Sequence alignment for CL0145

PF06730

F92A1_HUMAN/1-219---------------MMRRT.---------------------------...LENR-----NAQTKQLQTAVSNVEKHFGE
F92A1_MOUSE/70-288---------------MLRRN.---------------------------...LDER-----DAQTKQLQDAVTNVEKHFGE
Q9VK91_DROME/1-222---------------MFRRGK---------------------------LSFLNTK-----DDRVKIINERINITERHLME

PF09325

Q6BQ29_DEBHA/424-659---------------VGNNTGGFMSS-----------IFSM.......SQKIEEP.....DEYFIQKKEYIESLEHNLRV
Q9C2E4_NEUCS/307-541---------------SKGVLSTFGIS-----------VGS........GNKFVEQ.....DDWFHDRRVYLDALENQLKG
Q7PVK3_ANOGA/210-443---------------VMRLFNKVGET-----------VNKI.......TYKMDEN.....DPWFNDKISEVETIDAHMQK
Q4R6S4_MACFA/236-469---------------LLKMFNKATDA-----------VSKM.......TIKMNES.....DIWFEEKLQEVECEEQRLRK
Q5BN90_ACECL/162-395---------------LKGIAHTTTNL-----------VQG........KHVEAEE.....DPEYLRIREYVYQLEKHLSD
Q5DFB1_SCHJA/196-436---------------AIKVMKNLGDA-----------IGKL.......AYKVDDPEENTAEEFFYQKADELDIWEKQLKR
VPS5_YEAST/439-673---------------IDAESHKGFMS-----------ISFS......SLPKYNEA.....DEFFIEKKQKIDELEDNLKK
SNX2_HUMAN/281-514---------------ILRMVNKAADA-----------VNKM.......TIKMNES.....DAWFEEKQQQFENLDQQLRK
Q86IF6_DICDI/292-523---------------ISSFFGNSIST-----------LTQG.......VHSVKEI.....DGWFGDKKSYILQLDSTLHR
Q5A1F2_CANAL/431-666---------------TAAATSGGFMS-----------SLFS......MSTKVTEP.....DQYFITKKQYIDDLEYNLKQ
Q5B786_EMENI/288-522---------------SKGMFSSFGIS-----------VGG........GGKFIEH.....DDWFHDRKIYLDALENQLKS
A8WVN0_CAEBR/231-466---------------VKKIFKNFQVV-----------FSKM.......AFHMEEG.....DRWFEQVQSQIDELDEALRK
Q5KI36_CRYNJ/639-879---------------RKHQIAAQTSS-----------TEKGGLLAGWTSTKFVEQ.....DDWFNSRRAFLEALESQLKS
VPS5_SCHPO/340-576---------------TSGLLDSFTSA-----------FHTS......GSSKFSEQ.....DPILIEAKDTLDSLETQLKS
Q6CJR1_KLULA/428-663---------------LDTETGGSFMG-----------LSFA......TAPKYKEP.....DQFFVDAAEKMDILEEQLKQ
Q675P9_OIKDI/236-470---------------MLRFVGKVENV-----------ITKQ......VTQKMPET.....DSWFEDRAASVDNLQAQLKR
Q6CGR9_YARLI/393-628---------------GSGLMSSLSSS-----------FSF........SKSFIET.....DPWFSDKRGYVDVLESHLKS
Q759R2_ASHGO/362-598---------------LESDTGSLFMS-----------LSFS......SVPKYTEP.....DTFIMEKRQHIDVMEEQLRQ
Q4P3M6_USTMA/831-1062---------------TSSLSSGALS.-----------...........AYSFEET.....DEWFNEQRVYLDSLESALKG
Q8MS29_DROME/220-453---------------VIRLFNKVGET-----------VNKI.......TYKMDEN.....DPWFDDKITGVESLDANLQK
Q6FKM2_CANGA/398-636---------------LDSEYKKGFMN-----------ISFS......SIPKYNEP.....DKFFVDELDRITDLENQLKK
Q4V8Z4_DANRE/286-519---------------LLKMINRASDA-----------VNKM.......TIKINES.....DNWFESKLQEVENEEQLLRR

PF10456

SNX33_MOUSE/337-572DDKQ---------WKMGKRRAEKDEM-----------VGASFLLTFQIPT..EHQDLQDVEDRVDTFKAFSKKMDDSVLQ
Q8I4E1_CAEEL/334-564DEKD---------WKNGKRRAEKDEY-----------IGGAFLNCITVPH..QPLDPNNVDMQVERFQRSVKTSEEAMRV
SNX9_MOUSE/358-593DEKE---------WKTGKRKAEKDEL-----------VGVMIFSTME.PEA.PDLDLIEIEQKCDAVGKFTKAMDDGVKE
Q5SPP1_DANRE/370-606DEKD---------WKTGKRKAEKDET-----------VGVMIFSTIE.PEGLPDMDLIEVEQKCEQFSRFTKAMDDGVKD
Q5XGZ5_XENLA/348-585DDKA---------WKQGKRKCERDDL-----------VGANFFLTLSLSPGSPVLDPHDVDGRLDGFKAFTKRMDEGVLL
Q58EN7_DANRE/321-556DEKE---------WKLGKRKAEKDET-----------VGVKIFSTID.PEL.PELDPAQVEQKYEVYNQFTRSMDNSVKE
Q5DTD0_DANRE/328-561DEKA---------WKQGKRKAEKDDL-----------VGANFFLTIC.PPA.LPLDLQEVENKVEGFKTFTKKMDENIIQ
Q4S383_TETNG/309-534DEKA---------WKQGKRKAEKDEL-----------VGANFFLTISTPS..VPLDLQEVESKIEGFKTFTKKLDENIVV

PF04136

COG3_HUMAN/126-282---------------KYRQMRDYLSG-----------FQE.-------------------..QCDAILNDVNSALQHLES
COG3_SCHPO/100-257---------------DAEKKINELQT-----------FTN.-------------------..IIDQILGQTNNIESTLLS
COG3_DROME/110-269---------------GDADYHKYLQQ-----------LEQR-------------------KAECSHMLDQIAGAMERLGA

PF13805

C5GWX7_AJEDR/1-271MHRT---------YSMRQSRTPTASQ..LENPPPPPSTTKTNRLFGRTSLG.HAFRKQTAGAFGPDLSRKLSQLVKMEKN
SLBR2_SCHPO/2-270MNRA---------YSLRNSRAPTASQ..LLNPPPPSSSTRSGRLFA..PLS.HTMRINHAATFTPDLAKRLAVLVKMEKN
A6ZV68_YEAS7/1-270MHRT---------YSLRNSRAPTASQ..LQNPPPPPSTTKG.RFFGKGGLA.YSFRRSAAGAFGPELSRKLSQLVKIEKN
Q6CC94_YARLI/1-271MHRT---------YSLRNSRAPTAAQ..LASPPPPTSSTKSGRFFGNGSIV.HSFRRSAAGSMGPDLARKLAQLVKMEKN
C4YEG9_CANAW/1-270MHRT---------YSLRSSKAPTASQ..LQSPPPPPSSTKNK.FFGSGGLS.STIRKAAAGATGPELSRKLSQFIKMEKN
C5DXD8_ZYGRC/1-270MHRT---------YSLRNQRVPTASQ..IQSPPPPPSSTKSK.FFGKASIA.STFRKNAAGNFGPDLARKLSQLVSTEKG
Q2HFB9_CHAGB/2-286LNRA---------LSIRSSNRSSNGTTSTTTSSGTTTTTASSSHRK..PFSFHSLR....GASQPALSKRLYRLIKSANT

PF10455

MUG64_SCHPO/18-286SITP----------FAKKTTHYLRTK-----------IGSRV.............EELSLPEDYVELEQQVDSLKEAYNL
A3GFN0_PICST/37-331SIQP----------FATKTTQLISTQ-----------LQQVQHLANL..NVNSNIEVSELPAEYLQLETNCDLLLKLYTD
A5DTV0_LODEL/37-351SIQP----------FTNKTQQLLNEQ-----------LKQVQQLASNVSALPPNIEVSELPKDYLELEVNCDLLLKLYTE
A7TPP1_VANPO/27-288TIPT----------VAQSTHRMVKEK-----------LGQVD.............DISPLPQEYLDLELKIDTYKSVYEH
GVP36_YEAST/27-299ELPS----------LAQSTQRMVQER-----------LGQVT.............DISQLPREYTELEDKVDTIKLIYNH
YP148_YEAST/45-432R.LS----------IKSRT.RFVQES-----------LGTVS.............DISKLPPQYQFLEKKSDSLEKVCKR
Q59WJ7_CANAL/37-331SIQP----------YTTKTTQLISEQ-----------LKHLEQLANN...TTDDIDVSELPQDYLQLESNCDLLLKLYTD
Q6CPI5_KLULA/40-383R.LS----------ILKRR.HQLQET-----------LGTVH.............DISQLPIQYKFLEQKSDALEKICKR
Q6FKU8_CANGA/30-382K.LS----------IKAKT.RFLQEA-----------IGNER.............DISKLPPQYVVLEKKCDSIEKVLKR
Q753K3_ASHGO/49-359TILS----------LKTRK.RQLQET-----------LGSAK.............DISQLPPQYGFLERKCDAIEQVCKK

PF03114

ARH37_MOUSE/243-445LSKK..-------..TTRLSQMLKQE-----------AGLVS-------------RTE..DKEFDDLEERFQWVSLCVKE
RHG17_RAT/1-239MKKQ..-------..FNRMKQLANQT-----------VGRAE-------------KTEVLSEDLLQIERRLDTVRSMCHH
RHG44_HUMAN/1-242MKKQ..-------..FNRMRQLANQT-----------VGRAE-------------KTEVLSEDLLQVEKRLELVKQVSHS
SH3G3_MOUSE/6-242LKKQ..-------..FHKASQLFSEK-----------ISGAE-------------GTK.LDEEFLNMEKKIDITSKAVAE
Q8X0D7_NEUCS/18-242FKKN..-------..VNRATTQVMMK-----------TGHVE-------------KTN..DRDYEVEERRFKTMEAASLR
Q8WQ54_GEOCY/24-244TVKR..-------..AQRVQEKMMQK-----------LGKSD-------------QTR..DEVFEEFVNNFHKQNASAIK
Q8NJ03_NEUCS/6-247FQKS..-------..VVRAPQQFKQK-----------FNLGE-------------HTK..DPVYIDSERRFQELETETKR
SH3G3_DROME/6-241LKKQ..-------..INKANQYMTEK-----------MGGAE-------------GTK.LDMDFMEMERKTDVTVELVEE
Q95K31_MACFA/140-339ISKK..-------..SKRVTNHLKIL-----------TRGES-------------QVK..DNTFNREEKLFRALEKTVRL
Q8X0D6_NEUCS/3-231ITKK..-------..FDRAFQWAGEK-----------MGAEQ-------------KTT.MSEDFKQLEMEMALRFEGMDR
Q20005_CAEEL/8-266IASDAG-------GFFSRAKQLTEET-----------FLKAE-------------RTE.LDSHFENLLQRADKTEDHTRR
HOB1_SCHPO/6-247FTKA..-------..LARTPQTLRSK-----------FNVGE-------------ITK..DPIYEDAGRRFKSLETEAKK
O61843_CAEEL/6-240LRKQ..-------..FNKANQYLSET-----------MGAAE-------------PTK.LDDVFNEMEKNVDTTYNLITD
Q7ZWA0_DANRE/6-242LKKQ..-------..FYKASQLMSEK-----------VGGAE-------------GTK.LDEDFKDLERKADITSKAISD
Q8SYD9_DROME/13-268LVKEAG-------STISRVVQLTEEK-----------LGTTE-------------RTE.YDLHFQNLAERADVTKTWTEK
Q8IZ09_HUMAN/6-242LKKQ..-------..FHKATQKVSEK-----------VGGAE-------------GTK.LDDDFKEMERKVDVTSRAVME
AMPH_RAT/13-233VQKR..-------..LNRAQEKVLQK-----------LGKAD-------------ETK..DEQFEEYVQNFKRQEAEGTR
RV167_YEAST/6-247FTKA..-------..VSRAPQSFRQK-----------FKMGE-------------QTE..DPVYEDAERRFQELEQETKK
Q9XW43_CAEEL/24-258AAKAG.-------.LFNRIYVTVGQK-----------VGIVE-------------LTK.LEPRFERNIEKLTTYHNIIYN
Q94211_CAEEL/24-258AAKAG.-------.FVNRLYVNIGQK-----------VGVVE-------------LTK.LEPRFERNIDKLTSYHNLIYK
Q803I3_DANRE/25-245FQKS..-------..MNRAQEKVLQK-----------LGKTM-------------ETK..DEQFEECSANLNKQQTDGIR
Q21004_CAEEL/9-230LKKA..-------..TNRTKEKLLEG-----------IGKAK-------------ATQ..DEVFDQHAANLNKQSKSCEK
YNQA_SCHPO/1-230MNKH..-------..FAKLSQWTGEK-----------FGFDR-------------QKTTLSDDFCSLKGETDAWLVGMDK
DNMBP_HUMAN/997-1207IIKK..-------..SNRVSSHLKHL-----------TGFAP-------------QIK..DEVFEETEKNFRMQERLIKS
SHLB1_HUMAN/11-254LAADAG-------TFLSRAVQFTEEK-----------LGQAE-------------KTE.LDAHLENLLSKAECTKIWTEK
Q7ZVM8_DANRE/6-242FKKQ..-------..FHKASQLLKEK-----------INGVE-------------GTK.LDEEFLSMERKTEITHKLILD
RV161_YEAST/6-232FKKA..-------..INRAGHSVIIK-----------..NVD-------------KTI..DKEYDMEERRYKVLQRAGEA
Q9DDR3_LAMFL/6-242FKKQ..-------..FYKASQFVSEK-----------VGGAE-------------GTK.LDDDFTEMEKKYDTTNKAVMD

PF06456

ICA69_MOUSE/21-248VVNKMQ.......QKYWETKQAFIKA-----------TGKKE-----------DEHVVASDADLDAKLELFHSIQRTCLD
PICK1_MOUSE/117-352VLKKVK.........HRLVENMSSGT-----------ADALG-----------LSRAILCNDGLVKRLEELERTAELYKG
RIC19_CAEEL/27-255TVNTMQ.......RHYWTARQFIRTK-----------LGKKE-----------DEHLEASDNELDTCLNLYRSVHGTSFQ
YL87_CAEEL/59-286VAAKVESFKKWTIGTFKNSKQQLLEH-----------MGKID-----------K....TVDPEFEAQCEVLKDIHRRYGL
O18246_CAEEL/113-348LIKKVK.........HKVVEFVDQDS-----------ADALG-----------LSRAILTNDPLAEKEKILEENAEFYRH
ARFP2_HUMAN/89-316AGEKFDIVKKWGINTYKCTKQLLSER-----------FGRGS-----------R....TVDLELELQIELLRETKRKYES
ARFP1_HUMAN/121-348AMEKLELVRKWSLNTYKCTRQIISEK-----------LGRGS-----------R....TVDLELEAQIDILRDNKKKYEN
ICA1L_MOUSE/15-242VVSRMQ.......KNYWRTKQVFIKA-----------TGKKE-----------DEHVVASDAELDAKLEVFHSIQETCNE
Q8SY07_DROME/119-354ILKKLK.........HRIVDNLSSNT-----------ADTLG-----------LSRAILCNDSLVKRLEELEGTELMYKG
Q9VGQ8_DROME/106-331SASKIDSLKNWSISTYKCTRQIMLEK-----------LGKSQ-----------R....TVDSELEAQIEQLRETQRKYLS
Q9VP78_DROME/2-228LKSEVQ.......HQFWITKKVVQRK-----------LGTKE-----------DKHIISSDAELDSKIEVFKSISDTSLN

PF08397

Q568N5_DANRE/16-235-------------------YKNVMEQ-----------FN...-------------------PGLRNLINLGKSYEKAVSA
BAIP2_HUMAN/17-237-------------------YKTIMEQ-----------FN...-------------------PSLRNFIAMGKNYEKALAG
Q6P7G7_XENLA/16-236-------------------YRNVMNQ-----------FN...-------------------PGLRNLVNLGRNYEKAVAA
MTSS1_HUMAN/16-237-------------------FQTIISD-----------MKGSY-------------------PVWEDFINKAGKLQSQLRT
MTSSL_HUMAN/15-239-------------------FQAIVND-----------MKSSY-------------------PIWEDFNSKATKLHSQLRT
BI2L2_HUMAN/16-226-------------------YKSIMEQ-----------FN...-------------------PALENLVYLGNNYLRAFHA
Q6NV36_DANRE/16-235-------------------YKNVMEQ-----------FN...-------------------PGLRNLVNLGKNYEKSVAA
Q6AX92_XENLA/16-237-------------------FQTIVND-----------MKASY-------------------PTWEDFVSKATKLQSHLKT

PF06730

F92A1_HUMAN/1-219LCQIF-AAYVRK-----TARLRDKAD------------------------------------------------------
F92A1_MOUSE/70-288LCQIF-AAYVRK-----TARLRDKAD------------------------------------------------------
Q9VK91_DROME/1-222MCSSF-ALVTRK-----MAKYRDSFD------------------------------------------------------

PF09325

Q6BQ29_DEBHA/424-659FYKSI-ELINNQ-----RQEMAGLVD------------------------------------------------------
Q9C2E4_NEUCS/307-541LLKAM-DSMVAQ-----RKAMAEAAG------------------------------------------------------
Q7PVK3_ANOGA/210-443LHSAI-KALVSH-----RKELATLTG------------------------------------------------------
Q4R6S4_MACFA/236-469LHAVV-ETLVNH-----RKELALNTA------------------------------------------------------
Q5BN90_ACECL/162-395TYRRA-SDLVNK-----QQALGGALA------------------------------------------------------
Q5DFB1_SCHJA/196-436LHSSL-LNLVSG-----DNDLANAEA------------------------------------------------------
VPS5_YEAST/439-673LSKSL-EMVDTS-----RNTLAASTE------------------------------------------------------
SNX2_HUMAN/281-514LHVSV-EALVCH-----RKELSANTA------------------------------------------------------
Q86IF6_DICDI/292-523LEDTI-NNVIRK-----RRELAAAMG------------------------------------------------------
Q5A1F2_CANAL/431-666FYKTI-ELIGQQ-----RLDMIGILD------------------------------------------------------
Q5B786_EMENI/288-522LMKAI-DTVVAQ-----RKGLSEAAG------------------------------------------------------
A8WVN0_CAEBR/231-466LYTVT-ESLVAS-----RREMATSGE------------------------------------------------------
Q5KI36_CRYNJ/639-879LAKAI-EISSKH-----RVEVAISLA------------------------------------------------------
VPS5_SCHPO/340-576VYHAL-LLSIDQ-----RIQFASAIH------------------------------------------------------
Q6CJR1_KLULA/428-663LYKAL-ELVDSQ-----RSDLCSVIN------------------------------------------------------
Q675P9_OIKDI/236-470LSMAS-GNLSVH-----RRELGLSSG------------------------------------------------------
Q6CGR9_YARLI/393-628MSRGL-ELVVHQ-----RKDLAESMG------------------------------------------------------
Q759R2_ASHGO/362-598MYKSL-ELVDSQ-----KNELVSVIK------------------------------------------------------
Q4P3M6_USTMA/831-1062MVKSV-SALSNQ-----RKQMVQATH------------------------------------------------------
Q8MS29_DROME/220-453LHNAM-KSLVTS-----RRELSLLTG------------------------------------------------------
Q6FKM2_CANGA/398-636MLKAV-ESIEEQ-----RRELSSYTY------------------------------------------------------
Q4V8Z4_DANRE/286-519LHAAV-DSLVNH-----RKELCINTA------------------------------------------------------

PF10456

SNX33_MOUSE/337-572LSNVA-AELVRKHVGGFRKEFQKLGS------------------------------------------------------
Q8I4E1_CAEEL/334-564MQERM-NMFQKVFAGPVKQNWQKMGS------------------------------------------------------
SNX9_MOUSE/358-593LLTVG-QEHWKRCTGPLPKEYQKIGK------------------------------------------------------
Q5SPP1_DANRE/370-606LLTVG-NEHWKRCTGPLPKEYQRIGK------------------------------------------------------
Q5XGZ5_XENLA/348-585LSQTA-GEFARKQASGFKKEYQKVGL------------------------------------------------------
Q58EN7_DANRE/321-556LLAVG-NLHWKRCTGPLQKEYRQIGK------------------------------------------------------
Q5DTD0_DANRE/328-561VNVTI-NEFARKQITGFKKEYQRVGQ------------------------------------------------------
Q4S383_TETNG/309-534VNTTI-IEFARKQATGFKKEYQKVGQ------------------------------------------------------

PF04136

COG3_HUMAN/126-282LQKQY-LFVSNK-----TGTLHEACE------------------------------------------------------
COG3_SCHPO/100-257MKEKF-ESSEKK-----LSEFSEMCE------------------------------------------------------
COG3_DROME/110-269LCDEY-DFVSQK-----TSALNTASE------------------------------------------------------

PF13805

C5GWX7_AJEDR/1-271VMRSM-ELVGRE-----RMEAAQQLS------------------------------------------------------
SLBR2_SCHPO/2-270VMRSM-EVTIRG-----RRDCARQLS------------------------------------------------------
A6ZV68_YEAS7/1-270VLRSM-ELTANE-----RRDAAKQLS------------------------------------------------------
Q6CC94_YARLI/1-271VMRSI-EQQARE-----RREVAKQLS------------------------------------------------------
C4YEG9_CANAW/1-270FMRAV-EVTSRE-----RKDVAKQLS------------------------------------------------------
C5DXD8_ZYGRC/1-270VLRSL-EVVAYE-----RRAAARQLS------------------------------------------------------
Q2HFB9_CHAGB/2-286LVSAH-ETAARE-----RLSIATQLS------------------------------------------------------

PF10455

MUG64_SCHPO/18-286VLPIV.ETVEVD-----GYDYPT..NFRDSITD..FGKTVSGKVRNLGNLTPLEQTPLASVGKNLEEKEAAAKP......
A3GFN0_PICST/37-331LIQYSNETFNNI-----SYDYPPGNYTITKIKDANVGGVLATKFNQLKNVSSPQELENILLGKEAGDADSAEKDV.....
A5DTV0_LODEL/37-351LIQSNNSTYGQL-----SYDYPPGNTAFNKLKDAHIGDSIGAKFNQLKNVSSPQELEKVLLGQASKDAGDDEEEGEEGED
A7TPP1_VANPO/27-288FLKIT.SIYERE-----SYDYPK..EFSESVNE..FTDSIGNKMYEFSNGVSTEGSSGKT....................
GVP36_YEAST/27-299FLGVT.AIYENG-----SYDYPK..YINESVNE..FSRSVASKLTELTHATSASEAQNILVAPGPIKE............
YP148_YEAST/45-432ILLVS.KTFEVE-----GYDYPP..NLTESISD..WW..............SLNKDGW..FGSKKSESSTKKKG......
Q59WJ7_CANAL/37-331LIQTTNETYGKV-----SYDYPPGNYAINKIKDANVSGLIGQKFNQLKNVSSPQELEKVLLGQDVDAESKDESGV.....
Q6CPI5_KLULA/40-383LLLVT.KTFEVE-----GYDYPP..NLTESFND..WW..............SGNKDSIFSFSKKKAEVSPEVKE......
Q6FKU8_CANGA/30-382ILIVT.KTYEIE-----GYDYPP..NISESLSS..WWQT.....KEWFNISELTKNVIPKHGNVEKAGTEASKTL.....
Q753K3_ASHGO/49-359ILVVS.KTFEVE-----GYDYPP..NPTESISD..WWNT............STKETRFLKFGKGGTDKQKEDKQ......

PF03114

ARH37_MOUSE/243-445LRNNV-VDFMGN-----LEVFLSFRP.......-----------------------------------------------
RHG17_RAT/1-239SHKRL-IACFQG-----QHGTDAERRHKK....-----------------------------------------------
RHG44_HUMAN/1-242THKKL-TACLQG-----QQGAEADKRSKK....-----------------------------------------------
SH3G3_MOUSE/6-242ILSKA-TEYLQP-----NPAYRAKLGMLNTVSK-----------------------------------------------
Q8X0D7_NEUCS/18-242LQKEA-KGYLDS-----LRAMTASQM.......-----------------------------------------------
Q8WQ54_GEOCY/24-244LQKEL-MKYMNS-----IRVLYQNTK.......-----------------------------------------------
Q8NJ03_NEUCS/6-247LHDES-KKYFEA-----INGMLQHQI.......-----------------------------------------------
SH3G3_DROME/6-241LQLKT-KEFLQP-----NPTARAKMAAVKGISK-----------------------------------------------
Q95K31_MACFA/140-339CVKNI-SLCLQH-----IQDAMPLAL.......-----------------------------------------------
Q8X0D6_NEUCS/3-231LQKSM-NLYVK.-----.........WLGRRCD-----------------------------------------------
Q20005_CAEEL/8-266LLSAI-EGYLQP-----NPTVRMEEVFYEKLEL-----------------------------------------------
HOB1_SCHPO/6-247LAEDA-KKYTDA-----INGLLNHQI.......-----------------------------------------------
O61843_CAEEL/6-240LVAGT-NEYLQP-----NPATRAKMATQVALSK-----------------------------------------------
Q7ZWA0_DANRE/6-242VLCKT-TEYLQP-----NPASRARLTMANAMSK-----------------------------------------------
Q8SYD9_DROME/13-268IVRDT-ESVLIP-----NPQNRVEDFIFEKIEK-----------------------------------------------
Q8IZ09_HUMAN/6-242IMTKT-IEYLQP-----NPASRAKLSMINTMSK-----------------------------------------------
AMPH_RAT/13-233LQREL-RGYLAA-----IKGMQEASM.......-----------------------------------------------
RV167_YEAST/6-247LSEES-KRYSTA-----VNGMLTHQI.......-----------------------------------------------
Q9XW43_CAEEL/24-258MVNAI-ELQVQV-----DPKAIVKNQVLCDP..-----------------------------------------------
Q94211_CAEEL/24-258IVNVI-ELQVQF-----MPKAMAKKAVLCAP..-----------------------------------------------
Q803I3_DANRE/25-245LYKDV-KAYYNA-----VKVMHESSK.......-----------------------------------------------
Q21004_CAEEL/9-230LHKDV-KNYSSA-----LRTLLSAEK.......-----------------------------------------------
YNQA_SCHPO/1-230IHRSC-TRWVR.-----.........NMDKRKG-----------------------------------------------
DNMBP_HUMAN/997-1207FIRDL-SLYLQH-----IRESACVKV.......-----------------------------------------------
SHLB1_HUMAN/11-254IMKQT-EVLLQP-----NPNARIEEFVYEKLDR-----------------------------------------------
Q7ZVM8_DANRE/6-242IVPKT-IGYLQP-----NPAYRAKLSMLSTVSR-----------------------------------------------
RV161_YEAST/6-232LQKEA-KGFLDS-----LRAVTASQT.......-----------------------------------------------
Q9DDR3_LAMFL/6-242IITKT-QEYLQP-----NPASRAKLGMLNTMSK-----------------------------------------------

PF06456

ICA69_MOUSE/21-248LSKAI-VLYQKR-----ICFLSQEEN------------------------------------------------------
PICK1_MOUSE/117-352MTEHT-KNLLRA-----FYELSQTHR------------------------------------------------------
RIC19_CAEEL/27-255LLNNV-DNYANF-----LLDETLVQN------------------------------------------------------
YL87_CAEEL/59-286VVAAA-KNFSHV-----LTQMAEAEK------------------------------------------------------
O18246_CAEEL/113-348LVAYF-GDMFQY-----QQKISECQK------------------------------------------------------
ARFP2_HUMAN/89-316VLQLG-RALTAH-----LYSLLQTQH------------------------------------------------------
ARFP1_HUMAN/121-348ILKLA-QTLSTQ-----LFQMVHTQR------------------------------------------------------
ICA1L_MOUSE/15-242LVKIV-EKYQLR-----LNVISEEEN------------------------------------------------------
Q8SY07_DROME/119-354LVEHA-RRMLKA-----YYDLLQTYK------------------------------------------------------
Q9VGQ8_DROME/106-331ILRLT-RAFSSH-----FQHVVVTQH------------------------------------------------------
Q9VP78_DROME/2-228LCKII-DQYQER-----LCILSQEEC------------------------------------------------------

PF08397

Q568N5_DANRE/16-235MVLAG-KQYFDA-----VSKIGENAA------------------------------------------------------
BAIP2_HUMAN/17-237VTYAA-KGYFDA-----LVKMGELAS------------------------------------------------------
Q6P7G7_XENLA/16-236MVQAG-RAYYDG-----VAKMGELAS------------------------------------------------------
MTSS1_HUMAN/16-237TVVAA-AAFLDA-----FQKVADMAT------------------------------------------------------
MTSSL_HUMAN/15-239TVLAA-VAFLDA-----FQKVADMAT------------------------------------------------------
BI2L2_HUMAN/16-226LSEAA-EVYFSA-----IQKIGERAL------------------------------------------------------
Q6NV36_DANRE/16-235MTFAG-KAYFDA-----LSKIGESAA------------------------------------------------------
Q6AX92_XENLA/16-237MIIVT-GSFLDA-----FQKIADMAI------------------------------------------------------

PF06730

F92A1_HUMAN/1-219----------------------------LLVNEINAYAAT----------------------------------------
F92A1_MOUSE/70-288----------------------------LLVNEINLYAST----------------------------------------
Q9VK91_DROME/1-222----------------------------ELAKSVKSYADD----------------------------------------

PF09325

Q6BQ29_DEBHA/424-659----------------------------EISLTIDELASL----------------------------------------
Q9C2E4_NEUCS/307-541----------------------------EFSASLHALSTV----------------------------------------
Q7PVK3_ANOGA/210-443----------------------------GVAKSAALLSTC----------------------------------------
Q4R6S4_MACFA/236-469----------------------------QFAKSLAMLGSS----------------------------------------
Q5BN90_ACECL/162-395----------------------------DFGDAADKLGKF----------------------------------------
Q5DFB1_SCHJA/196-436----------------------------GLSRSILLLANV----------------------------------------
VPS5_YEAST/439-673----------------------------EFSSMVETLASL----------------------------------------
SNX2_HUMAN/281-514----------------------------AFAKSAAMLGNS----------------------------------------
Q86IF6_DICDI/292-523----------------------------ELTSAGLSFSSC----------------------------------------
Q5A1F2_CANAL/431-666----------------------------EIALTMSELAGL----------------------------------------
Q5B786_EMENI/288-522----------------------------EFSTSIQSLAAV----------------------------------------
A8WVN0_CAEBR/231-466----------------------------LLGKALSMLAAC----------------------------------------
Q5KI36_CRYNJ/639-879----------------------------DYAESLTALAES----------------------------------------
VPS5_SCHPO/340-576----------------------------DFGEAVGNLSLV----------------------------------------
Q6CJR1_KLULA/428-663----------------------------EFSETLKALADL----------------------------------------
Q675P9_OIKDI/236-470----------------------------NLARASNMLANA----------------------------------------
Q6CGR9_YARLI/393-628----------------------------DVAAVLSSLGTV----------------------------------------
Q759R2_ASHGO/362-598----------------------------EFAATINSLVEL----------------------------------------
Q4P3M6_USTMA/831-1062----------------------------DLAQVLTTLSGS----------------------------------------
Q8MS29_DROME/220-453----------------------------LVAKSAAMLSTC----------------------------------------
Q6FKM2_CANGA/398-636----------------------------DLASLIESLGAL----------------------------------------
Q4V8Z4_DANRE/286-519----------------------------VFSKSVAMLGSV----------------------------------------

PF10456

SNX33_MOUSE/337-572----------------------------AFQAISHAFQMD----------------------------------------
Q8I4E1_CAEEL/334-564----------------------------AFKTLQQSFEID----------------------------------------
SNX9_MOUSE/358-593----------------------------ALQSLAAVFSSS----------------------------------------
Q5SPP1_DANRE/370-606----------------------------AFQNLSSVFTTS----------------------------------------
Q5XGZ5_XENLA/348-585----------------------------AVRGLGQAFEMD----------------------------------------
Q58EN7_DANRE/321-556----------------------------AFQNMSSVFNTS----------------------------------------
Q5DTD0_DANRE/328-561----------------------------AFRLLSQAFEVD----------------------------------------
Q4S383_TETNG/309-534----------------------------SFKLLAQAFELD----------------------------------------

PF04136

COG3_HUMAN/126-282----------------------------QLLKEQSELVDL----------------------------------------
COG3_SCHPO/100-257----------------------------NLSTDEMRFSEI----------------------------------------
COG3_DROME/110-269----------------------------QLIEEQERLQEL----------------------------------------

PF13805

C5GWX7_AJEDR/1-271----------------------------FWGES.......----------------------------------------
SLBR2_SCHPO/2-270----------------------------YWGED.......----------------------------------------
A6ZV68_YEAS7/1-270----------------------------IWGLE.......----------------------------------------
Q6CC94_YARLI/1-271----------------------------LWGED.......----------------------------------------
C4YEG9_CANAW/1-270----------------------------AWGED.......----------------------------------------
C5DXD8_ZYGRC/1-270----------------------------LWGVD.......----------------------------------------
Q2HFB9_CHAGB/2-286----------------------------EWGEQTPAAYTV----------------------------------------

PF10455

MUG64_SCHPO/18-286...................SRTLYNAISRAASEAT...TKM.......................................
A3GFN0_PICST/37-331..........AIQTTSVLLPKTLYGALSVLAEKHS...QEL.......................................
A5DTV0_LODEL/37-351RKAGADGSLVTIQPTSGGIPRTLFGHLSEILAKQS...EELQ......................................
A7TPP1_VANPO/27-288...................PRTLNYAVSKVSMGASEQFQKL.......................................
GVP36_YEAST/27-299...................PKTLNYALSKVALNSSECLNKM.......................................
YP148_YEAST/45-432...........SNHDDAFLPRSFAQAISKAAVDCECEFQNLEHNEKAELKKKKESIKTAQTTEAQGADHNEEDEEDEEDE
Q59WJ7_CANAL/37-331.........VSIQPTSPQLPKTLFGHLAEICAKHS...DEL.......................................
Q6CPI5_KLULA/40-383............TAENGLLPRSFAQALSKAATDSALILKQLKAEETRTNQEESQEGADQK.PAEETKAEPELEAEADEDE
Q6FKU8_CANGA/30-382..........TDKEVSHEGPPSFASAIARAGKDSQLIFESIETK..................................DE
Q753K3_ASHGO/49-359...........KQAAGSSDPPSFAHALHRAAKGSQGIIQELKEQAEE...........................EQEQEV

PF03114

ARH37_MOUSE/243-445-------------.........................HER---------------------------------------
RHG17_RAT/1-239-------------...........LPLTALAQNMQEASAQL---------------------------------------
RHG44_HUMAN/1-242-------------...........LPLTTLAQCLMEGSAIL---------------------------------------
SH3G3_MOUSE/6-242-------------LRGQVKATGYPQTEGLLGDCMLKYGKEL---------------------------------------
Q8X0D7_NEUCS/18-242-------------...............RIAETIDAFYGEA---------------------------------------
Q8WQ54_GEOCY/24-244-------------...............SMSDTLKELYEED---------------------------------------
Q8NJ03_NEUCS/6-247-------------...............EFSKAMTEIYKPI---------------------------------------
SH3G3_DROME/6-241-------------LSGQAKSNTYPQPEGLLAECMLTYGKKL---------------------------------------
Q95K31_MACFA/140-339-------------...............QSVMDLQEISYNK---------------------------------------
Q8X0D6_NEUCS/3-231-------------SY...EDKDKSIPTTYLGKTMIGHGEDF---------------------------------------
Q20005_CAEEL/8-266-------------KK...DGAIRQNNLEQLSTAMTEAGEQF---------------------------------------
HOB1_SCHPO/6-247-------------...............GFADACIEIYKPI---------------------------------------
O61843_CAEEL/6-240-------------VRGTTKTSPYPQTEGMLADVMQKYGQQL---------------------------------------
Q7ZWA0_DANRE/6-242-------------MRGQVKSLGYPQAEGLLGECMLKYGRDM---------------------------------------
Q8SYD9_DROME/13-268-------------S.....KPKRLSNLEHLALDMIEAGGDF---------------------------------------
Q8IZ09_HUMAN/6-242-------------IRGQEKGPGYPQAEALLAEAMLKFGREL---------------------------------------
AMPH_RAT/13-233-------------...............KLTESLHEVYEPD---------------------------------------
RV167_YEAST/6-247-------------...............GFAKSMEEIFKPI---------------------------------------
Q9XW43_CAEEL/24-258-------------.........DESPWELLGGWINYMGTYH---------------------------------------
Q94211_CAEEL/24-258-------------.........GENPWEVLGGWLNYLGKNQ---------------------------------------
Q803I3_DANRE/25-245-------------...............RLSQTLKDIYEPD---------------------------------------
Q21004_CAEEL/9-230-------------...............QLRDTIRDAYEPE---------------------------------------
YNQA_SCHPO/1-230-------------LL...DEKDKQLPVTHVGSSFVELGQAL---------------------------------------
DNMBP_HUMAN/997-1207-------------...............VAAVSMWDVCMER---------------------------------------
SHLB1_HUMAN/11-254-------------K.....APSRINNPELLGQYMIDAGTEF---------------------------------------
Q7ZVM8_DANRE/6-242-------------IRGHVKAVGYPQTEGILGDCMLQYGSEL---------------------------------------
RV161_YEAST/6-232-------------...............TIAEVISNLYDDS---------------------------------------
Q9DDR3_LAMFL/6-242-------------IRGQVKSTGYPQPEGLLGEAMAKYGKDM---------------------------------------

PF06456

ICA69_MOUSE/21-248----------------------------ELGKFLRSQGFQD---------------------------------------
PICK1_MOUSE/117-352----------------------------AFGDVFSVIGVRE---------------------------------------
RIC19_CAEEL/27-255----------------------------VLGKYLKEKGKID---------------------------------------
YL87_CAEEL/59-286----------------------------KLSESFYQLSM..---------------------------------------
O18246_CAEEL/113-348----------------------------EFGSIFCDLAAHE---------------------------------------
ARFP2_HUMAN/89-316----------------------------ALGDAFADLSQ..---------------------------------------
ARFP1_HUMAN/121-348----------------------------QLGDAFADLSL..---------------------------------------
ICA1L_MOUSE/15-242----------------------------ELGLFLKFQAERD---------------------------------------
Q8SY07_DROME/119-354----------------------------SFGDCFTQISVHE---------------------------------------
Q9VGQ8_DROME/106-331----------------------------ALADSFADLAQ..---------------------------------------
Q9VP78_DROME/2-228----------------------------VFGRFLKEAGK..---------------------------------------

PF08397

Q568N5_DANRE/16-235----------------------------VSPV.SRELG------------------------------------------
BAIP2_HUMAN/17-237----------------------------ESQG.SKELG------------------------------------------
Q6P7G7_XENLA/16-236----------------------------ASHV.SKELG------------------------------------------
MTSS1_HUMAN/16-237----------------------------NTRGGTREIG------------------------------------------
MTSSL_HUMAN/15-239----------------------------NTRGATRDIG------------------------------------------
BI2L2_HUMAN/16-226----------------------------QSPT.SQILG------------------------------------------
Q6NV36_DANRE/16-235----------------------------VSPV.SRELG------------------------------------------
Q6AX92_XENLA/16-237----------------------------NTRGATKEIG------------------------------------------

PF06730

F92A1_HUMAN/1-219-ETP-HLKL.----------.GLMNFADEFAKL-QDYRQAEVERL-EAKVVEPLKTYG-TIVKMKRD-------------
F92A1_MOUSE/70-288-ETP-NLKQ.----------.GLKDFADEFAKL-QDYRQAEVERL-EAKVVEPLKAYG-TIVKMKRD-------------
Q9VK91_DROME/1-222-EEI-NESLC----------QGLKSFTNAVTIM-GDYMDINVHRL-EHKIVNELAQFE-QLCKSTRD-------------

PF09325

Q6BQ29_DEBHA/424-659-EIS..KITT----------DLLSSFSDVQLKL-KENLDRINLQD-QLTLGFTIEEYL-RIIGSIKYVFESRS----KIY
Q9C2E4_NEUCS/307-541-ELS..PTLS----------GPLDALSELQLTI-RDVYDRQAQQD-VLTFGIIIEEYI-RLIGSVKQAFSQRQ----KAF
Q7PVK3_ANOGA/210-443-EEH..TGLS----------QALSQLADVEEKV-ELLRSEQANSD-LYILSETIKDYI-GLFGAIKDVFHERV----KVF
Q4R6S4_MACFA/236-469-EDN..TALS----------RALSQLAEVEEKI-EQLHQEQANND-FFLLAELLSDYI-RLLAIVRAAFDQRM----KTW
Q5BN90_ACECL/162-395-EQP...RLQ----------EAFSQLGRHAGDL-SRGNEEHADKM-YSTFEAPLKEFY-RMVRSVKQTMTDRA----AAL
Q5DFB1_SCHJA/196-436-EEN..TGLA----------QALHHLAETEGHI-ADLHALQADAL-TCHLVEYSREIL-GMVQACKDVLSERV----RIY
VPS5_YEAST/439-673-NVS..EPNS----------ELLNNFADVHKSI-KSSLERSSLQE-TLTMGVMLDDYI-RSLASVKAIFNQRS----KLG
SNX2_HUMAN/281-514-EDH..TALS----------RALSQLAEVEEKI-DQLHQEQAFAD-FYMFSELLSDYI-RLIAAVKGVFDHRM----KCW
Q86IF6_DICDI/292-523-EIPVRQDIA----------NGYQRLTEVENNI-RQGMEDLSNNE-QGYFEEGIRDYL-RAISSVKELLNDRL----DAL
Q5A1F2_CANAL/431-666-EIS..KVTS----------DLLSAFSEVELKI-KDNLDRINLQD-QLTLGFTIEEYL-RIIGSINFVFDTRL----NVY
Q5B786_EMENI/288-522-ELS..PLLS----------GPLYGLSDLQLRI-KELYDRQAQQD-VLTLGITIDEYL-RLIGSVKTAFSQRQ----KAY
A8WVN0_CAEBR/231-466-EES..TSLS----------RALSALTDVTESV-SNAWGKQAEID-NAKFSEAIYEYI-MLISALKDVFGERV----RAW
Q5KI36_CRYNJ/639-879-DLG..ASLS----------AALSQMSGLVARE-GDYAEWHAKSE-VGELLNLADEYI-RFIGSVRSAFAARV----DSW
VPS5_SCHPO/340-576-DLE..PTLS----------SKFDGLSQLQVEL-RFVQERKVAQD-NLTLGTTLEEYI-RYVESAKNAFTTRQ----KLW
Q6CJR1_KLULA/428-663-ELS..NRTS----------DLLQNFAEVHLRI-KESTSRSSMQD-SLTLGITIDDNL-RAIGSVKAVLNQRK----KLG
Q675P9_OIKDI/236-470-EDK..QDLS----------RRLANVGTIYENL-GEIYTDLSDKD-LYDFSELLSDQV-RGLDGIKNILEARQ----KMW
Q6CGR9_YARLI/393-628-EIS..KHLS----------NVLYQFSDAVERI-KEICARQSQQD-MVTLGSTMDEYL-RVIGSVRSTFSQRS----KHF
Q759R2_ASHGO/362-598-EAS..KRIS----------SILSNFAEVHLRI-MESLQRTSLQD-SLTLGVTIDEYL-RSLGSIKAVFNQRA----KLG
Q4P3M6_USTMA/831-1062-SLS..RSLS----------TCFAGLAEVKRRA-IELEDMQAEAD-VRQLGTTMYEYE-RVVGSVRKAFTVRT----EIW
Q8MS29_DROME/220-453-EEH..TGLS----------RALSNLADVEEKI-ELLRSEQANSD-FFILAEFIKDYL-GLFGAIKCIFHERV----KAF
Q6FKM2_CANGA/398-636-DVT..KGST----------KLCYELAETQKRV-KESLERDALQE-AITMGATLDEYV-RSLASLRSIFYQRA----KLG
Q4V8Z4_DANRE/286-519-EEN..SALS----------RALSQLAEVEDKM-EQLHQQQAFSD-FFILAELLADYV-RLLGAVRCCFEQRM----KVW

PF10456

SNX33_MOUSE/337-572-PPFRSDALN----------NAISHTGRTYETV-GEMFAEQPKHD-LFQMLDTLSLYQ-GLLSNFPDIIHLQK----GAF
Q8I4E1_CAEEL/334-564-ETVASRRLT----------EALAYTASEYHEI-GQVFDAHTKND-MEPVLENLYSYK-GTVQNVPDIIQVHK----QAV
SNX9_MOUSE/358-593-GYQGETDLN----------DAITEAGKTYEEI-ASLVAEQPKKD-LHFLMECNHEYK-GFLGCFPDIIGAHK----GAI
Q5SPP1_DANRE/370-606-GYEGEGTLT----------DAMTAAGKTYEEI-AQMVAEQPKKD-LHFLMETNNEYK-GLLGCFPDTIGVHK----AAI
Q5XGZ5_XENLA/348-585-HMAFSAGLN----------RAMAFTGEAYEAI-GEMFAEQPRQD-LDPIMDLLAVYQ-GHLANFPDIIHVQR----GSL
Q58EN7_DANRE/321-556-GYPRESTLT----------EALTATGKTYEEI-AEVIAAQPRKD-LHFLLETNNEYK-GLLGCFPDTIGVHK----AAI
Q5DTD0_DANRE/328-561-QQVFSSPLN----------KAMANTGEVYETI-GDYFAEQPRQD-LEPISDLLAIYQ-GHLANFPDIIHVQK----GAL
Q4S383_TETNG/309-534-QQAYSAGLN----------RAIAGTGDAYEAI-GDYFAEQPRQD-LDPISDLLDFYR-GHLANFPDIIHVQK----GAL

PF04136

COG3_HUMAN/126-282-AEN----IQ----------QKLSYFNELETIN-TKLNSPTLSVN.SDGFIPMLAKLD-DCITYISS-------------
COG3_SCHPO/100-257-ADG----IR----------KGLTIFAPLKELT-RVFRHPPPDFAGKVSFKEHITQLN-TCIMFLEE-------------
COG3_DROME/110-269-SHE----IQ----------RRLHYFSQVELLN-QRLQSPTLSVA.SEAFRECLNKID-ECLNYIEE-------------

PF13805

C5GWX7_AJEDR/1-271-.........----------.CDDDVSDVTDKL-GVLIYEMGELE--DQFVDRYDQYR-VTMKSIRNIEASVQ----PSR
SLBR2_SCHPO/2-270-.........----------.CDDDISDVTDKL-GVLFYEMAELE--NYLIDRYDQYR-MTLKSIRNIESSVQ----PSR
A6ZV68_YEAS7/1-270-.........----------.NDDDVSDITDKL-GVLIYEVSELD--DQFIDRYDQYR-LTLKSIRDIEGSVQ----PSR
Q6CC94_YARLI/1-271-.........----------.ADEDVSDVTDKL-GVLIYEIGELE--DQFIDKYDQYR-ITLKSVRNIEASVQ----PSR
C4YEG9_CANAW/1-270-.........----------.NEDDISDVTDKL-GVLIYEIGELE--DQYIDKYDQYR-ITLKSIRDIEGSVQ----PSR
C5DXD8_ZYGRC/1-270-.........----------.NDDDVSDVTDKL-GVLIFELGELQ--DQFIDKYDQYR-VTLKSIRNIEASVQ----PTR
Q2HFB9_CHAGB/2-286-AGGSGGGGS----------GNDAAVSDVSDKI-GVLLSELGEQE--EAYAARLDESR-AVLKVVRNTEKSVQ----PSR

PF10455

MUG64_SCHPO/18-286...GAGNPLS----------SAFGQISVLEEKV-GNLQGERDSAI-SKNFCEQVRAVLYPRFAEAHRVKADVQ----DKR
A3GFN0_PICST/37-331.KTSA.APLS----------LALLQVSSSYLEI-ANARLVQDEKI-LAEVNDKLVAILNEQFIKVNELRKKVY----STR
A5DTV0_LODEL/37-351AKSEELNPLS----------FVLLQISSTYHEI-AAARLVQDDKI-IKGLNNQLVEILNQQFIKVNELRKKVY----LTR
A7TPP1_VANPO/27-288.HDTDDKRIA----------NLLTNVGNAEASI-AEARLLQDHSI-QAKFNFQLREEIAQSIERASKYRKEVY----HKR
GVP36_YEAST/27-299.FPTEEQPLA----------SALLQFSDVQAKI-AQARIQQDTLI-QTKFNKNLRERLSFEIGKADKCRKDVH----SMR
YP148_YEAST/45-432EDDEDLSNLI----------KVFDSWSTCYKNI-DEGKAEMDSMM-VKEFNKKLETLINQDFKKVHDLRKKVE----ESR
Q59WJ7_CANAL/37-331.KSSE.HPLS----------FALLQVSSTYQEI-AVARLDQDKKI-MSGLNAELIRTLNESFIKVNELRKKVY----ATR
Q6CPI5_KLULA/40-383DEDEDVDNLI----------KAFESWTKCQLSI-DQSKAEMDSLM-VKEFNAKLSKLIETDFKKGHELRAKVQ----DAR
Q6FKU8_CANGA/30-382DEKEDIDELV----------KIFKIWSDCFYEI-SDSKTEMDQMM-IKEFNVKLEDYLQKNFQKIHTLRAKVE----ESR
Q753K3_ASHGO/49-359EIDEDVESLI----------KMFGTWADAQYNM-DIAKREMDQFM-VKEFNEKLKHLLEVEFKKGHTLRRKVE----ESR

PF03114

ARH37_MOUSE/243-445-SLDIP..GG..........PAEQYCSLARDLQ.LHAFLQFKQRL-RSLVWQPLCSLA.RALAGPQNLIKKRL----DKL
RHG17_RAT/1-239-.EESL..LG..........KMLETCGDAENQL.AFELSQHEVFV-EKEIMDPLYGIAEVEIPNIQKQRKQLA----RLV
RHG44_HUMAN/1-242-GDDTL..LG..........KMLKLCGETEDKL.AQELIHFELQV-ERDVIEPLFLLAEVEIPNIQKQRKHLA----KLV
SH3G3_MOUSE/6-242-GEDSA..FG..........NSLVDVGEALKLM.AEVKDSLDINV-KQTFIDPLQLLQDKDLKEIGHHLRKLE----GRR
Q8X0D7_NEUCS/18-242-GAKDG..............VSKSYKQAVEDLD.AETIKALDGPY-RTTVLDPITRFC.AYFPDVNECIKKRG----HKL
Q8WQ54_GEOCY/24-244-WDGCE..................KQRELMEQR.ILLWEDLLTSL-TSRTVEPMTNYI.SRFSDVKTRIQKRE----RKM
Q8NJ03_NEUCS/6-247-SGRMSDPDSLVPHGNYEGIAACEEYEAVVKDL.QETLAPELEMI-EARVIRPANELL.DVIKVIRKTAVKRE----HKK
SH3G3_DROME/6-241-GEDNS.VFA..........QALVEFGEALKQM.ADVKYSLDDNI-KQNFLEPLHHMQTKDLKEVMHHRKKLQ----GRR
Q95K31_MACFA/140-339-DDEMG...................YSETLSNA.LNSCHDFASHL-QRLILTPLSALL.SLFPGPHKLIQKRY----DKL
Q8X0D6_NEUCS/3-231-ASDSE..FG..........SCLISMGRANERI.GQFQETFVGEA-TTTWLESLERSL.AMMKEYQAARKKLE----SRR
Q20005_CAEEL/8-266-GETTP..YG..........SALLKVAQTENRL.GQAERELCGQA-ATNTLLPIRRFLEGDMKTIQKERKVLN----SKR
HOB1_SCHPO/6-247-SGRASDPESYEQEGNAEGIEAAEAYKEIVYDL.QKNLASEMDVI-NTRIVNPTGELL.KIVKDVDKLLLKRD----HKQ
O61843_CAEEL/6-240-GDNSD..LG..........KSLNDAAETYRQM.ADIKYQMEDNV-KQNFLDPLTHLQNNELKDVNHHRTKLK----GRR
Q7ZWA0_DANRE/6-242-GEDTN..FG..........GALVEMGEAMKRL.AEVKDSLDIDV-KQNFIDPFQTIVDKDLKDIQHHLKKLE----GRR
Q8SYD9_DROME/13-268-GQDLP..YG..........QALIKVGQAEQKL.GQCEHDFIATS-GICFTQPLRKFLDGEMKTIGKERGILE----TKR
Q8IZ09_HUMAN/6-242-GDDCN..FG..........PALGEVGEAMREL.SEVKDSLDIEV-KQNFIDPLQNLHDKDLREIQHHLKKLE----GRR
AMPH_RAT/13-233-WYGRE..................DVKMVGEKC.DVLWEDFHQKL-VDGSLLTLDTYL.GQFPDIKNRIAKRS----RKL
RV167_YEAST/6-247-SGKMSDPNATIPEDNPQGIEASEQYRAIVAEL.QETLKPDLALV-EEKIVTPCQELL.KIITYIRKMATKRN----HKK
Q9XW43_CAEEL/24-258-FNGPQ...S..........KILDAYSIACGKI.GQKERQLQKRT-RSHCIKKMRMYTADESVELNNHVAHLK----DLL
Q94211_CAEEL/24-258-FDGQH...S..........KMLEKYSSACGRI.AQKEIQVQKRT-RSHLIKKMRLYTGEESEILNSNVENLN----NLL
Q803I3_DANRE/25-245-WHGVE..................DLTVIMESE.DLLWNDYEEKL-NDQVVRTMENYT.AQFQDVKERVAKRG----RKL
Q21004_CAEEL/9-230-WPDRE..................HLTAIFDNL.DIQTNELEKTV-CDDLPQTVTQYV.NQFPDLKKKIEKRG----RKL
YNQA_SCHPO/1-230-SHSSS..NS..........HTYIMYGKSMVEI.GHLQEEFMDYL-NNSFLANLENSL.AEFKALDVKEKKME----NRR
DNMBP_HUMAN/997-1207-GHRDL.................EQFERVHRYISDQLFTNFKERT-ERLVISPLNQLL.SMFTGPHKLVQKRF----DKL
SHLB1_HUMAN/11-254-GPGTA..YG..........NALIKCGETQKRI.GTADRELIQTS-ALNFLTPLRNFIEGDYKTIAKERKLLQ----NKR
Q7ZVM8_DANRE/6-242-GAESG..FG..........FALLEMGEALKQV.AQARDCMDVRV-KRAFIDPLQSLQQKELKEIGFHLRKLE----GRR
RV161_YEAST/6-232-KYVAGGGYN..........VGNYYLQCVQDFD.SETVKQLDGPL-RETVLDPITKFS.TYFKEIEEAIKKRD----HKK
Q9DDR3_LAMFL/6-242-GTESC..FG..........LALADVGESMKQM.AEIKDSLDIDV-KQNFLDPMQALQDKELKEIGHHLKKLE----GRR

PF06456

ICA69_MOUSE/21-248-KTRA.G-------------KMMQATGKALCFS-SQQRLALRNPL-CR-FHQEVETFRHRAISDTWLTVNRME----QYR
PICK1_MOUSE/117-352-PQPAAS-------------EAFVKFADAHRSI-EKFGIRLLKTI-KP-MLTDLNTYLNKAIPDTRLTIKKYL----DVK
RIC19_CAEEL/27-255-KTEAVG-------------RILIAVGRSLLFS-SHRLNAARIGV-ST-FYNKLSVFVERAIGDCSQTIEAVQ----MCR
YL87_CAEEL/59-286-KEEQIK-------------AQCTMTSETMRGV-GEQAASLDACL-RY-FISSMETVYNQTITDTLHTIYNTE----SAR
O18246_CAEEL/113-348-KQQTAN-------------EAFSSFGDKHRMI-AKKQSESAVPL-QK-MVSDLQVYIDHVVPDTRLTIKKYL----DVK
ARFP2_HUMAN/89-316-KSPELQ-------------EEFGYNAETQKLL-CKNGETLLGAV-NF-FVSSINTLVTKTMEDTLMTVKQYE----AAR
ARFP1_HUMAN/121-348-KSLELH-------------EEFGYNADTQKLL-AKNGETLLGAI-NF-FIASVNTLVNKTIEDTLMTVKQYE----SAR
ICA1L_MOUSE/15-242-STQA.G-------------EMMDAAGKALCSS-AKQRLALCTPL-SR-LKQEVATFSQRAISDTLVTINRME----RAR
Q8SY07_DROME/119-354-PQQRAS-------------EAFRTFGEFHRTL-EKDGLGIIKQI-KP-VLADLGTYLNKAIPDTKLTVRRYA----DAK
Q9VGQ8_DROME/106-331-KNPELQ-------------KEFTCNSETQRNL-TKNGELLLNAL-NF-FISSVNTLCNKTIDDTLLTIRQYE----TAR
Q9VP78_DROME/2-228-RSRTTG-------------GSIAHTAKAVSFA-GQQRMCVRVPL-LR-LQHEVDVFRCRAIKDTEQTLQTME----KER

PF08397

Q568N5_DANRE/16-235--------------------VVLMEISDVHRKV-NVELEENFRRF-HREVIAELERKTDMDVKYMTATFKRYQTEHKMKQ
BAIP2_HUMAN/17-237--------------------DVLFQMAEVHRQI-QNQLEEMLKSF-HNELLTQLEQKVELDSRYLSAALKKYQTEQRSKG
Q6P7G7_XENLA/16-236--------------------HVLLEISIVHKRL-NDNLEENFKKF-HREIVAELERKTDQDIKYMNATLKRYQTEHKNKV
MTSS1_HUMAN/16-237--------------------SALTRMCMRHRSI-EAKLRQFSSAL-IDCLINPLQEQMEEWKKVANQLDKDHAKEYKKAR
MTSSL_HUMAN/15-239--------------------SALTRMCMRHRSI-ETKLRQFTNAL-LESLINPLQERIEDWKKAANQLDKDHAKEYKRAR
BI2L2_HUMAN/16-226--------------------EILVQMSDTQRHL-NSDLEVVVQTF-HGGLLQHMEKNTKLDMQFIKDSRQHYELEYRHRA
Q6NV36_DANRE/16-235--------------------VVLMEISEVHKNA-QLEMEESFKRF-HKELIAELEKKTDMDTKYMTATFKRYQSEHKLKQ
Q6AX92_XENLA/16-237--------------------SALTRMCMRHRNI-ESRLKHLTVAL-TDNLINPLEGKMEEWKKVANQLDKDHAKEYKKAR

PF06730

F92A1_HUMAN/1-219----DLKATLTA-----------------------------------RNREAKQ-----------------------LTQ
F92A1_MOUSE/70-288----DLKATLTA-----------------------------------RNREAKQ-----------------------LSQ
Q9VK91_DROME/1-222----NLRLAVIA-----------------------------------RDKEVLR-----------------------QRQ

PF09325

Q6BQ29_DEBHA/424-659QQYYNFNQDYIK-----------------------------------KQAQLNK-----------------------LNK
Q9C2E4_NEUCS/307-541YSWHSAESELQK-----------------------------------RKASQDK-----------------------LLR
Q7PVK3_ANOGA/210-443QNWQHAQMQLTK-----------------------------------KRENKAK-----------------------LEL
Q4R6S4_MACFA/236-469QRWQDAQATLQK-----------------------------------KREAEAR-----------------------LLW
Q5BN90_ACECL/162-395TQVSQAKADMEA-----------------------------------KNAKVAR-----------------------CKG
Q5DFB1_SCHJA/196-436RTWRTAESNLRS-----------------------------------KREQKIR-----------------------MEM
VPS5_YEAST/439-673YFLVVIENDMNK-----------------------------------KHSQLGK-----------------------LGQ
SNX2_HUMAN/281-514QKWEDAQITLLK-----------------------------------KREAEAK-----------------------MMV
Q86IF6_DICDI/292-523MSMQNNERNVAA-----------------------------------KKEKAAK-----------------------TTG
Q5A1F2_CANAL/431-666QQYHNSNQELSK-----------------------------------KQAQLDK-----------------------YTR
Q5B786_EMENI/288-522HSWHAAESELQK-----------------------------------RKHSQEK-----------------------LLR
A8WVN0_CAEBR/231-466QQWQDAQQTLSR-----------------------------------KRDQKTK-----------------------IDL
Q5KI36_CRYNJ/639-879KVWQEKDKEVAR-----------------------------------MKTAREK-----------------------ARI
VPS5_SCHPO/340-576QTWQSSVQAVSR-----------------------------------AKTQLEK-----------------------CKK
Q6CJR1_KLULA/428-663YYILLVENDLNK-----------------------------------KQTQFNK-----------------------VSG
Q675P9_OIKDI/236-470QNWQSSEQGLMK-----------------------------------KRDTVTR-----------------------LQA
Q6CGR9_YARLI/393-628QVIQNIESELTK-----------------------------------RKANLDK-----------------------LLR
Q759R2_ASHGO/362-598YYLVIVESDLHK-----------------------------------KQAHLQK-----------------------LTT
Q4P3M6_USTMA/831-1062AKSARCADELRR-----------------------------------TRARFEK-----------------------YKQ
Q8MS29_DROME/220-453QNWQYAQMQLSK-----------------------------------RRENRGR-----------------------FEL
Q6FKM2_CANGA/398-636YYLVIVENDFQK-----------------------------------KKQDVEK-----------------------MCH
Q4V8Z4_DANRE/286-519QRLQEAQITLQK-----------------------------------KREAEAK-----------------------LLW

PF10456

SNX33_MOUSE/337-572AKVKESQRMSDE-----------------------------------GRMA-----------------------------
Q8I4E1_CAEEL/334-564QKFRDS.....E-----------------------------------GRLS-----------------------------
SNX9_MOUSE/358-593EKVKESDKLVAT-----------------------------------SKIT-----------------------------
Q5SPP1_DANRE/370-606EKVKEADKLVTA-----------------------------------GKIT-----------------------------
Q5XGZ5_XENLA/348-585TKVRESKKQVEE-----------------------------------GKLE-----------------------------
Q58EN7_DANRE/321-556DKVKEADHLVMT-----------------------------------NKIS-----------------------------
Q5DTD0_DANRE/328-561TKAKESQKHGEE-----------------------------------K..D-----------------------------
Q4S383_TETNG/309-534TKVKDC......-----------------------------------....-----------------------------

PF04136

COG3_HUMAN/126-282--------------------------------------------------------------------------------
COG3_SCHPO/100-257--------------------------------------------------------------------------------
COG3_DROME/110-269--------------------------------------------------------------------------------

PF13805

C5GWX7_AJEDR/1-271DRKQKITDQIAH-----------------------------------LKYKEPN--------------------------
SLBR2_SCHPO/2-270EKKQKLLDQIYA-----------------------------------LKHKDPE--------------------------
A6ZV68_YEAS7/1-270DRKDKITDKIAY-----------------------------------LKYKDPQ--------------------------
Q6CC94_YARLI/1-271DRKQKITDQIAH-----------------------------------LKYKEPN--------------------------
C4YEG9_CANAW/1-270DRKQKITDEIAH-----------------------------------LKYKDPQ--------------------------
C5DXD8_ZYGRC/1-270NRKEKITDEIAH-----------------------------------LKYKDPH--------------------------
Q2HFB9_CHAGB/2-286DGKRKVAEEIQR-----------------------------------LKIKEPQ--------------------------

PF10455

MUG64_SCHPO/18-286LQLEMAKLDVES...................................AKPENLE..........................
A3GFN0_PICST/37-331SEFDLIRSKVDE...................................TDQENEE..........................
A5DTV0_LODEL/37-351SQFDQLRSKHEA...................................TDPENEE..........................
A7TPP1_VANPO/27-288LKYDIAREKY.....................................SKHEKNG..........................
GVP36_YEAST/27-299LRYDVARTNLANN..................................KKPEKEA..........................
YP148_YEAST/45-432LKFDTMRYEVKAKEAELEAKKAEATGEAHSKDVSAKDISANTTTSFDETPSTEDEKPKSEGAEEESKKEANEPTVDDVAD
Q59WJ7_CANAL/37-331GEFDLLRSKYEK...................................SDPENEE..........................
Q6CPI5_KLULA/40-383LNFDTLRHEIKLKLQEKEVVAS...............SEEAEKKVATETPETPEKKTNEEPV..................
Q6FKU8_CANGA/30-382LNFDTMRYEVAQTSKQTDSKELGN............EDETKPSSMDANKTNTEEKEAANDKVETKEKTETNATIA..DET
Q753K3_ASHGO/49-359LTFDTLKYEQHERDAALAKKQ..................DEAKQAEGATPSTGVTQSS......................

PF03114

ARH37_MOUSE/243-445LDFDRVEEKLLD-----------------------------------VGS..V.--------------------------
RHG17_RAT/1-239LDWDSVRARWNQ-----------------------------------AH..KSS--------------------------
RHG44_HUMAN/1-242LDMDSSRTRWQ.-----------------------------------.QTSKSS--------------------------
SH3G3_MOUSE/6-242LDYDYKKRRVGK-----------------------------------IP.....--------------------------
Q8X0D7_NEUCS/18-242LDYDALRAKVKK-----------------------------------LV...EK--------------------------
Q8WQ54_GEOCY/24-244VDYDLRRRELEH-----------------------------------AK...SK--------------------------
Q8NJ03_NEUCS/6-247LDYDRHRATLKK-----------------------------------LQDKKDR--------------------------
SH3G3_DROME/6-241LDFDCKRRRQAK-----------------------------------.......--------------------------
Q95K31_MACFA/140-339LDCNSYLQRSA.-----------------------------------.......--------------------------
Q8X0D6_NEUCS/3-231LAYDATATKIQK-----------------------------------ARRDDFR--------------------------
Q20005_CAEEL/8-266LDLDACKSRLKK-----------------------------------AKTVDLQ--------------------------
HOB1_SCHPO/6-247LDYDRHRSSFKK-----------------------------------LQEKKDK--------------------------
O61843_CAEEL/6-240LDYDCKKRQQRR-----------------------------------.......--------------------------
Q7ZWA0_DANRE/6-242LDYDYKKKRQGK-----------------------------------IA.....--------------------------
Q8SYD9_DROME/13-268LDLDACKNRVKK-----------------------------------ARSMLGQ--------------------------
Q8IZ09_HUMAN/6-242LDFDYKKERQGK-----------------------------------IP.....--------------------------
AMPH_RAT/13-233VDYDSARHHLEA-----------------------------------LQ...SS--------------------------
RV167_YEAST/6-247LDLDRHLNTYNK-----------------------------------HEKKKEP--------------------------
Q9XW43_CAEEL/24-258IAIDDSRHQLKS-----------------------------------SRTTKEV--------------------------
Q94211_CAEEL/24-258HAIDDSRHHVKS-----------------------------------SKTTKEV--------------------------
Q803I3_DANRE/25-245VDYDSTRHHLEA-----------------------------------LQ...SA--------------------------
Q21004_CAEEL/9-230VDYDSAKNSFNS-----------------------------------VKA..SS--------------------------
YNQA_SCHPO/1-230LVFDALSTKIQK-----------------------------------AKKEESK--------------------------
DNMBP_HUMAN/997-1207LDFYNCTERAEK-----------------------------------LKDKKT.--------------------------
SHLB1_HUMAN/11-254LDLDAAKTRLKK-----------------------------------AKAAETR--------------------------
Q7ZVM8_DANRE/6-242LDFDYKKRRKGK-----------------------------------IA.....--------------------------
RV161_YEAST/6-232QDFDAAKAKVRR-----------------------------------LV...DK--------------------------
Q9DDR3_LAMFL/6-242LDFDYKKKRLGK-----------------------------------IP.....--------------------------

PF06456

ICA69_MOUSE/21-248TEYRGALLWMKD-----------------------------------VSQELDP--------------------------
PICK1_MOUSE/117-352FEYLSYCLKVKE-----------------------------------MDDEEYS--------------------------
RIC19_CAEEL/27-255TEYRGSLLWMKK-----------------------------------TSEELDP--------------------------
YL87_CAEEL/59-286IEYDVDRNDISA-----------------------------------AT..NPP--------------------------
O18246_CAEEL/113-348YEYLSYCLKLKE-----------------------------------MDDEEVE--------------------------
ARFP2_HUMAN/89-316LEYDAYRTDLEE-----------------------------------LS..LGP--------------------------
ARFP1_HUMAN/121-348IEYDAYRTDLEE-----------------------------------LN..LGP--------------------------
ICA1L_MOUSE/15-242TEYRGALLWMKD-----------------------------------ASQELDP--------------------------
Q8SY07_DROME/119-354FTYLSYCLKVKE-----------------------------------MDDEEHG--------------------------
Q9VGQ8_DROME/106-331IEFDAYRMDLEN-----------------------------------TKPELTP--------------------------
Q9VP78_DROME/2-228TEYRAALSWMKS-----------------------------------ASQELDP--------------------------

PF08397

Q568N5_DANRE/16-235DSLERSQSDLKK-----------------------------------VRRKSQ.--------------------------
BAIP2_HUMAN/17-237DALDKCQAELKK-----------------------------------LRKKSQG--------------------------
Q6P7G7_XENLA/16-236DSLEKSQSDLKK-----------------------------------LKRKSQG--------------------------
MTSS1_HUMAN/16-237QEIKKKSSDTLK-----------------------------------LQKKAKK--------------------------
MTSSL_HUMAN/15-239HEIKKKSSDTLK-----------------------------------LQKKARK--------------------------
BI2L2_HUMAN/16-226ANLEKCMSELWR-----------------------------------MERKRDK--------------------------
Q6NV36_DANRE/16-235DFLDKSQADLKK-----------------------------------LRRKSQ.--------------------------
Q6AX92_XENLA/16-237ADIKKKSSDTIK-----------------------------------LQKKVKK--------------------------

PF06730

F92A1_HUMAN/1-219LERTR---QRNPSDRHVISQAETEL---------QRAAMDASRTSR-HLEETIN-NFERQK--------MKDIKTIFSEF
F92A1_MOUSE/70-288LERTR---QRNPSDRHVISQAETEL---------QRATIDATRTSR-HLEETID-NFEKQK--------IKDIKNILSEF
Q9VK91_DROME/1-222MLELK---SKFSANN...SAADSEL---------FKAKMEVQRTNK-EIDDIIG-NFEQRK--------LRDLKQIISDF

PF09325

Q6BQ29_DEBHA/424-659KFKVQ..NDKAGNLNFEVDKLRAKV---------QTFEKKFNLISE-TIKSELE.RFEFEK--------IDDFRNSVEIF
Q9C2E4_NEUCS/307-541QGKSQ..QDRLNQVNAEVADAERKV---------HQARLLFEDMGR-LMRAELD.RFEREK--------VEDFKSGVETF
Q7PVK3_ANOGA/210-443Q..DR..RDKLEFAQKEVEEWEGKV---------QRCQKEFDNISS-EIKKEME.RFELAR--------ARDFKSTIIKY
Q4R6S4_MACFA/236-469A..NK..PDKLQQAKDEILEWESRV---------TQYERDFERIST-VVRKEVM.RFEKEK--------SKDFKNHVIKY
Q5BN90_ACECL/162-395TPGIR..DEKIIDAQRELDEATKKH---------EEAKQKYIDITS-KMSSELA.RFQQER--------SVEMASVLKSF
Q5DFB1_SCHJA/196-436SGRSD..HKKMAMITMELEDLENRV---------DQAQHKFNNISE-NTKREFQ.NFDFNR--------FAYFKQATTEY
VPS5_YEAST/439-673NIHSE....KFREMRKEFQTLERRY---------NLTKKQWQAVGD-KIKDEFQ.GFSTDK--------IREFRNGMEIS
SNX2_HUMAN/281-514A..NK..PDKIQQAKNEIREWEAKV---------QQGERDFEQISK-TIRKEVG.RFEKER--------VKDFKTVIIKY
Q86IF6_DICDI/292-523A........KAANMQKEVDDAVRKL---------TEATTEYEKISA-SARLELT.KFDEKR--------AYEMKRILNYV
Q5A1F2_CANAL/431-666K.QQQ..PDKINQLNFEVDKLKQRT---------ESFEKSFKEISE-TIKQELE.NFEYER--------IDDFRNSVEIF
Q5B786_EMENI/288-522QGKSQ..QDRLNQANADVADAERRV---------HQARLLFEDMGR-LMRNELQ.RFEKEK--------VEDFKSGVETF
A8WVN0_CAEBR/231-466AAGGR..NEKSDQLKAEIEETVLRI---------DQLEQHFGELSK-AIREEVA.RFDTDR--------KTDMKKILIDY
Q5KI36_CRYNJ/639-879SGKLG...DRVQSSLKEIMEAERRV---------HEASLEFDRLTK-LVKSEFV.RFERER--------VLEFKETLERY
VPS5_SCHPO/340-576QAKSQ..QKSLPYLEEQYEKYRAKA---------ADLEKEFSESTT-LLKRDLS.SLTTSR--------VDDLKASVETW
Q6CJR1_KLULA/428-663NSANS...EKATSIENELRILTSRC---------NKIKQEWQTIAE-VIRKDVN.QHDVDT--------IEDFRNNMEIY
Q675P9_OIKDI/236-470T..GR..TEKIPGAELEIKEWETKA---------ATSKKGFEDMTA-VAKKEIN.TWETQR--------VAETKMFILKW
Q6CGR9_YARLI/393-628QGKTQ..QQRLNVLKDQVQEYEKKL---------VNAKVKFDDVSS-TIKKEVDVRFENEK--------FDDFRNAIEIF
Q759R2_ASHGO/362-598SGKSP..TDKAAAAKQELANLQRRH---------KTIKDHWEHIAE-TLRDELA.AYSEAK--------ITDFRNNLEIY
Q4P3M6_USTMA/831-1062TNPSA.AGAQFQSLLSELTEAETKA---------LNAERLFQTVSE-RCKDEME.RLDLER--------VLDFKRVVGAW
Q8MS29_DROME/220-453A..NR..ADKLDQAQQEVDEWQGKV---------QRCQQQFDDISA-EIKREME.RFELTR--------VKDFKVNIIKY
Q6FKM2_CANGA/398-636NNKQPANKERFLAARDSVKNIERRA---------ITVKKAWHDIGE-KIKKEVS.SFDRSK--------MEEFRNCMEIT
Q4V8Z4_DANRE/286-519A..NK..PEKLQQAKDDINEWESKV---------SQYERDFERVTC-TVRKEVL.RFEKEK--------ARDFKQHIVKY

PF10456

SNX33_MOUSE/337-572---------------------QEEA---------DGIRRRCRVVGF-ALQAEMN-HFHQRR--------ELDFKHMMQSY
Q8I4E1_CAEEL/334-564---------------------SAEA---------EKMKQRIDAMSY-TVIAEVQ-HQTAEK--------VEDMKSTMGTY
SNX9_MOUSE/358-593---------------------PQDK---------QTMVKRVGTMSY-ALQAEMN-HFHSNR--------IYDYNSVIRLY
Q5SPP1_DANRE/370-606---------------------ASDK---------TTMGKRASTMSY-ALQAEMN-HFHNNR--------IYDYNRVMQQY
Q5XGZ5_XENLA/348-585---------------------LQKA---------SEIQERCNVISY-ATLAEIH-HFHKIR--------VRDFKSQMQHF
Q58EN7_DANRE/321-556---------------------QQDK---------HTMEKNLSTMSY-ALQAEMN-HFHSNR--------IYDYNRLMQFY
Q5DTD0_DANRE/328-561---------------------GTAG---------GGINDRCNIISC-ATLAEIQ-HFHCIR--------VRDFKAQMQYF
Q4S383_TETNG/309-534---------------------PKQE---------SELHDRCNIISC-ATLAEIQ-HFHRTR--------IRDFRSQMQHH

PF04136

COG3_HUMAN/126-282---------------------HPNF---------KDYPIYLLKFKQ-CLSKALH-LMKTYT--------VNTLQTLTSQL
COG3_SCHPO/100-257---------------------NLDF---------QESPHYLGQYKK-LLSQAMD-IFKPYF--------IRIIKQTTDQV
COG3_DROME/110-269---------------------NPKF---------KDAAAYNVKYRQ-CLAKASG-LVRNYV--------TSVINQATEAT

PF13805

C5GWX7_AJEDR/1-271-------SPRIVVLEQELVRAEAES---------LVAEAQLSNITREKVKAAFAYQFDALREHCEKLAIIAGYGKHLLEL
SLBR2_SCHPO/2-270-------SPRLVTMEQELVREEAAC---------LVAEAQLSNTTREKFKQAMTFNLDALHEHAEKLNLIATYGRHLLNL
A6ZV68_YEAS7/1-270-------SPKIEVLEQELVRAEAES---------LVAEAQLSNITRSKLRAAFNYQFDSIIEHSEKIALIAGYGKALLEL
Q6CC94_YARLI/1-271-------SPKIIVLEQELVRAEAES---------LVAEAQLSNITREKVKAAFNYQFDAIREHSEKLALIAGYGKALLEL
C4YEG9_CANAW/1-270-------SPKIPVLEQELVRAEAES---------LVAEAQLSNITREQLKAAFNYQFDATRELAEKYALIAGYGKALLEL
C5DXD8_ZYGRC/1-270-------SPKIPVLEQELVRAEAES---------LVAEAQLSNITRERMKAAYNYQFDSMRELAEKFALIAGYGKALLEL
Q2HFB9_CHAGB/2-286-------SARLVTLEQELVRAEAEN---------LVAEAQLGNVTRQKLKEAYTVDFLATIERAEKQAILARHGLRLLQL

PF10455

MUG64_SCHPO/18-286...................HCKSAV---------RSAEDELNGAIE-HAKILYE-QI--LN--------KDYNTDLLRSI
A3GFN0_PICST/37-331........................L---------ISKEDELVSATE-VAVVEMK-RL--LK--------PSKNISLLKVF
A5DTV0_LODEL/37-351........................L---------IAKEDELVSATE-LAVIEMK-KI--LK--------PSKNINLLKIM
A7TPP1_VANPO/27-288...................TVKVEL---------EILEDEFNHATK-DAIMVMQ-EI--IS--------NNRFEQNLKDF
GVP36_YEAST/27-299...................SLRVQM---------ETLEDQFAQVTE-DATVCLQ-EV--IS--------HANFSEDLKEL
YP148_YEAST/45-432RKEDLKSNKVNDEPPIEESEDNKLL---------EKLEDEFVSNTT-AAVETME-EI--TD--------SSEILGLIKLF
Q59WJ7_CANAL/37-331........................L---------IAKEDGFVSATE-VAVVEMK-KL--LK--------PSKNIDLLKVL
Q6CPI5_KLULA/40-383...........DMAKTEEDPDSKLF---------ERLEDQFVSATS-ETVEFLG-EL--TD--------SSEIISLVKLF
Q6FKU8_CANGA/30-382KETKDTKDSEDLKEDSKTSTDGQLL---------EQLEDEFVSNTT-EAVEVMT-EV--SE--------NSELLSLIKLF
Q753K3_ASHGO/49-359...............TADLAFYAQL---------EDAEDEFVSNTA-EAVEFMT-SI--AD--------ATKLISLVKLF

PF03114

ARH37_MOUSE/243-445-----................TWEE---------EAARHEYQALNS-LLVAELP-QFNQLV--------MQWLGQILCTF
RHG17_RAT/1-239-----GTNFQGLP..SKIDTLKEEM---------DEAGNKVEQCKD-QLAADMY-NFMAKE--------GEYG.KFFVTL
RHG44_HUMAN/1-242-----GLSSSLQPAGAKADALREEM---------EEAANRVEICRD-QLSADMY-SFVAKE--------IDYA.NYFQTL
SH3G3_MOUSE/6-242-----................EEEI---------RQAVEKFEESKE-LAERSMF-NFLEND--------VEQV.SQLAVF
Q8X0D7_NEUCS/18-242-----PDKDVTK.....LPRAEKEM---------EMAKAAYEQLNE-QLCTELP-QLIDLR--------VPYLDPSFEAL
Q8WQ54_GEOCY/24-244-----AKVNDQK.....VQQAEDTH---------TQAKQLYDEITD-ELYEELP-TLYDSR--------IQFYGQIFQSI
Q8NJ03_NEUCS/6-247-----SAKDEKA.....MWKAENEV---------EQATQEYNYFND-LLKDELP-KLFALE--------RQFIQPLFQSF
SH3G3_DROME/6-241-----................DDEI---------RGAEDKFGESLQ-LAQVGMF-NLLEND--------TEHV.SQLVTF
Q95K31_MACFA/140-339-----................GEES---------DLAKKEYEALNA-QLVEELQ-AFNQAA--------RKILLNCLCSF
Q8X0D6_NEUCS/3-231-----I...............EEEL---------RGAKAKYEEASE-DVGRRMQ-DIRDSE--------VDSV.RDLTQF
Q20005_CAEEL/8-266-----TVTNSKTSGGFTIEQAEADV---------RVAQAEFDKQSE-ITKLLLE-GIQTAH--------NNQL.KCLRDF
HOB1_SCHPO/6-247-----SLKDEKK.....LYEAETAF---------EQSSQEYEYYNE-MLKEELP-KLFALA--------QSFIAPLFQGF
O61843_CAEEL/6-240-----................DDEM---------IQAEEKLEESKR-LAEMSMF-NVLSND--------VEQI.SQLRAL
Q7ZWA0_DANRE/6-242-----................DEEL---------RMAMEKFEESRD-AAETSMQ-NLLDTD--------VEQV.SQLCAL
Q8SYD9_DROME/13-268-----QSKDGISPE.AVLEQAERDL---------RVAQAEFDRQAE-ITKLLLD-GISTSQ--------ASHL.RHLHAF
Q8IZ09_HUMAN/6-242-----................DEEL---------RQALEKFDESKE-IAESSMF-NLLEMD--------IEQV.SQLSAL
AMPH_RAT/13-233-----KRKDESR.....ISKAEEEF---------QKAQKVFEEFNV-DLQEELP-SLWSRR--------VGFYVNTFKNV
RV167_YEAST/6-247-----TAKDEER.....LYKAQAQV---------EVAQQEYDYYND-LLKTQLP-ILFSLE--------AEFVKPLFVSF
Q9XW43_CAEEL/24-258-----KAK.............GEIY---------RKNIQAFNCTAN-EVQARLD-EV.PMI--------VPHHENELLKF
Q94211_CAEEL/24-258-----KAK.............GETY---------RKAINAFNETAN-EVQALID-EV.AMV--------VPLHENEFLKF
Q803I3_DANRE/25-245-----KKRDDAK.....VNKAEEEF---------NKAQEVFEDINK-ELREELP-VLYQSR--------ISCYVTMFQNI
Q21004_CAEEL/9-230-----KKDNDPK.....LAKATMEL---------QAAEQMYTEMNN-ELLEILP-AVFDSR--------ITFFVDTLQTL
YNQA_SCHPO/1-230-----L...............EEDL---------RNARAKYEESLE-EFEDRMV-QLKELE--------PDRV.ENVVRL
DNMBP_HUMAN/997-1207-----................LEEL---------QSARNNYEALNA-QLLDELP-KFHQYA--------QGLFTNCVHGY
SHLB1_HUMAN/11-254-----NSS.............EQEL---------RITQSEFDRQAE-ITRLLLE-GISSTH--------AHHL.RCLNDF
Q7ZVM8_DANRE/6-242-----................DSEI---------KKAFDKFEESKE-MAERCMF-NLLEKD--------VQRL.QHLSGL
RV161_YEAST/6-232-----PAKDASK.....LPRAEKEL---------SLAKDIFENLNN-QLKTELP-QLVSLR--------VPYFDPSFEAL
Q9DDR3_LAMFL/6-242-----................DEEI---------RQAEEKFEESRE-VAASSMH-NLVESE--------IEQV.SQLAAL

PF06456

ICA69_MOUSE/21-248---------DLYKQMEKFRKVQTQV.........RLAKKNFDKLKM-DVCQKVD-LLGASR--------CNLLSHMLATY
PICK1_MOUSE/117-352---------CIGPRRALYRVSTGNYEYRLILRCRQEARARFSQMRK-DVLEKME-LLDQKH--------VQDIVFQLQRF
RIC19_CAEEL/27-255---------EVDGSMEKFREAQTTV.........KSNKERLDRLKT-DTLQKVD-LLSASR--------SNLLSYVLTHY
YL87_CAEEL/59-286---------QGQLTKNLPVGATEKC.........EEKKAKYEKLKN-DAKIKMR-LLEENR--------ISVVAAQLEKL
O18246_CAEEL/113-348---------FVAIQEPLYRVETGNYEYRVMLRCRQECRARFMKMRD-DVMVKIE-LLDQKH--------VRDIAQHLAIF
ARFP2_HUMAN/89-316---------RDAGTRGRLESAQATF.........QAHRDKYEKLRG-DVAIKLK-FLEENK--------IKVMHKQLLLF
ARFP1_HUMAN/121-348---------RDANTLPKIEQSQHLF.........QAHKEKYDKMRN-DVSVKLK-FLEENK--------VKVLHNQLVLF
ICA1L_MOUSE/15-242---------DTFKQMEKFRKVQNQV.........RNSKDSFDKLKK-DVCQKVD-LLGASR--------CNMLSHSLTTY
Q8SY07_DROME/119-354---------FAALQEPLYRVETGNYEYRLILRCRQDARSKFAKLRT-DVLEKME-LLECKH--------AMDLNKQLRSL
Q9VGQ8_DROME/106-331---------SAVA....LEETQRSY.........AQHKEQYEKLRS-DVAVKMQ-FLDENR--------IKVMHKQLILL
Q9VP78_DROME/2-228---------DTGKGLDKFRTAQAHV.........RVAKHNFDGYSM-DSIQKID-LLAAAR--------CNMYSHALVAY

PF08397

Q568N5_DANRE/16-235----...GRNASKYESKENECLETL---------THRQMDMQKFIA-DGCQEAL-LEEKRR--------FCFLVDKHCSF
BAIP2_HUMAN/17-237----...SKNPQKYSDKELQYIDAI---------SNKQGELENYVS-DGYKTAL-TEERRR--------FCFLVEKQCAV
Q6P7G7_XENLA/16-236----...GRNVTKYEIKESEYVETI---------TSRQSEINKFIA-QGCREAL-LEEKRR--------FCFLVDKHCTF
MTSS1_HUMAN/16-237----...GRGDIQPQLDSA..LQDV---------NDKYLLLEETEK-QAVRKAL-IEERGR--------FCTFISMLRPV
MTSSL_HUMAN/15-239----ELLGKGDLQPQLDSA..LQDV---------NDMYLLLEETEK-QAVRRAL-IEERGR--------FCTFITFLQPV
BI2L2_HUMAN/16-226----..........NVREM..KESV---------NRLHAQMQAFVS-ESQRAAE-LEEKRR--------YRFLAEKHLLL
Q6NV36_DANRE/16-235----...GKHSSKYEIKENECMETI---------SSRQTDMQRFIA-DGCKEAL-LEEKRR--------FCFLVDKHCAL
Q6AX92_XENLA/16-237----...GKDDARLQLDSA..LQDV---------NDKYVVLEETEK-KAVYKAL-VEERGR--------FCMFVSFLKPV

PF06730

F92A1_HUMAN/1-219ITIEMLFHGKALEVYTAAYQNIQNIDEDEDLE------------
F92A1_MOUSE/70-288ITIEMLFHGKALEVFTAAYQNIQNIDEDEDLE------------
Q9VK91_DROME/1-222ILIAMKQHTKALEILSASYYDIGTIDERDDFI------------

PF09325

Q6BQ29_DEBHA/424-659IESSIESQKEAIELWETFYER-----------------------
Q9C2E4_NEUCS/307-541LESAVEAQKELIEKWETFLMQ-----------------------
Q7PVK3_ANOGA/210-443LEDQMAHQQQQMRYWEAIVPV-----------------------
Q4R6S4_MACFA/236-469LETPLYSQQQLAKYWEAFLPE-----------------------
Q5BN90_ACECL/162-395AVNQARAAAESAKLWGNTSSA-----------------------
Q5DFB1_SCHJA/196-436LELLLQIQLKVLENWEKYLSH-----------------------
VPS5_YEAST/439-673LEAAIESQKECIELWETFYQT-----------------------
SNX2_HUMAN/281-514LESLVQTQQQLIKYWEAFLPE-----------------------
Q86IF6_DICDI/292-523IRLNLDHFLKSSDCWRELLTE-----------------------
Q5A1F2_CANAL/431-666IESAIESQKEAIELYETFYER-----------------------
Q5B786_EMENI/288-522LESAVEAQKELIELWETFLLQ-----------------------
A8WVN0_CAEBR/231-466MESMIHTHTEMLQLWEKFEPQ-----------------------
Q5KI36_CRYNJ/639-879LNGLIEKEKEMIEGWEGLHS.-----------------------
VPS5_SCHPO/340-576LESAIESQKEIIERWESFLDQ-----------------------
Q6CJR1_KLULA/428-663LESAIESQKECIEIWETFYQN-----------------------
Q675P9_OIKDI/236-470MKHMLEAEKKVVAMWEKYLPK-----------------------
Q6CGR9_YARLI/393-628LENAVETQKEAIEVWETFYSR-----------------------
Q759R2_ASHGO/362-598LESAIETQKECIELWETFYQN-----------------------
Q4P3M6_USTMA/831-1062LEGMIQRQEEVVEEWVRYAGL-----------------------
Q8MS29_DROME/220-453IEDQMAHQQQIVSYWEAFAPF-----------------------
Q6FKM2_CANGA/398-636LESAIESQKESIELWETMYHE-----------------------
Q4V8Z4_DANRE/286-519LESLLHTQHRLVKCWEAFLPE-----------------------

PF10456

SNX33_MOUSE/337-572LRQQILFYQRVGQQLEKTLHMYD---------------------
Q8I4E1_CAEEL/334-564LKKQAMFYQEVATKLTSLAARYD---------------------
SNX9_MOUSE/358-593LEQQVQFYETIAEKLRQALSRFP---------------------
Q5SPP1_DANRE/370-606LEQQVKFYEMIAEKLRQAHSQFT---------------------
Q5XGZ5_XENLA/348-585LQQQICFFQKVTLKLEEALQKYD---------------------
Q58EN7_DANRE/321-556LEEQVKFYETIAEKLKKALGQYT---------------------
Q5DTD0_DANRE/328-561LQQQISFFQKITGKLEEALDMYD---------------------
Q4S383_TETNG/309-534LRQQIDFFQKITTKLQETLQKYD---------------------

PF04136

COG3_HUMAN/126-282LKRD----------------------------------------
COG3_SCHPO/100-257LKDS----------------------------------------
COG3_DROME/110-269LHPK----------------------------------------

PF13805

C5GWX7_AJEDR/1-271IDDTPVTPGETRNAYDGYDASRAIIQDCEDALTHWVSSNAAVSS
SLBR2_SCHPO/2-270IDDTPVTPGEARPAYDGYETSRQIVMDAEHALSSWVPSQPAVNF
A6ZV68_YEAS7/1-270LDDSPVTPGETRPAYDGYEASKQIIIDAESALNEWTLDSAQVKP
Q6CC94_YARLI/1-271LDDTPVTPGESRPAYDGYEASKQVIIDAENALASWTLDQASVKP
C4YEG9_CANAW/1-270LDDSAVTPGETRPAYDGYEASKQIIIDAENALASWTLDSAAVKP
C5DXD8_ZYGRC/1-270LDDSPVTPGETRSAYDGYDASKQIIMDAEAALESWTLDSAAVKP
Q2HFB9_CHAGB/2-286LDDTPVVPGDVRPPYAHASQTRQILNDAEDDLREWRLDAGFMGD

PF10455

MUG64_SCHPO/18-286IKNQLKFHQDAAAAL....SDITI--------------------
A3GFN0_PICST/37-331VDAQKEYFEVGAKKLAALSASLDK--------------------
A5DTV0_LODEL/37-351VQAQKEYFETSAKKLNDLLANLDK--------------------
A7TPP1_VANPO/27-288AAAKLAYHEKSVDALRNLLDNAEL--------------------
GVP36_YEAST/27-299AKAQAEYFETSAGLMKEFLSNSFA--------------------
YP148_YEAST/45-432QNFQLVYFRQCVQEVEANLKVLNG--------------------
Q59WJ7_CANAL/37-331VAAQKDYFEVGAKKLKEVLDNLDK--------------------
Q6CPI5_KLULA/40-383HNFQLIHYKQCVKSLEEDLEVLNS--------------------
Q6FKU8_CANGA/30-382QTFQLSYHQHCVKSLEQSLKDLNA--------------------
Q753K3_ASHGO/49-359QNFQLVYHRKCVQELEVSLNSLTS--------------------

PF03114

ARH37_MOUSE/243-445VVLQRDLADQV...LRRAESTMAL--------------------
RHG17_RAT/1-239LEAQADYHRKALAVLEKALPEMRA--------------------
RHG44_HUMAN/1-242IEVQAEYHRKSLTLLQAVLPQIKA--------------------
SH3G3_MOUSE/6-242VEAALDYHRQSTEILQELQSKLEL--------------------
Q8X0D7_NEUCS/18-242VKIQLRFCAEAYSRMAQVQQYLDP--------------------
Q8WQ54_GEOCY/24-244AAAETRFHAEISKVDEDLARVMDG--------------------
Q8NJ03_NEUCS/6-247YYMQLNIFYTLHEKMQHCDIGYFD--------------------
SH3G3_DROME/6-241AEALYDFHSQCADVLRGLQETLQE--------------------
Q95K31_MACFA/140-339I....TLLRDLMLVAQQAYSTLVP--------------------
Q8X0D6_NEUCS/3-231LDAELEYHERCADELRRVRQSWAG--------------------
Q20005_CAEEL/8-266VEAQMSFYAQSHQLMADLQRELSG--------------------
HOB1_SCHPO/6-247YYMQLNVYYVLYEKMSHCEIQYFD--------------------
O61843_CAEEL/6-240IEAQLDFHRQTAQCLENLQQQLGH--------------------
Q7ZWA0_DANRE/6-242VGSQLQFHKQSMQVLEELAGAMRE--------------------
Q8SYD9_DROME/13-268IQTQVRYYKQCGDVMEQLQRELAN--------------------
Q8IZ09_HUMAN/6-242VQAQLEYHKQAVQILQQVTVRLEE--------------------
AMPH_RAT/13-233SSLEAKFHKEIAVLCHKLYEVMTK--------------------
RV167_YEAST/6-247YFMQLNIFYTLYNRLQDMKIPYFD--------------------
Q9XW43_CAEEL/24-258SREVSIFNNSVENLLKEVVFRLGY--------------------
Q94211_CAEEL/24-258SREASVYHDTVHNSLSEVIFRLGY--------------------
Q803I3_DANRE/25-245SNLRDVFYKEMSMLNHNIYNMMKK--------------------
Q21004_CAEEL/9-230FNANSVYQTDASKFHKQIVMQLDK--------------------
YNQA_SCHPO/1-230LQMQIRFHQKSLDLLKGLEMNGFS--------------------
DNMBP_HUMAN/997-1207AEAHCDFVHQA...LEQLKPLLSL--------------------
SHLB1_HUMAN/11-254VEAQMTYYAQCYQYMLDLQKQLGS--------------------
Q7ZVM8_DANRE/6-242LEAVIDYHRQSSQILENLRSNLQT--------------------
RV161_YEAST/6-232IKIQLRFCTDGYTRLAQIQQYLDQ--------------------
Q9DDR3_LAMFL/6-242VDAQLEYHQRSAAVLQDLQAALHE--------------------

PF06456

ICA69_MOUSE/21-248QTTLLHFWEKTSHTM-----------------------------
PICK1_MOUSE/117-352VSTMSKYYNDCYAVL-----------------------------
RIC19_CAEEL/27-255QNELYEYYSKTSRAF-----------------------------
YL87_CAEEL/59-286QSALAAYYSGNAKLL-----------------------------
O18246_CAEEL/113-348AKTMAKCQQECAEIL-----------------------------
ARFP2_HUMAN/89-316HNAVSAYFAGNQKQL-----------------------------
ARFP1_HUMAN/121-348HNAIAAYFAGNQKQL-----------------------------
ICA1L_MOUSE/15-242QRTLLGFWEKTAQMM-----------------------------
Q8SY07_DROME/119-354LESLAELHRSLVDRL-----------------------------
Q9VGQ8_DROME/106-331HNAIAAYFSGNAMAL-----------------------------
Q9VP78_DROME/2-228VTELKNFAQKAASTF-----------------------------

PF08397

Q568N5_DANRE/16-235SHQVSAFHQKARELLSDNLIVWQEKCSDATNVP-----------
BAIP2_HUMAN/17-237AKNSAAYHSKGKELLAQKLPLWQQACADPSKIP-----------
Q6P7G7_XENLA/16-236SNYINYFHVQAVDLLTSKLPKWQETCSDISQVP-----------
MTSS1_HUMAN/16-237IEEEISMLGE.ITHLQTISEDLKSLTMDPHKLP-----------
MTSSL_HUMAN/15-239VNGELTMLGE.ITHLQGIIDDLVVLTAEPHKLP-----------
BI2L2_HUMAN/16-226SNTFLQFFGRARGMLQNRVLLWKEQ.SEASRSP-----------
Q6NV36_DANRE/16-235SYQLSAFHDKAKEMLTLKLPSWQEKCNDANRVP-----------
Q6AX92_XENLA/16-237LDEEIGMLGE.ITHLQTILEDLSSLTAEPSKLP-----------

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window