Sequence alignment for CL0140

PF05515

Q8QXV8_9VIRU/1-123MHPHDFN................................LLC.....................................C
Q8QXW6_9VIRU/1-124MHRYDFN................................LLA.....................................C
VNBP_SHVX/1-124MHPHDLN................................LLC.....................................C
Q67662_9VIRU/1-124MHPYNLN................................LLC.....................................C
Q67698_9VIRU/1-124MHTYDFN................................FLA.....................................C
VNBP_ICRSV/1-222MEPHDQSGSTTRQLDEIRDRRGSQIRSVRLLPWRPFTRFPVCPSGTSPYSRGTHSQPSYVRCQNCERARQWFRAHDGPRC
Q67702_9VIRU/1-124MHPHDFN................................LLC.....................................C
Q67694_9VIRU/1-124MIPQDFN................................ILC.....................................C

PF01623

VNBP_CLV/1-92MRERKLR--------------------------------KQL------------------------------------ED
O38024_9VIRU/3-92CVTQTAL--------------------------------LVA------------------------------------RA
VNBP_PVMG/3-92DVTKVAL--------------------------------LIA------------------------------------RA
O41484_9VIRU/1-89MKADRLA--------------------------------TLL------------------------------------LC
VNBP_POPMV/5-97RKVLALM--------------------------------QVF------------------------------------RE
VNBP_HELVS/5-95NKANVVL--------------------------------SLC------------------------------------SM
VNBP_CVB/1-92MDVIVKM--------------------------------LIL------------------------------------RK
VNBP_PVSP/1-88MKAERLE--------------------------------MLL------------------------------------LC
O09491_9VIRU/14-103IKQRTYR--------------------------------RLL------------------------------------RA
VNBP_LSV/28-117IMDEALK--------------------------------RRT------------------------------------TI

PF04808

Q66245_9CLOS/1-209MDNTSGQ--------------------------------TFV------------------------------------SV
Q9DJS8_9CLOS/1-209MNDTSGQ--------------------------------TFV------------------------------------SV
Q66258_9CLOS/1-209MDNPSGQ--------------------------------TFI------------------------------------SV

PF05515

Q8QXV8_9VIRU/1-123LH..............................FS-PNHLPKDLQILIFSRVTTECKL.RRLSENKPFRGRSKFAMRR-RA
Q8QXW6_9VIRU/1-124LH..............................FS-KPTLPNDVRIIIYNLTLNSRKLGRKAQQNKPFTGTSKCAARR-RA
VNBP_SHVX/1-124LH..............................FS-KPSLPNDLKTLLFRACETSCKLNRRLLDNKPFQGTSKCAKRR-RA
Q67662_9VIRU/1-124LH..............................FS-KPTLPLELRLYIYNLAAPNLLLGRKMLQNKPFQGTSKCAARR-RA
Q67698_9VIRU/1-124LQ..............................FA-QPNLPSDVRISIYMLSSASRKIGRKSQQNKPFTGTSKCAARR-RA
VNBP_ICRSV/1-222LHQRPDYSRLQAPPDPFQHLNSFEPILLAALSVL-RP.LPRDIQITIISCACDYFHSVRCASSR..YLGSSRSAVKR-RA
Q67702_9VIRU/1-124LH..............................FS-QPPLPKDLKEFIFSRCVDCCKLVRRTNQNKPFQGVSKCAKRR-RA
Q67694_9VIRU/1-124LH..............................FA-KPFIPQDLKAHLFFTCVNECKLVRIARENKPFLGTSKCAQRR-RA

PF01623

VNBP_CLV/1-92LF------------------------------KR..FASVQHGHSDCINIIIAKIKSDQ--------PGESKYARRR-RA
O38024_9VIRU/3-92LY------------------------------LH.SGVFVFEIAYLIST.RAGRPLGG.--------.GRSKYARRR-RA
VNBP_PVMG/3-92MC------------------------------TS.SGTFVFELAFSIAE.CAGRPLGG.--------.GRSKYARRR-RA
O41484_9VIRU/1-89VH------------------------------RL.GYVLPVEICVNIIS.LSAGPISR.--------.GRSTYGRKR-RA
VNBP_POPMV/5-97RY------------------------------DHKCDFNFCDIAVSIVCRSELDFINE.--------PGLSNYAKRR-RA
VNBP_HELVS/5-95FA------------------------------SR.GNCIPIPIVFNIYMRAFPKLVGR.--------.GTSTYARRR-RA
VNBP_CVB/1-92FV------------------------------EQ.GNVCPIHLCVDIYKRAFPRSVNK.--------.GRSSYARRR-RA
VNBP_PVSP/1-88VY------------------------------RL.GYILPVDVCIKIIS.VAQVSVQ..--------.GRSTYSCKR-RA
O09491_9VIRU/14-103IF------------------------------K....LHTNKNCVDVIDIIVNKIVCGR--------TGASKYARAR-RA
VNBP_LSV/28-117VL------------------------------CL.LSAFPRDICRDILRRTSSHIVGL.--------.GRSRYARRR-RA

PF04808

Q66245_9CLOS/1-209NL------------------------------SDESNTATTDVEPVSSEADRLDFLQKMNPIIIDALIRKNSYQGARFRA
Q9DJS8_9CLOS/1-209NL------------------------------SDESNTASTRVENVKSEADRLEFLRKMNPLIIDALVRKTNYQGARFRA
Q66258_9CLOS/1-209NL------------------------------SDESNTASTETKAVSSEADRLEFLRKMNPFIIDALIRKNSYQGARFRA

PF05515

Q8QXV8_9VIRU/1-123KRYNRCFDCG--A..VLIDDHQCK..VLTSRAQSDVLTVIREGPAKLYAERTYRPNSDAARLIEDDILYIK---------
Q8QXW6_9VIRU/1-124KRYGRCFDCG--A..LLEANHVCK..LFTTRSNSDCLSVIHEGPAKLYAERSFRKSSFAEQLMRNDLQLMK---------
VNBP_SHVX/1-124KRYNRCFDCG--A..YLYDDHVCK..RFTSRSNSDCLSVIHQGPAKLYAEGAYRANSDAEQLIMNDMLLIK---------
Q67662_9VIRU/1-124KRYNRCFDCG--G..YLLNNHVCK..QFPTRASTSCFNVIHEGPAKLYAEGAFRRDSFAEQLILNDLELMK---------
Q67698_9VIRU/1-124KRYNRCFDCG--A..LLNTDHVCK..LFTSRASTDCLHVIREGPAKLYAERTFRKSSFAEQLILDDLELMK---------
VNBP_ICRSV/1-222ARLNYCYKCG--HPLYLNKPHTCRPGRLCSASISERLALLREGPIRSLTENPI..NARAAHFLAHELLDPR---------
Q67702_9VIRU/1-124KRYNRCFDCG--A..FLVDGHRCK..VFVSKAHSDVLAVIHEGPAKLYAERSYRPNSDAAQLIENDILYIR---------
Q67694_9VIRU/1-124KRYNRCFECG--A..YLLDNHKCR..IFVSRAQSDVLAVIHEGPAKLHAERTYRPNSDAALLIESDLQYIK---------

PF01623

VNBP_CLV/1-92KSIARCPRC-----------ARVSPG.FYFTTRCDGKTCR---PGLSA-------RPDLLEFI-----------------
O38024_9VIRU/3-92IAAGRCHRC-----------YRLWPP.TVFTIKCDNRSCV---PGISY-------NVRVSASR-----------------
VNBP_PVMG/3-92ISIARCHRC-----------YRLWPP.TVFTTRCDNKYCV---PGISY-------NVRVAQFI-----------------
O41484_9VIRU/1-89RSIGRCWRC-----------YRVYPP..ICNSKCDNRTCR---PGISP-------NYNVVTFI-----------------
VNBP_POPMV/5-97RRLGRCVRC-----------FRVNPG.FYFTKRCDGITCV---PGISW-------NYDVEDYI-----------------
VNBP_HELVS/5-95RSILRCERC-----------YRVYPP.LPFSKKCDNRTCV---PGISY-------NIKVADFI-----------------
VNBP_CVB/1-92LELGRCHRC-----------YRVYPPLFPEISRCDNRTCV---PGISY-------NSKVRDYI-----------------
VNBP_PVSP/1-88RSIGRCWRC-----------YRVYPP..VCNSKCDNRTCR---PGISP-------NFKVVTFI-----------------
O09491_9VIRU/14-103KSIGRCPRC-----------FRCAPG.FYFTKNCDTKTCT---PGISY-------NEKVKNFI-----------------
VNBP_LSV/28-117LQIGRCERC-----------YRVYPP..VCGSKCDNKTCR---PGLSI-------NTNVANYI-----------------

PF04808

Q66245_9CLOS/1-209RIIGVCVDCGRKHDKGLKTERKCKVN--NTQSQNEVAHMLMHDPVKYLNKRKARAFSNAEIFAIDLVMYTKERQLAIDLA
Q9DJS8_9CLOS/1-209RIIGVCVDCGRKHDKALKTERKCKVN--NTQSQNEVAHMLMHDPVKYLNKRKARAFSNAEMFAIELVLYTKEKQLAVDLA
Q66258_9CLOS/1-209RIIGVCVDCGRKHDKASRTERKCKVN--NTQSQNEVAHMLMHDPVKYLNKRKARAFSNAEMFAIDLVMHTKERQLAVDLA

PF05515

Q8QXV8_9VIRU/1-123---------------------------------------------------------------------
Q8QXW6_9VIRU/1-124---------------------------------------------------------------------
VNBP_SHVX/1-124---------------------------------------------------------------------
Q67662_9VIRU/1-124---------------------------------------------------------------------
Q67698_9VIRU/1-124---------------------------------------------------------------------
VNBP_ICRSV/1-222---------------------------------------------------------------------
Q67702_9VIRU/1-124---------------------------------------------------------------------
Q67694_9VIRU/1-124---------------------------------------------------------------------

PF01623

VNBP_CLV/1-92---------------------------------------------------------------------
O38024_9VIRU/3-92---------------------------------------------------------------------
VNBP_PVMG/3-92---------------------------------------------------------------------
O41484_9VIRU/1-89---------------------------------------------------------------------
VNBP_POPMV/5-97---------------------------------------------------------------------
VNBP_HELVS/5-95---------------------------------------------------------------------
VNBP_CVB/1-92---------------------------------------------------------------------
VNBP_PVSP/1-88---------------------------------------------------------------------
O09491_9VIRU/14-103---------------------------------------------------------------------
VNBP_LSV/28-117---------------------------------------------------------------------

PF04808

Q66245_9CLOS/1-209AEREKTRLARRHPMRSPEETPEYYKFGRTAKAMLPDINAVDVGDNEETSSEYPVSLSVSGGVLREHHFI
Q9DJS8_9CLOS/1-209AEREKTRLARRHPMRSPEETPEHYKFGMTASAMLPELNAVGVGDNEDTSSEYPVSLSVSGGVLREHHFI
Q66258_9CLOS/1-209AEREKTRLARRHPMRSPEETPEHYKFGMTAKAMLPNINAVDVGDNEDTSSEYPVSLSVSGGVLREHHLI

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window