Sequence alignment for CL0157

PF02616

Y1134_METJA/18-224GIEKKNLNPWDVNIAEIADYYIQKIKEL.KKFDIRL.......SADVILVAGILLRMKSEALYD....ECKVEEEEDYDY
SCPA_MYCPN/178-414LLIDKKFNLHQVDIAKITTQYLHLINTNLNKQAIEP.......ITDYLVITSRIVEQKANNLLQ....INDIAL..DSDF
O83689_TREPA/28-240LIKKNELSIYDIPICEITAQYLQYVDQT.VSPDLRG.......LTEFYAMAAVLLYIKSCMLLP....MELDLDGEDIE.
SCPA_BACSU/21-245LINRLEIDIYDIPVAKITEQYLLYVHTM.RVLELDI.......ASEYLVMAATLLSIKSRMLLP....KQEEELFEDELL
O66739_AQUAE/18-203LIEEGKLDPWEVDIVELANLYMEELKKL.EVLDLRV.......PARAILAASFLLRKKIETIFPK...............
P74212_SYNY3/16-259MAHQGEINPWDVSVIDVIDRFLQDLGIL.NSLDLNFQQQNLPRSGQAFLWASMLVRYKADSLH....NLEQEPEEVLPEA
SCPA_MYCGE/167-402LLVDKKVSVNDVDIGLISLQYLNIIANYTNKKAIEK.......ITDYLVITSKILAKKADNLLN....DHQEESVLEYDL
O28713_ARCFU/1-224MAKRGEIDPWNIDVVDVTDRFLKRIEDA.KKLDLRV.......SGRVLLYAAILVRMKAEAITLEALGGDEEEELEMYDY
Q49888_MYCLE/28-252LICAHRLDVTEVALHQVTDDFIAYIRRLGPQLGLEE.......TTAFLVIAATLIDLKAARLLP....AGRVEDEEDLA.
O33208_MYCTU/40-264LIFAHQLDVTEVALHQVTDDFIAYTKAIGARLELEE.......TTAFLVIAATLLDLKAARLLP....AGQVDDEEDLA.
O59461_PYRHO/15-213LVKMGKVDPWNIDIVDLTEKYIKMLREM.QELDLRI.......SARAILAASILVRMKSEALL....RGEEEEN......

PF04824

RAD21_MOUSE/578-632-------------------------------------------TGAESISLLELC.RN----------------------
RAD21_SCHPO/568-623-------------------------------------------TEGEKVSFQTLS.AG----------------------
REC8_SCHPO/503-557-------------------------------------------NNGRITFSSLLP.ND----------------------
Q9LF01_ARATH/962-1016-------------------------------------------NGKNVLVADKLL.AG----------------------
REC8_HUMAN/492-546-------------------------------------------ANREPDFSSLVS.PL----------------------
Q9AXN6_ORYSA/445-499-------------------------------------------DQPGKFILNRIL.EG----------------------
Q21306_CAEEL/594-647-------------------------------------------NGQVELD.EMLK.KG----------------------
SCC11_ARATH/573-627-------------------------------------------GAPQVESLNKLA.VG----------------------
REC8_MOUSE/536-590-------------------------------------------ANKELDFSSLVP.PL----------------------
Q9XHV2_ORYSJ/624-675-------------------------------------------GASQSESLSQLA.HG----------------------
SCC12_ARATH/752-806-------------------------------------------EEEEKVSLLQLC.RG----------------------
Q9U6D9_DROME/656-710-------------------------------------------IAKDSLELSQLT.SG----------------------
SCC1_YEAST/505-559-------------------------------------------TDVLKSQANTEP.EN----------------------
Q19325_CAEEL/561-615-------------------------------------------TSGQADFSSVTA.TA----------------------
Q19232_CAEEL/542-595-------------------------------------------FEVTLDS..MIPVAA----------------------
SCC13_ARATH/633-687-------------------------------------------HPSGDLSLSEIL.AG----------------------

PF02616

Y1134_METJA/18-224CDDYYDYDDIEEKP....KKGKKKEKEDK......DKNKKSKKPVTVDELIKTIEK...ELNKVKK..............
SCPA_MYCPN/178-414LDNKLRDKLVAQLVEYKRYRESLDDFEKLRINRL...AYFSKD.NDFNRFIQTVDKSNTEPVKIEDELPNYVSVLKLHHA
O83689_TREPA/28-240...DPRQSLVEHLIEYQKYKQLCKLMELYECEDM...WCVERK.KTQHLFLSPAEV...PL..LHG......DVRDLLML
SCPA_BACSU/21-245EEEDPREELIEKLIEYRKYKDAAKDLKEREEERQ...KSFTKPPSDLSEYAKEVKQ...SEQKLSV......TVYDMIGA
O66739_AQUAE/18-203...................................PPRKYTKRKYTLQEIVDMFEE...EYREVEE......DIKENVEK
P74212_SYNY3/16-259ELEEWPDGLIARLP....RDLENRLRRRTA....VPPLQ..RRRVTLAELIDQIEA...IAVEIEK......S.....EQ
SCPA_MYCGE/167-402ATNNFRDKMIANLVEHKRYCDSLGEFEKLRVNRL...AYFSKA.NEMEQFIKT...ANDQLVTVEDQLPNYISVLKLFHA
O28713_ARCFU/1-224DSFYFLDE.PLEFP....EEVDEEELDEVILEALTSMRRRVRKITTLKDLIDELRR...A.EEVER..............
Q49888_MYCLE/28-252.LLEGRDLLFARLLQYRAFKRVAQIFAELEATAL...RSYPHAVFLEERFASLLPE...VMIGVDA......DRFAEIAA
O33208_MYCTU/40-264.LLEVRDLLFARLLQYRAFKHVAEMFAELEATAL...RSYPRAVSLEDGFVGLLPE...VMLGVDA......HRFAEIAA
O59461_PYRHO/15-213..................KRGEEEKIKV.DVDPLVPPLRRVERYYTLDDLIEALMD...ALEEAEK..............

PF04824

RAD21_MOUSE/578-632--------------------------------------------------------------------------------
RAD21_SCHPO/568-623--------------------------------------------------------------------------------
REC8_SCHPO/503-557--------------------------------------------------------------------------------
Q9LF01_ARATH/962-1016--------------------------------------------------------------------------------
REC8_HUMAN/492-546--------------------------------------------------------------------------------
Q9AXN6_ORYSA/445-499--------------------------------------------------------------------------------
Q21306_CAEEL/594-647--------------------------------------------------------------------------------
SCC11_ARATH/573-627--------------------------------------------------------------------------------
REC8_MOUSE/536-590--------------------------------------------------------------------------------
Q9XHV2_ORYSJ/624-675--------------------------------------------------------------------------------
SCC12_ARATH/752-806--------------------------------------------------------------------------------
Q9U6D9_DROME/656-710--------------------------------------------------------------------------------
SCC1_YEAST/505-559--------------------------------------------------------------------------------
Q19325_CAEEL/561-615--------------------------------------------------------------------------------
Q19232_CAEEL/542-595--------------------------------------------------------------------------------
SCC13_ARATH/633-687--------------------------------------------------------------------------------

PF02616

Y1134_METJA/18-224.......SRKNREKKTNEVEEII.....EELIEEDDISDIIA.............ELLDDLMKEG.IIVYQEKFK.....
SCPA_MYCPN/178-414MNKLMQRWRAQFLANKNI........SIQELSIEQVQAEILATIKQFGYHSVSLKRVLLKV...................
O83689_TREPA/28-240FIRLVRKTPQWIMDLY..........EE..VSVNEKLTLLSE....LL..GVRGR............CVFTELIKQP...
SCPA_BACSU/21-245FQKVLKRKKINRPMETTITRQ........DIPIEARMNEIV.................HSLKSRGTRINFMDLFPY....
O66739_AQUAE/18-203IRKIVKRKRASAKRKRREKRKEVPL...HVAKFEEVLEELW..............NSFKELEVGT.RLSFFNF.......
P74212_SYNY3/16-259KPKRVKRA.....RP.QSRREALQIITEL..AHQENLTELASQLEQFL..QTRLPEILPDLPHRS.WVDLDTLLHCWHHH
SCPA_MYCGE/167-402MNKLLEMRLSSLLTNKNI........TIKELSVEQVQKELVLAIKQFNYQTVSLKRVLLKL...................
O28713_ARCFU/1-224........RRRRRRR.RERQEEVGIDAALRVPHEESLEEMIARVER.........EVFEALRKKD.TVTLFSLVKS....
Q49888_MYCLE/28-252FTFTPRPVPIVATGHL..........HELKISVPEQAKRLLA....ML..EARGN.........GQWTSFSELVADC...
O33208_MYCTU/40-264IALTPRPAPTVATEHL..........HELMVSVPEQAEHLLA....ML..KARGS.........GQWASFSELVADC...
O59461_PYRHO/15-213........RKPKKKKKVEIDEEIFVVDDFRVDIEKYVEELY.KVVK.........KIYE..KTKT.PIKFWDLVPD....

PF04824

RAD21_MOUSE/578-632--------------------------------------------------------------------------------
RAD21_SCHPO/568-623--------------------------------------------------------------------------------
REC8_SCHPO/503-557--------------------------------------------------------------------------------
Q9LF01_ARATH/962-1016--------------------------------------------------------------------------------
REC8_HUMAN/492-546--------------------------------------------------------------------------------
Q9AXN6_ORYSA/445-499--------------------------------------------------------------------------------
Q21306_CAEEL/594-647--------------------------------------------------------------------------------
SCC11_ARATH/573-627--------------------------------------------------------------------------------
REC8_MOUSE/536-590--------------------------------------------------------------------------------
Q9XHV2_ORYSJ/624-675--------------------------------------------------------------------------------
SCC12_ARATH/752-806--------------------------------------------------------------------------------
Q9U6D9_DROME/656-710--------------------------------------------------------------------------------
SCC1_YEAST/505-559--------------------------------------------------------------------------------
Q19325_CAEEL/561-615--------------------------------------------------------------------------------
Q19232_CAEEL/542-595--------------------------------------------------------------------------------
SCC13_ARATH/633-687--------------------------------------------------------------------------------

PF02616

Y1134_METJA/18-224.......TREDRVRYFIPSLYLAND--GKAELIQ-EKLFGELIIKLK---
SCPA_MYCPN/178-414...NHHISLMYFITAFVALLVLINN--QIIDIEQ-TSFDDELYICLL---
O83689_TREPA/28-240.......SRADVVCAFVAILEAAKT--HLVHISQ-PEFFGPITLYAR---
SCPA_BACSU/21-245......EQKEHLVVTFLAVLELMKN--QLVLIEQ-EHNFSDIYITGS---
O66739_AQUAE/18-203......LSKKDLVPQFMALLYLDYE--SKVRLFQ-EKPFEDITVEIL---
P74212_SYNY3/16-259LDPDKLPDKKDKVGVFWALLLLSSQ--SKVSLAQ-EEFYQDLQVQII---
SCPA_MYCGE/167-402...NHPISLMYFVTAFVALLVLLNN--QVIGLEQ-KDYHSELYIFLL---
O28713_ARCFU/1-224......WDVPTLVDYYVSVLHLAFR--KKVEIRQ-EEFYGDVEIQKF---
Q49888_MYCLE/28-252......REPIEVVGCFLALLELYRT--RAIAFEQ-AEPLGVLQVSWA---
O33208_MYCTU/40-264......TAPIEIVGRFLALLELYRT--RAVAFEQ-SEPLGALQVSWT---
O59461_PYRHO/15-213......VEPKIIARTFLYLLFLENM--GRVEMIQ-EEPFGEILVVPV---

PF04824

RAD21_MOUSE/578-632------TNRKQAAAKFYSFLVLKKQ..QAIELTQ.EEPYSDIIATPGPRF
RAD21_SCHPO/568-623------CNREEAVQLFFDVLVLATK..DVISVKQDVAIQNEITLTAKRGM
REC8_SCHPO/503-557------LKRPVVAQAFSHLLSLATK..SAFLVKQ.DKPYSEISVSLNLKS
Q9LF01_ARATH/962-1016------KTRKEASRMFFETLVLKTR..DYIQVEQ.GKPYESIIIKPRPKL
REC8_HUMAN/492-546------SPRRMAARVFYLLLVLSAQ..QILHVKQ.EKPYGRLLIQPGPRF
Q9AXN6_ORYSA/445-499------RHRKQAARMFFETLVLKSY..DYIDVEQ.EAAYGDIAVSVKPSL
Q21306_CAEEL/594-647------TSRKVAAAKFYSLLCLKKN..QCIDIEQ.KEPYGDIMIKAGPNI
SCC11_ARATH/573-627------MDRNAAAKLFFQSCVLATR..GVIKVNQ.AEPYGDILIARGPNM
REC8_MOUSE/536-590------SPRKLASRVFYLLLVLSTQ..KILLVEQ.QKPYGPLLIRPGPKF
Q9XHV2_ORYSJ/624-675------MTTAKAARLFYQACVLREENKCAIAL......FPELDKWATPSL
SCC12_ARATH/752-806------RTQKESARLFYETLVLKTK..GYVEVKQ.NHPYSDVFLMRVSRP
Q9U6D9_DROME/656-710------NSRKQAAQKFYSLLVLKKF..KVLHIDQ.SAPYADITITRGPTF
SCC1_YEAST/505-559------ITKREASRGFFDILSLATE..GCIGLSQ.TEAFGNIKIDAKPAL
Q19325_CAEEL/561-615------KNRKQAAEQFYSLLTLAKS..QAISVDQ.SEPYGEIVIRPGANF
Q19232_CAEEL/542-595------TSRREAARTFYTVLELLKE..RKIKATQ.RAPYENIDLLLSTDD
SCC13_ARATH/633-687------KTRKLAARMFFETLVLKSR..GLIDMQQ.DRPYGDIALKLMPAL

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window