Sequence alignment for CL0148

PF02093

GAG_GALV/213-423QYWPFSSADLYNWKSNHPSFSENPAGLTGLLESLMFSHQPTWDDCQQLLQI--LF---TTEER-ERILLEA---------
GAG_BAEVM/236-446QYWPFSASDLYNWKTHNPSFSQDPQALTSLIESILLTHQPTWDDCQQLLQV--LL---TTEER-QRVLLEA---------
Q83378_9GAMR/222-432QYWPFSAADIYNWKQHNPPFSKDPVALTNLIESVLLTHQPTWDDIQQLLQA--LL---TSEEK-QRVLLEA---------
O62706_PIG/212-422QYWPFSSADLYNWKTNHPPFSEDPQRLTGLVESLMFSHQPTWDDCQQLLQT--LF---TTEER-ERILLEA---------
O89811_FLV/282-492QYWPFSASDLYNWKSHNPPFSQDPVALTNLIESILVTHQPTWDDCQQLLQA--LL---TGEER-QRVLLEA---------
Q83397_9GAMR/225-435QYWPFSSSDLYNWKNNNPSFSEDPGKLTALIESVLTTHQPTWDDCQQLLGT--LL---TGEEK-QRVLLEA---------

PF00607

GAK10_HUMAN/312-526------IKMLKDMKEGVKQYGPNSPYMRTLLDSIAYGHRLIPYDWEILAKSSLSP...SQFLQFKTWWIDG...VQEQ..
GAG_BLVAU/125-322------LRELQDIKKEIENKAPGSQVWIQTLRLAILQADPTPADLEQLCQY..IASPVDQTAH.MTSLTAA...IAAE..
GAG_SRV1/321-526------FTVIKELKTAASQYGATAPYTLAIVESVADNW.LTPTDWNTLVRA..VL...S.GGD.HLLWKSE...FFENCR
GAG_SMRVH/381-581------LKTIEKIKTAVANYGPTAPFTVALVESLSERW..LTPSDWFFLSR..AA...LSGGD.NILWKSEYEDISKQFA
GAG_HV1B1/149-363------PRTLNAWVKVVEE.KAFSPEVIPMFSALSEGA..TPQDLNTMLNT..VG...GHQAA.MQMLKET...INEEAA
GAG_MMTVB/290-496------LKTLKELQSAVRTMGPSAPYTLQVVDMVASQW..LTPSDWHQTAR..AT...LSPGD.YVLWRTE...YEEK..
GAG_SIVG1/151-366------PRTLNAWVKCVEE.KRWGAEVVPMFQALSEGC..LSYDVNQMLNV..IG...DHQGA.LQILKEV...INEEAA
GAG_EIAVY/141-355------PRGYTTWVNTIQTNGLLNEASQNLFGILSVDC..TSEEMNAFLDV..VP...GQAGQ.KQILLDA...IDKIAD
GAG_SIVVT/157-372------PRTLNAWVKAVEE.KKFGAEIVPMFQALSEGC..TPYDINQMLNV..LG...DHQGA.LQIVKEI...INEEAA
GAG_CAEVC/153-363------SVMFQQLQTVAMQHGLVSEDFERQLAYYATTW..TSKDILEVLAM..MP...GNRAQ.KELIQGK...LNEEAE
GAG_JSRV/272-477------FKQLKELKIACSQYGPTAPFTIAMIESLGTQA..LPPNDWKQTAR..AC...LSGGD.YLLWKSE...FFEQCA
GAG_SIVSP/151-365------PRTLNAWVKLIEE.KKFGAEVVPGFQALSEGC..TPYDINQMLNC..VG...EHQAA.MQIIREI...INEEAA
GAG_FIVT2/151-358------PKMVSIFMEKARE.GLGGEEVQLWFTAFSANL..TSTDMATLIMS..AP...GCAAD.KEILDET...LKQMTA
GAG_BIV29/165-368------MKQLKIWSDATER.NGVDLHAVNILGVITANL..VQEEIKLLLNS..TP...KWRLD.VQLIESK...VREK..
GAG_SIVGB/138-353------PRIIQTWVKTVEE.KKWKPEVIPLFSALTEGA..ISHDLNIMLNA..VG...DHQGA.MQVLKDV...INEQAA
GAG_HTL1A/147-344------MKDLQAIKQEVSQAAPGSPQFMQTIRLAVQQFDPTAKDLQDLLQY..LC...S.SLV.ASLHHQQ...LDSL..

PF02093

GAG_GALV/213-423----RKNVLGDNGAP--------TQLENLINEA---FPLNRPHWDYNTAAGRERLLVYRRTLVAGLKGAARRPTNLAKVR
GAG_BAEVM/236-446----RKNVPGPGGLP--------TQLPNEIDEG---FPLTRPDWDYETAPGRESLRIYRQALLAGLKGAGKRPTNLAKVR
Q83378_9GAMR/222-432----RKHVLGDNGRP--------TLLPEEIDDT---FPLTRPDWDFTTAEGRRHLRLYRQLLLAGLRGAARRPTNLAQVK
O62706_PIG/212-422----RKNVPGADGRP--------TRLQNEIDMG---FPLTRPGWDYNTAEGRESLKIYRQALVAGLRGASRRPTNLAKVR
O89811_FLV/282-492----RKQVPGEDGRP--------TQLPNVIDET---FPLTRPNWDFATPAGREHLRLYRQLLLAGLRGAARRPTNLAQVK
Q83397_9GAMR/225-435----RKAVRGNDGRP--------TQLPNEVDAA---FPLERPDWDYTTQRGRNHLVLYRQLLLAGLQNAGRSPTNLAKVK

PF00607

GAK10_HUMAN/312-526..VRRNRAAN.PPVN........IDADQLLGIGQNWSTISQQALMQN.....EAIEQVRAICLRAWEKIQDPGSTCPSFN
GAG_BLVAU/125-322...........AAIP........SRVL.IPKMGT..LTQQSAQPNAG.....DLRSQYQNLWLQAGRISLLVLQVQ.PWS
GAG_SRV1/321-526ETAKRNQQA...GNG........WDFDMLTGSGN..YSSTDAQMQYD....PGLFAQIQAAATKAWRKLPVKGDPGASLT
GAG_SMRVH/381-581ERTRVRPPPKDGPLK.............IPGASP..YQNNDKQAQFP....PGLLTQIQSAGLKAWKRLPQKGAATTSLA
GAG_HV1B1/149-363EWDRVHPVHA.GPIAPG.QMREPRGSD.IAGTTS..TLQEQIGWMTN.NPPIPVGEIYKRWIILGLNKIVRMYSPT.SIL
GAG_MMTVB/290-496SKEMVQKAA..GKRKGK......VSLDMLLGTGQ..FLSPSSQIKLS....KDVLKDVTTNAVLAWRAIPPPGVKKTVLA
GAG_SIVG1/151-366EWDRTHRPPA.GPLPAG.QLRDPTGSD.IAGTTS..SIQEQIEWTFNANPRIDVGAQYRKWVILGLQKVVQMYNPQ.KVL
GAG_EIAVY/141-355DWDNRHPLPN.APLVAPPQGPIPMTARFIRGLGV..PRERQMEPAFD....QFR.QTYRQWIIEAMSEGIKVMIGKPKAQ
GAG_SIVVT/157-372QWDVTHPLPA.GPLPAG.QLRDPRGSD.IAGTTS..SVQEQLEWIYTANPRVDVGAIYRRWIILGLQKCVKMYNPV.SVL
GAG_CAEVC/153-363RWRRNNPPP...PAGGG......LTVDQIMGVGQ..TNQAAAQANMD.....QARQICLQWVINALRAVRHMAHRPGNPM
GAG_JSRV/272-477RIADVNRQQ...GIQ........TSYEMLIGEGP..YQATDTQLNFL....PGAYAQISNAARQAWKKLPSSSTKTEDLS
GAG_SIVSP/151-365DWDLQHPQP..GPIPPG.QLREPRGSD.IAGTTS..TVDEQIQWMYRQQNPIPVGNIYRRWIQLGLQKCVRMYNPT.NIL
GAG_FIVT2/151-358EYDRTHPPD..GPRP....LPYFTAAE.IMGIGL..TQEQQAEPRFA.....PARMQCRAWYLEALGKLAAIKAKSPRAV
GAG_BIV29/165-368..ENAHRTWK.QHHP.....EAPKTDE.IIGKGL..SSAEQATLISV.....ECRETFRQWVLQAAMEVAQAKHATPGPI
GAG_SIVGB/138-353EWDLTHPQQQ.PAQPGG.GLRTPSGSD.IAGTTS..TVEEQLAWMNMQQNAINVGTIYKSWIILGMNRLVKSHCPI.SIT
GAG_HTL1A/147-344....ISEAE...TRG........ITGY.NPLAGP..LRVQANNPQQQ.....GLRREYQQLWLAAFAALPGSAKDP.SWA

PF02093

GAG_GALV/213-423EVLQGPAEPPSVFLERLMEAYRRYTPFDPSSEGQQAAVAMAFIGQSAPDIKKKLQRLE--GLQDYSL-QDLVKEAEKVYH
GAG_BAEVM/236-446TITQGKDESPAAFMERLLEGFRMYTPFDPEAPEHKATVAMSFIDQAALDIKGKLQRLD--GIQTHGL-QELVREAEKVYN
Q83378_9GAMR/222-432QVVQEAAETPSAFLERLKEAYRMYTPYDPDDPGQMTNVSMSFIWQAAPDIRAKLQRIE--NLQGYTL-QDLLKEAERIYN
O62706_PIG/212-422EVMQGPNEPPSVFLERLLEAFRRYTPFDPTSEAQKASVALAFIGQSALDIRKKLQRLE--GLQEAEL-RDLVKEAEKVYY
O89811_FLV/282-492QVVQGKEETPAAFLERLKEAYRMYTPYDPEDPGQAASVILSFIYQSSPDIRNKLQRLE--GLQGFTL-SDLLKEAEKIYN
Q83397_9GAMR/225-435GITQGPNESPSAFLERLKEAYRRYTPYDPEDPGQETNVSMSFIWQSAPDIGRKLERLE--DLKSKTL-GDLVREAERIFN

PF00607

GAK10_HUMAN/312-526TVRQGSKEPYPDFVARLQDVAQKSIA--DEKAGKVIVELMAY-ENANPECQSAIKPLKGKVPAGSDVISEYVKACDGIGG
GAG_BLVAU/125-322TIVQGPAESYVEFVNRLQISLADNLP--DGVPKEPIIDSLSY-ANANKECQQILQGRG...LVAAPV.GQKLQACA.HWA
GAG_SRV1/321-526GVKQGPDEPFADFVHRLITTAGRIFG--SAEAGVDYVKQLAY-ENANPACQAAIRPYR....KKTDL.TGYIRLCSDIGP
GAG_SMRVH/381-581KIRQGPDESYSDFVSRLQETADRLFG--SGESESSFVKHLAY-ENANPACQSAIRPFR..QKELSTM.SPLLWYCS....
GAG_HV1B1/149-363DIRQGPKEPFRDYVDRFYKTLRAEQA--SQEVKNWMTETLLV-QNANPDCKTILKALG....PAATL.EEMMTACQGVGG
GAG_MMTVB/290-496GLKQGNEESYETFISRLEEAVYRMMP--RGEGSDILIKQLAW-ENANSLCQDLIRPIR....KTGTI.QDYIRACLDASP
GAG_SIVG1/151-366DIRQGPKEPFQDYVDRFYKALRAEQA--PQDVKNWMTQTLLI-QNANPDCKLILKGLG....MNPTL.EEMLIACQGVGG
GAG_EIAVY/141-355NIRQGAKEPYPEFVDRLLSQIKSEGH--PQEISKFLTDTLTI-QNANEECRNAMRHLR....PEDTL.EEKMYACRDIGT
GAG_SIVVT/157-372DIRQGPKEPFKDYVDRFYKAIRAEQA--SGEVKQWMTESLLI-QNANPDCKVILKGLG....MHPTL.EEMLTACQGVGG
GAG_CAEVC/153-363LVKQKTNEPYEDFAARLLEAIDAEPV--TQPIKDYLKLTLSY-TNASADCQKQMDRTLGQRVQQASV.EEKMQACRDVGS
GAG_JSRV/272-477KVRQGPDEPYQDFVARLLDTIGKIMS--DEKAGMVLAKQLAF-ENANSACQAALRPYR....KKGDL.SDFIRICADIGP
GAG_SIVSP/151-365DVKQGPKEPFQSYVDRFYKSLRAEQT--DPAVKNWMTQTLLI-QNANPDCKLVLKGLG....INPTL.EEMLTACQGVGG
GAG_FIVT2/151-358QLKQGAKEDYSSFIDRLFAQIDQEQN--TAEVKLYLKQSLSI-ANANPDCKRAMSHLK....PESTL.EEKLRACQEVGS
GAG_BIV29/165-368NIHQGPKEPYTDFINRLVAALEGMAA--PETTKEYLLQHLSI-DHANEDCQSILRPLG....PNTPM.EKKLEACRVVGS
GAG_SIVGB/138-353DVRQGPKEAFKDYVDRFYNVMRAEQA--SGEVKMWMQQHLLI-ENANPECKQILRSLG....KGATL.EEMLEACQGVGG
GAG_HTL1A/147-344SILQGLEEPYHAFVERLNIALDNGLP--EGTPKDPILRSLAY-SNANKECQKLLQARG...HTNSPL.GDMLRACQ.TWT

PF02093

GAG_GALV/213-423KRET----
GAG_BAEVM/236-446KRET----
Q83378_9GAMR/222-432KRET----
O62706_PIG/212-422KRET----
O89811_FLV/282-492KRET----
Q83397_9GAMR/225-435KRET----

PF00607

GAK10_HUMAN/312-526AMHKAMLM
GAG_BLVAU/125-322PKTKQPAI
GAG_SRV1/321-526SYQQGLAM
GAG_SMRVH/381-581....AHAV
GAG_HV1B1/149-363PGHKARVL
GAG_MMTVB/290-496AVVQGMAY
GAG_SIVG1/151-366PQHKAKLM
GAG_EIAVY/141-355TKQKMMLL
GAG_SIVVT/157-372PSYKAKVM
GAG_CAEVC/153-363EGFKMQLL
GAG_JSRV/272-477SYMQGIAM
GAG_SIVSP/151-365PGQKARLM
GAG_FIVT2/151-358PGYKMQLL
GAG_BIV29/165-368QKSKMQFL
GAG_SIVGB/138-353PQHKARLM
GAG_HTL1A/147-344PKDKTKVL

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window