEMDCND....ESLFQ------AVDTALKKYNAGL.K-----------SGNQFVLYQVTEG
CYTM_SOLTU/194-281------------------GGITDVPF.PNNPEFQD------LARFAIQVYNKKE..-----------.NVHLEFVENLNV
CPI1_PIG/9-97------------------GGLTEPRP..ATPEIQE------IANKVKPQLEEKT..-----------.NKTYEKFEAIIY
KNT1_RAT/143-237------------------GCFQPIPM..DSSDLKP------VLKHAVEHFNNNT.K-----------HTHLFALREVKSA
CYTS_RAT/32-127------------------GGIEKSSM..EEEGASE------ALNYAVNEYNEKN.S-----------DLYLSRVVEVKDV
CYT1_MAIZE/42-130------------------GGIKDVPANENDLQLQE------LARFAVNEHNQKA..-----------.NALLGFEKLVKA
KNG1_HUMAN/23-116------------------SEEIDCND....KDLFK------AVDAALKKYNSQN.Q-----------SNNQFVLYRITEA
CYTL_DROME/29-116------------------GGVSQLEG.NSRKEALE------LLDATLAQLATGD..-----------.GPSYKAINVTSV
CYTA_SARPE/24-112------------------GCPSEVKG.DKLKQSEE------TLNKSLSKLAAGD..-----------.GPTYKLVKINSA
CYTD_HUMAN/32-128------------------GGIHATDL..NDKSVQC------ALDFAISEYNKVINK-----------DEYYSRPLQVMAA
CYT_BITAR/3-103------------------GGLSPRD..VTDPDVQE------AAAFAVEKYNAGS.K-----------NDYYFKERRVVEA
CYT_CYPCA/23-117------------------GGLVDADI.N.DKDVQK------ALRFAVDHYNGQS.N-----------DAFVRKVSKVIKV
KNG1_HUMAN/266-360------------------GCPRDIPT..NSPELEE------TLTHTITKLNAEN.N-----------ATFYFKIDNVKKA
KNG1_RAT/144-238------------------GCMHPISV..DSPELGP------VLKHAVEHFNNNT.K-----------HTHLFALGEVKSA
CYT1_MOUSE/4-91------------------GGVSEASR..ATPEIQM------IANKVRPQLEAKT..-----------.NKKYEKFEAVEY

PF00666

CAMP_HUMAN/32-98-----------------------------VLSYKE------AVLRAIDGINQRS-S-----------DANLYRLLDLDPR
ICTL_PIG/1-67-----------------------------QLRYRE------AVLRAVDRLNEQS-S-----------EANLYRLLELDQP
CRAMP_MOUSE/29-95-----------------------------TPSYRD------AVLRAVDDFNQQS-L-----------DTNLYRLLDLDPE
P15A_RABIT/25-89-----------------------------RLRYEE------VVAQALQFYNEGQ-Q-----------GQPLFRLLEATPP
CTHL2_BOVIN/31-97-----------------------------ALSYRE------AVLRAVDQFNERS-S-----------EANLYRLLELDPT
CTHL1_BOVIN/31-97-----------------------------ALSYRE------AVLRAVDQLNEQS-S-----------EPNIYRLLELDQP
SC51_SHEEP/31-98-----------------------------VLSYRE------AVLRAADQLNEKS-S-----------EANLYRLLELDPP
CAP18_RABIT/31-97-----------------------------DLTYRE------AVLRAVDAFNQQS-S-----------EANLYRLLSMDPQ

PF07448

SPP24_RAT/67-203VLDEDTLVMNLEFTVQETTCLRESG.DPSTCAFQRGYSVPTAACRSTVQMSKGQVKDVWAHCRW.ASTSESNSSEEMIFG
SPP24_BOVIN/67-203ALDEDSLTMDLEFRIQETTCRRESEADPATCDFQRGYHVPVAVCRSTVRMSAEQVQNVWVRCHWSS.SSGSSSSEEMFFG
SPP24_HUMAN/73-211VLDENNLVMNLEFSIRETTCRKDSGEDPATCAFQRDYYVSTAVCRSTVKVSAQQVQGVHARCSWSSSTSESYSSEEMIFG

PF07430

P94012_CUCMA/8-209-----------CGQVPAVEKWIKIPD-VSGHCVQE------VAKLAVEQFNVQH--------------GHSLKYDSIHEG
P94012_CUCMA/604-802-----------CGPLVFEPKWIQIPN-LKEPGFQV------VINFIVEQLKIIL--------------GDCLKFHSIYEG
P94012_CUCMA/212-405-----------CDQGKVSPGWNQIPD-VKELGLQV------VIKFIVEQIKIKF--------------GDSLKFEIVYEG

PF00031

CYTN_HUMAN/32-127RQQTVGGV..NYFFDVEVGR--TICTK......SQP--------------------------NLDTCAFHEQPELQKKQL
FETAF_PROFL/147-239QHKYEPEA...YYLEFVIVE--INCTAQ....EAHD--------------------------DHHQCHPYT.AGEDHIAF
CYT1_ORYSJ/48-135KQQVVAGT..LYYFTIEVKE--G.........DAKK--------------------------LYEAKVWE....KPWMDF
FETUA_BOVIN/150-239QFVPLPVS...VSVEFAVAA--TDCIA.....KEVV--------------------------DPTKCNLL...AEKQYGF
FETUA_HUMAN/150-239QLVPLPPS...TYVEFTVSG--TDCVA.....KEAT--------------------------EAAKCNLL...AEKQYGF
KNG1_BOVIN/265-359TVQVVAGL..KYSIVFIARE--TTCSKG....SNEE--------------------------LTKSCEINI...HGQILH
CYTM_SOLTU/99-187KEQVVAGI..MYYITLAATD--D.AG.......KKK--------------------------IYKAKIWV....KEWEDF
CYTB_BOVIN/4-92KSQLVAGK..NYFIKVQVDE--DDFV.......HIR--------------------------VFESLPHE....NKPVAL
CYTC_MOUSE/31-126RKQLVAGV..NYFLDVEMGR--TTCTK......SQT--------------------------NLTDCPFHDQPHLMRKAL
CYTA_RAT/10-97KSQVVAGQ..ILFMKVDVGN--GRFL.......HMK--------------------------VLRGLSG.....DDDLKL
CYTM_SOLTU/288-375KEQLVSGM..MYYITLAATD--A.G........NKK--------------------------EYEAKIWV....KEWEDF
CYTC_BOVIN/40-135RKQVVSGM..NYFLDVELGR--TTCTK......SQA--------------------------NLDSCPFHNQPHLKREKL
KNG1_BOVIN/22-115.ARMDNPD.TFYSLKYQIKE--GDCPF.....QSNK--------------------------TWQDCDYKD.SAQAATGE
CYTM_SOLTU/665-752KEQVVAGM..MYYITLAATD--A.R........KKE--------------------------IYETKILV....KEWENF
FETUA_PIG/147-236QLVPLSAS...VSVEFAVAV--TDCVA.....KEAY--------------------------SPTKCNLL...VEKQYGF
FETUA_MOUSE/150-239QNVPLPVS...TLVEFVIAA--TDCTA.....KEVT--------------------------DPAKCNLL...AEKQHGF
KNG1_RAT/266-360TSQVVAGT..KYVIEFIARE--TKCSKE....SNAE--------------------------LTADCETKR...LGQSLN
CYT3_MOUSE/10-97KSQVVAGQ..NLFIKIDVGN--GCFL.......HMK--------------------------VFRGLSG.....EDDLKL
CST8_MOUSE/35-128KLQITDRM..EYQIDVQISR--SNCKK......PLN--------------------------NTENCIPQKKPELEKKMS
CYTB_RAT/4-92RRQVVAGT..NFFIKVDVGE--EKCV.......HLR--------------------------VFEPLPHE....NKPLTL
CYTM_SOLTU/5-92KQQIVAGI..MYYITFEATE--G.G........NKK--------------------------EYEAKILL....RKWEDL
CYTX_ONCVO/53-148SSQVVAGV..KYKMDVQVAR--SQCKKS...SNEKV--------------------------DLTKCKKLE..G.HPEKV
KNG1_HUMAN/144-238QRQVVAGL..NFRITYSIVQ--TNCSKE....NFLF--------------------------LTPDCKSLW...NGDTGE
CYT2_MOUSE/10-97KVQVVQGL..NYFIKMNVGR--GCYL.......HIN--------------------------VLSGISS.....ENDLEL
CYTA_HUMAN/4-92KTQVVAGT..NYYIKVRAGD--NKYM.......HLK--------------------------VFKSLPGQ....NEDLVL
CYT_CHICK/32-127KRQLVSGI..KYILQVEIGR--TTCPK......SSG--------------------------DLQSCEFHDEPEMAKYTT
KNG1_BOVIN/143-237QRQVVSGW..NYEVNYSIAQ--TNCSKE....EFSF--------------------------LTPDCKSLS...SGDTGE
CYTC_HUMAN/37-132RKQIVAGV..NYFLDVELGR--TTCTK......TQP--------------------------NLDNCPFHDQPHLKRKAF
KNG1_RAT/23-116.TKKDGSK.TFYSFKYQIKE--GNCSV.....QSGF--------------------------AWQDCDFKD.AEEAATGE
CYTM_SOLTU/194-281KQQVVAGM..MYYITLAAID--A.G........KKK--------------------------IYETKIWV....KEWEDF
CPI1_PIG/9-97RSQVVAGT..NYYIKVHVGG--NNYV.......HIR--------------------------VFQSLPHQ....EDPLKL
KNT1_RAT/143-237HSQVVAGM..NYKIIYSIVQ--TNCSKE....DFPS--------------------------LREDCVPLP...YGDHGE
CYTS_RAT/32-127QKQVVAGT..KFFFDVILGK--TICLK......TQG--------------------------DLTNCPLNEEADQQEHEF
CYT1_MAIZE/42-130KTQVVAGT..MYYLTIEVKD--..GE.......VKK--------------------------LYEAKVWE....KPWENF
KNG1_HUMAN/23-116.TKTVGSD.TFYSFKYEIKE--GDCPV.....QSGK--------------------------TWQDCEYKD.AAKAATGE
CYTL_DROME/29-116TGQVVAGSLNTYEVELD...--...........NGS--------------------------DKKQCTVKI.WTQPWLKE
CYTA_SARPE/24-112TTQVVSGS..KDVINADLKD--...........END--------------------------KTKTCDITI.WSQPWLEN
CYTD_HUMAN/32-128YQQIVGGV..NYYFNVKFGR--TTCTK......SQP--------------------------NLDNCPFNDQPKLKEEEF
CYT_BITAR/3-103QSQVVSGV..KYYLMMELLK--TTCKKTVGRPKGYQ--------------------------EIQNCNLPP.ENQQEEIT
CYT_CYPCA/23-117QQQVAAGM..KYIFTVKMEV--ASCK.......KGG--------------------------VKTMCAVPKNPSIEQVIQ
KNG1_HUMAN/266-360RVQVVAGK..KYFIDFVARE--TTCSKE....SNEE--------------------------LTESCETKK...LGQSLD
KNG1_RAT/144-238DRQVVAGM..NYQIIYSIVQ--TNCSKE....DFPS--------------------------LHEDCVPLP...SGDDGE
CYT1_MOUSE/4-91KTQVVAGE..NIFIKMDVGH--GCFI.......HIK--------------------------VFNGPTG.....KDNYEL

PF00666

CAMP_HUMAN/32-98.PTMDGDPDTPKPVSFTVKE--TVCPRT-----TQQ--------------------------SPEDCD------------
ICTL_PIG/1-67.PKADEDPGTPKPVSFTVKE--TVCPRP-----TRQ--------------------------PPELCD------------
CRAMP_MOUSE/29-95.PQGDEDPDTPKSVRFRVKE--TVCGKA-----ERQ--------------------------LPEQCA------------
P15A_RABIT/25-89.PSLNSKS..RIPLNFRIKE--TVCIFT-----LDR--------------------------QPGNCA------------
CTHL2_BOVIN/31-97.PNDDLDPGTRKPVSFRVKE--TDCPRT-----SQQ--------------------------PLEQCD------------
CTHL1_BOVIN/31-97.PQDDEDPDSPKRVSFRVKE--TVCSRT-----TQQ--------------------------PPEQCD------------
SC51_SHEEP/31-98PKQDDENSNIPKPVSFRVKE--TVCPRT-----SQQ--------------------------PAEQCD------------
CAP18_RABIT/31-97.QLEDAKPYTPQPVSFTVKE--TECPRT-----TWK--------------------------LPEQCD------------

PF07448

SPP24_RAT/67-203DMARSHRRRNDYLLGFLYDE--PKGEQF-----YDR--------------------------SIEITRRGHPPAHRRFLN
SPP24_BOVIN/67-203DILGSSTSRNSYLLGLTPDR--SRGEPL-----YEP--------------------------S.REMRRNFPLGNRRYSN
SPP24_HUMAN/73-211DMLGSHKWRNNYLFGLISDE--SISEQF-----YDR--------------------------SLGIMRRVLPPGNRRYPN

PF07430

P94012_CUCMA/8-209WYCELGQNNLKYRLHIRAIDFLQRSLLYEALVFEEKPKLERIRKLISFLYLLNGGHYVGPVDPPQVEKWIKIPDLRVPFV
P94012_CUCMA/604-802WYFELCPISLKFRLHIKAIDFLGRCLNYEIIIIEEK....RIFKLESIIVILSPGHCVGPVDPPKVEKWIKISNLQFAFL
P94012_CUCMA/212-405WYFELCPNSLKYRFHVKVIDFLGRSLKFEIIIIEERRVLLRIWKLDSIIVIVSP........EPQEKKWIKIPNVQVPLV

PF00031

CYTN_HUMAN/32-127CSFEIYEVPW-----------------------------------------------------------------
FETAF_PROFL/147-239CRSTVFRSHA-----------------------------------------------------------------
CYT1_ORYSJ/48-135KELQEFKPVD-----------------------------------------------------------------
FETUA_BOVIN/150-239CKGSVIQKAL-----------------------------------------------------------------
FETUA_HUMAN/150-239CKATLSEKLG-----------------------------------------------------------------
KNG1_BOVIN/265-359CDANVYVVPW-----------------------------------------------------------------
CYTM_SOLTU/99-187KKVVEFKLVG-----------------------------------------------------------------
CYTB_BOVIN/4-92TSYQTNKGRH-----------------------------------------------------------------
CYTC_MOUSE/31-126CSFQIYSVPW-----------------------------------------------------------------
CYTA_RAT/10-97LDYQTNKTKN-----------------------------------------------------------------
CYTM_SOLTU/288-375KKVIDFKLVG-----------------------------------------------------------------
CYTC_BOVIN/40-135CSFQVYVVPW-----------------------------------------------------------------
KNG1_BOVIN/22-115CTATVAKRGN-----------------------------------------------------------------
CYTM_SOLTU/665-752KEVQEFKLVG-----------------------------------------------------------------
FETUA_PIG/147-236CKGTVTAKVN-----------------------------------------------------------------
FETUA_MOUSE/150-239CKANLMHNLG-----------------------------------------------------------------
KNG1_RAT/266-360CNANVYMRPW-----------------------------------------------------------------
CYT3_MOUSE/10-97KGYQTNKTKT-----------------------------------------------------------------
CST8_MOUSE/35-128CSFLVGALPW-----------------------------------------------------------------
CYTB_RAT/4-92SSYQTDKEKH-----------------------------------------------------------------
CYTM_SOLTU/5-92KKVVGFKLVG-----------------------------------------------------------------
CYTX_ONCVO/53-148MTLEVWEKPW-----------------------------------------------------------------
KNG1_HUMAN/144-238CTDNAYIDIQ-----------------------------------------------------------------
CYT2_MOUSE/10-97TGYKAKQTNN-----------------------------------------------------------------
CYTA_HUMAN/4-92TGYQVDKNKD-----------------------------------------------------------------
CYT_CHICK/32-127CTFVVYSIPW-----------------------------------------------------------------
KNG1_BOVIN/143-237CTDKAHVDVK-----------------------------------------------------------------
CYTC_HUMAN/37-132CSFQIYAVPW-----------------------------------------------------------------
KNG1_RAT/23-116CTATLEKRRN-----------------------------------------------------------------
CYTM_SOLTU/194-281KKVVEFKLVG-----------------------------------------------------------------
CPI1_PIG/9-97IGYQVDKTKD-----------------------------------------------------------------
KNT1_RAT/143-237CTGHTHVDIH-----------------------------------------------------------------
CYTS_RAT/32-127CSFVVHDIPW-----------------------------------------------------------------
CYT1_MAIZE/42-130KQLQEFKPVE-----------------------------------------------------------------
KNG1_HUMAN/23-116CTATVGKRSS-----------------------------------------------------------------
CYTL_DROME/29-116NGTNIKIKCS-----------------------------------------------------------------
CYTA_SARPE/24-112GIEVTFNCPG-----------------------------------------------------------------
CYTD_HUMAN/32-128CSFQINEVPW-----------------------------------------------------------------
CYT_BITAR/3-103CRFEVWSRPW-----------------------------------------------------------------
CYT_CYPCA/23-117CKITVWSQPW-----------------------------------------------------------------
KNG1_HUMAN/266-360CNAEVYVVPW-----------------------------------------------------------------
KNG1_RAT/144-238CKGNAFVDIH-----------------------------------------------------------------
CYT1_MOUSE/4-91HGYQTDKTMD-----------------------------------------------------------------

PF00666

CAMP_HUMAN/32-98---------------------------------------------------------------------------
ICTL_PIG/1-67---------------------------------------------------------------------------
CRAMP_MOUSE/29-95---------------------------------------------------------------------------
P15A_RABIT/25-89---------------------------------------------------------------------------
CTHL2_BOVIN/31-97---------------------------------------------------------------------------
CTHL1_BOVIN/31-97---------------------------------------------------------------------------
SC51_SHEEP/31-98---------------------------------------------------------------------------
CAP18_RABIT/31-97---------------------------------------------------------------------------

PF07448

SPP24_RAT/67-203LQRRARVNSGFE---------------------------------------------------------------
SPP24_BOVIN/67-203PWPRARVNPGFE---------------------------------------------------------------
SPP24_HUMAN/73-211HRHRARINTDFE---------------------------------------------------------------

PF07430

P94012_CUCMA/8-209QEVSKFAIDEYN.KGGEGLKYVEIYDGWYAEMGQDNIKFRLHVKAKDCLGRLRNYEAIVLVKQFLSKKIKILESF
P94012_CUCMA/604-802QEVSKFALDDFNVKSGDSLRFDGIYDGWYMEMGQDNIKFRIHLRAKDCLSRVHHYEAYVYVKQFLSKRIKIVESF
P94012_CUCMA/212-405QELAKFAVDEHN.KNGDGLKYIEVYEGWFMDLGHDNIKFRLHLKAKDWLGRIRNYEAVVLVEHFWSKRIKILESF

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window