Sequence alignment for CL0169

PF03389

MOBA2_ECOLX/17-218---------------------------------------QSARAKADYIQR-----------------------------
MOBL_THIFE/17-244---------------------------------------RSATGAAAYRAG-----------------------------
O87207_9LACT/17-239---------------------------------------RSAVASASYRSG-----------------------------
Q9R6F0_RHIRD/17-243---------------------------------------RSAVLSAAYRHC-----------------------------
TRAA_RHISN/17-243---------------------------------------RSAVLSAAYRHC-----------------------------
Q52001_9ZZZZ/11-235---------------------------------------RSLIAMASYRSG-----------------------------
Q9ZA19_BIFLN/2-224---------------------------------------RDERTGEAFNGF-----------------------------
TRAA_AGRT5/17-243---------------------------------------RSVVLSAAYQHC-----------------------------
Q53632_STAAU/17-218---------------------------------------QSATAKSAYNSA-----------------------------

PF03432

Q9WW30_PEDPE/8-248---------------------------------------RSDSASRLVNYA-----------------------------
RLX3_STAAU/8-236---------------------------------------STKSTSRAINYA-----------------------------
Q56424_BACFG/7-242---------------------------------------KGTSFSGCVCYV-----------------------------
VIRD2_RHIRD/16-264---------------------------------------GTKTLQQIINQL-----------------------------
Q45123_BACFG/7-242---------------------------------------SISHGVAALEYD-----------------------------
Q9ZIP2_FUSNU/13-276---------------------------------------TKSSLYNILKYV-----------------------------
TRAI6_ECOLX/12-252---------------------------------------KKSDFAELVKYI-----------------------------
Q9R2J7_9ZZZZ/61-315---------------------------------------RNESFVALVDVM-----------------------------
Q9Z361_STAEP/8-242---------------------------------------ATKSTSRAINYA-----------------------------
LTRB_LACLM/34-307---------------------------------------NEDHLTNLFPYI-----------------------------
Q9XAW2_PSEAC/12-285---------------------------------------GKTSFKSLAKYA-----------------------------
Q51927_PASMD/14-247---------------------------------------.ASSCKACVDYL-----------------------------
TRAI5_ECOLX/12-252---------------------------------------GKSDFAGLANYI-----------------------------
Q54883_STRPN/11-264---------------------------------------GKNYRSKLIKYI-----------------------------
RLX1_STAAU/8-238---------------------------------------NTKSASRAINYA-----------------------------
RLX2_STAAU/8-239---------------------------------------NTKSASRAINYA-----------------------------
Q57087_9ZZZZ/9-280---------------------------------------NGASAASALNYA-----------------------------

PF01076

65KD_ZYMMA/1-192---------------------------------------MPNYAIFRFEKH-----------------------------
O54530_9ZZZZ/1-186---------------------------------------MAAYAIMRCKKL-----------------------------
O87277_9STAP/1-193---------------------------------------MS.YAVCRMQKV-----------------------------
P71098_BACTI/20-220---------------------------------------HNNREMNEKEKE-----------------------------
O32791_9LACT/1-193---------------------------------------MS.FAVARMQKV-----------------------------
Q45448_BACIU/1-193---------------------------------------MANYAVIRMEKY-----------------------------
PRE_STRAG/1-194---------------------------------------MS.YMVARMQKM-----------------------------
PRE1_STAAU/1-198---------------------------------------MS.HSILRVARV-----------------------------
PREA_BACTU/1-192---------------------------------------MNKFAIIHMQKF-----------------------------
Q52058_9ZZZZ/3-190---------------------------------------SNNFCILRFQKI-----------------------------
Q09026_OENOE/1-199---------------------------------------.MYKLVLHVKHF-----------------------------
Q53618_STAAU/1-198---------------------------------------MA.YSIIRVAKV-----------------------------
Q48524_LACCA/1-194---------------------------------------MS.YLVANMQKL-----------------------------
O05418_CLOPF/6-219---------------------------------------KADMSCARVKKY-----------------------------
Q52050_BUTFI/1-198---------------------------------------MG.YGIMRCEKR-----------------------------
PREA_LACPN/1-194---------------------------------------MS.FAVARMTKL-----------------------------
P71520_MARHA/20-221---------------------------------------HNNREFTERGKE-----------------------------
Q53620_STAAU/1-198---------------------------------------MS.YSIVRVSKV-----------------------------

PF00799

REP_BGYMV/7-120--------------------------------------------FRVQSKN-----------------------------
REP_PHUV/7-120--------------------------------------------FRLNAKN-----------------------------
REPA_PASVK/17-125--------------------------------------------FRHRNAN-----------------------------
REPA_MSVK/10-118--------------------------------------------FSHRNAN-----------------------------
REPA_CSMV/34-142--------------------------------------------FSLRTKH-----------------------------
REP_TLCVA/7-120--------------------------------------------FRINAKN-----------------------------
REPA_TYDVA/11-118--------------------------------------------FRLQTKY-----------------------------
REPA_WDVS/9-127--------------------------------------------FRVYSKY-----------------------------
REP_CLVK/6-119--------------------------------------------FRIQAKN-----------------------------
REP_SLCV/8-122--------------------------------------------FRLTARN-----------------------------
REP_BCTVC/7-120--------------------------------------------FRIQAKN-----------------------------

PF05840

VGA_BPG4/115-441PDELQLSDEIVEDYRLTVLSIIE................ELQECYDVLGQL.DINNTIDHK.P.................
REPA_BPPHX/74-400VDGHKAASDVRDEFVSVTEKLMD................ELAQCYNVLPQL.DINNTIDHR.P.................
VGA_BPPHK/49-381SEETHLDDETYALYESQTGLLED................HMALVRKCAAQL.DNSNTIDHRTP.................
Q8W759_9CAUD/122-510DELRDMAFRIAKIMEAYLQLTAS....RKHADREEDVDQAVVDAYEALAHFCTQTFGIKA..PRK...........YQKQ
VPA_BP186/139-507ADIDLLAADIANFIRAELADIDD.........TGFSELKTLYTWYMRAGFI.SLQFNVTP..PKW.......ERVTKKYF
VPA_BPP2/133-515KELKKFAARISSQLFMMYEELSDAWVDAHGEKESLFTDEAQAHLYGHVAGA.ARAFNIS...PLY......WKKYRKGQM
ENDP2_SALTI/193-568DQVKRLSTLVAAHMSMCLDAAC.....GDLFVSDDVKPEEIRQAWERVAAE.AMRLEVIP..PAF..EQLRRKKRRRKPV
Q8XBG0_ECO57/179-564HQIQTLATMTAAMFSSTFEKLCD....GFGATDGELTMDVTLKAYQMLARM.ALHLHAMP..PHY..DALTTDKDRRNEP
P12_BPPM2/101-478LQRDKRRKDKAKQLALICQQMGI..VDFDKSMTLEQATALVISKYQKLAEF.TINQIDTA..PAYSTYEAFMKKGGNPEI
REP_BPHP1/204-578SKLKKMAYEMATAFIRFQCDCSHFLKNGIEKDNEGDIQGYFYQLYKWCGEI.AFSAGFKI..PHW......EKIENDKRI
O80256_9VIRU/150-506DECVELAKAKAKAFSKTLSKFDE.............IEEPFTKACELLASL.GLSFR.....PEL..........IKQKR

PF02407

REP9_FBNY2/3-82---------------------------------------AVNWVFTLNFAG-----------------------------
Q8AYY2_GOCV/9-96---------------------------------------YKRWVFTINNPT-----------------------------
REP7_FBNY2/6-83---------------------------------------ATHWCFTLNFSG-----------------------------
Q7T7M5_9VIRU/6-94---------------------------------------AQWWCFTVFFLS-----------------------------
REP_PCV2/14-100---------------------------------------HKRWVFTLNNPS-----------------------------
Q66005_9VIRU/5-93---------------------------------------IRRWCFTLNYET-----------------------------
MREP_SCSVF/5-83---------------------------------------VICWCFTLNNP.-----------------------------
Q9NJY0_GIAIN/7-96---------------------------------------VRSWIGTLNGAD-----------------------------
REP1_FBNY2/3-82---------------------------------------CSNWVFTRNFQG-----------------------------
Q65378_BBTV/5-83---------------------------------------VVCWMFTINNP.-----------------------------
Q83026_BBTV/5-92---------------------------------------SLKWCFTLNYSS-----------------------------
REP1_MDV1/6-84---------------------------------------GTFWCFTLNFSG-----------------------------
REP_CACV/9-93---------------------------------------AKRWCFTLNNYT-----------------------------
Q8QME8_9VIRU/5-87---------------------------------------GKRWCFTSFDSD-----------------------------
REP6_SCSVF/6-86---------------------------------------STSWVFTLNFEG-----------------------------
REP3_MDV1/6-85---------------------------------------STCWVFTLNFKG-----------------------------
Q8QTK9_BBTV/3-90---------------------------------------ASRWTFTLHYSD-----------------------------
Q91GA3_PICV/36-120---------------------------------------AKRWCFTLNNPT-----------------------------
REP2_SCSVF/2-88---------------------------------------ARRYCFTLNYAT-----------------------------

PF01446

O52769_STRPN/89-314----------------------------------------MKYSYQTSQIV-----------------------------
Q45447_BACIU/96-338----------------------------------------LKIAYHNKLIV-----------------------------
Q04140_9ZZZZ/8-257----------------------------------------LKIAYQNKRVV-----------------------------
P94343_PAEPP/119-370----------------------------------------LKVAHQVKRVA-----------------------------
Q52233_9ZZZZ/88-315----------------------------------------MKYQVQISKIV-----------------------------
REP_LACHI/82-313----------------------------------------MGQSNQLMQVL-----------------------------
Q9Z9H4_LACPN/83-316----------------------------------------LKNSSQLTEIL-----------------------------
Q45962_CLOBU/94-350----------------------------------------VKQASRMAKYI-----------------------------
Q55003_SELRU/109-342----------------------------------------LKLFSQVSRIT-----------------------------
O31146_ZYMMB/105-328----------------------------------------LMWQARFYSAL-----------------------------
O33866_BACPU/97-340----------------------------------------LKIACHNKLIV-----------------------------
P96459_STAAU/94-329----------------------------------------MKNSYQAQKVI-----------------------------
Q48548_LACFE/83-313----------------------------------------LKNSYELQQIL-----------------------------
REP_BACSP/64-306----------------------------------------LKIAYHNKLIV-----------------------------
Q99135_9ZZZZ/88-313----------------------------------------LMWQARFYQAL-----------------------------
Q9ZNC0_9PROT/105-304----------------------------------------LTSYLQRYQIV-----------------------------
Q51313_9NOSO/107-321----------------------------------------LMWKAKAYKIL-----------------------------
REP_LACPN/80-316----------------------------------------MKNSSQLKQII-----------------------------
Q48836_LACRE/82-310----------------------------------------MKNSYELRQIL-----------------------------
Q06460_9SYNC/106-332----------------------------------------LMWRAKAFKIL-----------------------------
Q48905_MICAE/1-247----------------------------------------..MRG.SLKPY-----------------------------
O30850_STRTR/89-312----------------------------------------MKYSYQTSKIV-----------------------------
REPB_STAAU/1-233----------------------------------------MKHGIQSQKVV-----------------------------
Q01536_9ZZZZ/1-236----------------------------------------MKYAYQAELVV-----------------------------
O87867_STASA/94-328----------------------------------------MKNSYQTQKIV-----------------------------

PF07232

Y35K_HALSI/1-316---MAKRD....GMKLRDELTFDTSRAVKAVSWGEAIDRFQSWYDDQRGTQ-----------------------------
Y36K_HALSN/1-328---MASQPEEGFGERLRKEVTVDTSRGVRATSTAQAVENFEGWYADQRDTQ-----------------------------

PF02217

LT_POVBO/129-222--------------------------------------------PDFPEVL-----------------------------
LT_POVMK/151-247--------------------------------------------NDMPADL-----------------------------
Q80FI2_9POLY/134-228--------------------------------------------IPLPDAV-----------------------------
Q9DPC0_POVJC/137-230--------------------------------------------KDFPVDL-----------------------------
LT_POVLY/200-298--------------------------------------------DDFPVCL-----------------------------
Q20HY2_9POLY/139-233--------------------------------------------ICLPADV-----------------------------
Q9J7C9_SV40/136-229--------------------------------------------KDFPSEL-----------------------------
Q20HX6_9POLY/120-214--------------------------------------------IDLPASI-----------------------------
LT_POVHA/261-354--------------------------------------------DDFPTIL-----------------------------
Q9IBK8_BFPYV/111-204--------------------------------------------YELPPEV-----------------------------
LT_POVMC/285-377--------------------------------------------SDFPSSL-----------------------------

PF03389

MOBA2_ECOLX/17-218--------------------------------------------------------------------------------
MOBL_THIFE/17-244--------------------------------------------------------------------------------
O87207_9LACT/17-239--------------------------------------------------------------------------------
Q9R6F0_RHIRD/17-243--------------------------------------------------------------------------------
TRAA_RHISN/17-243--------------------------------------------------------------------------------
Q52001_9ZZZZ/11-235--------------------------------------------------------------------------------
Q9ZA19_BIFLN/2-224--------------------------------------------------------------------------------
TRAA_AGRT5/17-243--------------------------------------------------------------------------------
Q53632_STAAU/17-218--------------------------------------------------------------------------------

PF03432

Q9WW30_PEDPE/8-248--------------------------------------------------------------------------------
RLX3_STAAU/8-236--------------------------------------------------------------------------------
Q56424_BACFG/7-242--------------------------------------------------------------------------------
VIRD2_RHIRD/16-264--------------------------------------------------------------------------------
Q45123_BACFG/7-242--------------------------------------------------------------------------------
Q9ZIP2_FUSNU/13-276--------------------------------------------------------------------------------
TRAI6_ECOLX/12-252--------------------------------------------------------------------------------
Q9R2J7_9ZZZZ/61-315--------------------------------------------------------------------------------
Q9Z361_STAEP/8-242--------------------------------------------------------------------------------
LTRB_LACLM/34-307--------------------------------------------------------------------------------
Q9XAW2_PSEAC/12-285--------------------------------------------------------------------------------
Q51927_PASMD/14-247--------------------------------------------------------------------------------
TRAI5_ECOLX/12-252--------------------------------------------------------------------------------
Q54883_STRPN/11-264--------------------------------------------------------------------------------
RLX1_STAAU/8-238--------------------------------------------------------------------------------
RLX2_STAAU/8-239--------------------------------------------------------------------------------
Q57087_9ZZZZ/9-280--------------------------------------------------------------------------------

PF01076

65KD_ZYMMA/1-192--------------------------------------------------------------------------------
O54530_9ZZZZ/1-186--------------------------------------------------------------------------------
O87277_9STAP/1-193--------------------------------------------------------------------------------
P71098_BACTI/20-220--------------------------------------------------------------------------------
O32791_9LACT/1-193--------------------------------------------------------------------------------
Q45448_BACIU/1-193--------------------------------------------------------------------------------
PRE_STRAG/1-194--------------------------------------------------------------------------------
PRE1_STAAU/1-198--------------------------------------------------------------------------------
PREA_BACTU/1-192--------------------------------------------------------------------------------
Q52058_9ZZZZ/3-190--------------------------------------------------------------------------------
Q09026_OENOE/1-199--------------------------------------------------------------------------------
Q53618_STAAU/1-198--------------------------------------------------------------------------------
Q48524_LACCA/1-194--------------------------------------------------------------------------------
O05418_CLOPF/6-219--------------------------------------------------------------------------------
Q52050_BUTFI/1-198--------------------------------------------------------------------------------
PREA_LACPN/1-194--------------------------------------------------------------------------------
P71520_MARHA/20-221--------------------------------------------------------------------------------
Q53620_STAAU/1-198--------------------------------------------------------------------------------

PF00799

REP_BGYMV/7-120--------------------------------------------------------------------------------
REP_PHUV/7-120--------------------------------------------------------------------------------
REPA_PASVK/17-125--------------------------------------------------------------------------------
REPA_MSVK/10-118--------------------------------------------------------------------------------
REPA_CSMV/34-142--------------------------------------------------------------------------------
REP_TLCVA/7-120--------------------------------------------------------------------------------
REPA_TYDVA/11-118--------------------------------------------------------------------------------
REPA_WDVS/9-127--------------------------------------------------------------------------------
REP_CLVK/6-119--------------------------------------------------------------------------------
REP_SLCV/8-122--------------------------------------------------------------------------------
REP_BCTVC/7-120--------------------------------------------------------------------------------

PF05840

VGA_BPG4/115-441...........LGNDHWNLLYEK...............PVYKHWYQLVSNRPLKDIRAD....YNYAKAKGVKDECS...
REPA_BPPHX/74-400...........EGDEKWFLENEK...............TVTQFCRKLAAERPLKDIRDE....YNYPKKKGIKDECS...
VGA_BPPHK/49-381...........LDPECVFLFEMICPGVRYGK.......TLNSLWSKYAAQWPEKLIRQE....LDMVKPLSFKDEVA...
Q8W759_9CAUD/122-510THLSASSDIMRMISDSWWLGRLVKVRKIMREHLAIAMGQVSNNASPYASWDCVREHQEQQQRNYEAIKNMVLFDEET.EE
VPA_BP186/139-507CEDEIAPAVMRMFNEVWWRGRLRRIAAAWREHLQIAVGNVSKKRHAYASKNCVTDWREQKRRTREFLKGLDLEDEEG..N
VPA_BPP2/133-515TTRQAYSAIARLFNDEWWTHQLKGQRMRWHETLLIAVGEVNKDRSPYASKHAIRDVRARRQANLEFLKSCDLENRET.GE
ENDP2_SALTI/193-568PYELIPPSLARMLCADWWYRKLWQMRCEWREEQLRAVCLVNKKASPYVSYEAVIHKREQRRKSLEFFRSHELINEDG..D
Q8XBG0_ECO57/179-564DTELLPGAILRLTCAEWWKRKLWLLRCEWREEQLRAACLVSRKTSPYLSQDALSEFRAQREKTRDFLKSFMLENEDG..F
P12_BPPM2/101-478LADKLEIAIRRMTCDKWWQRKLNRARDMTLEHLNITLGLVNKKKSPYASLQAVNEFKYAKKSQQKWLDSMQLESDDG.ET
REP_BPHP1/204-578KAEHIDSTLIRLTCEKWWFKQMRDIQKRMVEHIAIACGEVRANAASYISNQSFQEWQLQQRKNHDYLRAMIIENIDNPEE
O80256_9VIRU/150-506QSNELECLTSRAMCENWLRRQLRRRYFAEVEAVRDLL.LVSKNENPYCSAHGLEVMKSRKSATEQVLSNTVCYVEDNPET

PF02407

REP9_FBNY2/3-82--------------------------------------------------------------------------------
Q8AYY2_GOCV/9-96--------------------------------------------------------------------------------
REP7_FBNY2/6-83--------------------------------------------------------------------------------
Q7T7M5_9VIRU/6-94--------------------------------------------------------------------------------
REP_PCV2/14-100--------------------------------------------------------------------------------
Q66005_9VIRU/5-93--------------------------------------------------------------------------------
MREP_SCSVF/5-83--------------------------------------------------------------------------------
Q9NJY0_GIAIN/7-96--------------------------------------------------------------------------------
REP1_FBNY2/3-82--------------------------------------------------------------------------------
Q65378_BBTV/5-83--------------------------------------------------------------------------------
Q83026_BBTV/5-92--------------------------------------------------------------------------------
REP1_MDV1/6-84--------------------------------------------------------------------------------
REP_CACV/9-93--------------------------------------------------------------------------------
Q8QME8_9VIRU/5-87--------------------------------------------------------------------------------
REP6_SCSVF/6-86--------------------------------------------------------------------------------
REP3_MDV1/6-85--------------------------------------------------------------------------------
Q8QTK9_BBTV/3-90--------------------------------------------------------------------------------
Q91GA3_PICV/36-120--------------------------------------------------------------------------------
REP2_SCSVF/2-88--------------------------------------------------------------------------------

PF01446

O52769_STRPN/89-314--------------------------------------------------------------------------------
Q45447_BACIU/96-338--------------------------------------------------------------------------------
Q04140_9ZZZZ/8-257--------------------------------------------------------------------------------
P94343_PAEPP/119-370--------------------------------------------------------------------------------
Q52233_9ZZZZ/88-315--------------------------------------------------------------------------------
REP_LACHI/82-313--------------------------------------------------------------------------------
Q9Z9H4_LACPN/83-316--------------------------------------------------------------------------------
Q45962_CLOBU/94-350--------------------------------------------------------------------------------
Q55003_SELRU/109-342--------------------------------------------------------------------------------
O31146_ZYMMB/105-328--------------------------------------------------------------------------------
O33866_BACPU/97-340--------------------------------------------------------------------------------
P96459_STAAU/94-329--------------------------------------------------------------------------------
Q48548_LACFE/83-313--------------------------------------------------------------------------------
REP_BACSP/64-306--------------------------------------------------------------------------------
Q99135_9ZZZZ/88-313--------------------------------------------------------------------------------
Q9ZNC0_9PROT/105-304--------------------------------------------------------------------------------
Q51313_9NOSO/107-321--------------------------------------------------------------------------------
REP_LACPN/80-316--------------------------------------------------------------------------------
Q48836_LACRE/82-310--------------------------------------------------------------------------------
Q06460_9SYNC/106-332--------------------------------------------------------------------------------
Q48905_MICAE/1-247--------------------------------------------------------------------------------
O30850_STRTR/89-312--------------------------------------------------------------------------------
REPB_STAAU/1-233--------------------------------------------------------------------------------
Q01536_9ZZZZ/1-236--------------------------------------------------------------------------------
O87867_STASA/94-328--------------------------------------------------------------------------------

PF07232

Y35K_HALSI/1-316---------------------------------------------------------------------IVVENE.LGET
Y36K_HALSN/1-328---------------------------------------------------------------------MVVEEATTGER

PF02217

LT_POVBO/129-222--------------------------------------------------------------------------------
LT_POVMK/151-247--------------------------------------------------------------------------------
Q80FI2_9POLY/134-228--------------------------------------------------------------------------------
Q9DPC0_POVJC/137-230--------------------------------------------------------------------------------
LT_POVLY/200-298--------------------------------------------------------------------------------
Q20HY2_9POLY/139-233--------------------------------------------------------------------------------
Q9J7C9_SV40/136-229--------------------------------------------------------------------------------
Q20HX6_9POLY/120-214--------------------------------------------------------------------------------
LT_POVHA/261-354--------------------------------------------------------------------------------
Q9IBK8_BFPYV/111-204--------------------------------------------------------------------------------
LT_POVMC/285-377--------------------------------------------------------------------------------

PF03389

MOBA2_ECOLX/17-218-----------------------------EG....KYA---------------RDMD....E.V---LH-----------
MOBL_THIFE/17-244-----------------------------VEITDERTG---------------LVHDYTRKGGV---LH-----------
O87207_9LACT/17-239-----------------------------EKLYSEMEN---------------KTYFYNRSV..---MP-----------
Q9R6F0_RHIRD/17-243-----------------------------AKMDYEREA---------------RTIDYTRKVGL---LH-----------
TRAA_RHISN/17-243-----------------------------ARMDYEREA---------------RTIDYRAKQGL---LH-----------
Q52001_9ZZZZ/11-235-----------------------------EKLYSELYE---------------KTNLYNHRT.V---KP-----------
Q9ZA19_BIFLN/2-224-----------------------------GR.......---------------.....RSAS.S---MY-----------
TRAA_AGRT5/17-243-----------------------------AKMEYEREA---------------RTIDYTRKQGL---VH-----------
Q53632_STAAU/17-218-----------------------------SRIKDFKEN---------------EFKDYSNKQ.C---DY-----------

PF03432

Q9WW30_PEDPE/8-248-----------------------------EK...........................RAVLKD---GL-----------
RLX3_STAAU/8-236-----------------------------EK...........................RAEEKS---AL-----------
Q56424_BACFG/7-242-----------------------------LRE......................DKS.KLLEAV---GV-----------
VIRD2_RHIRD/16-264-----------------------------EYLSRKG.................KLELQRSARHL---DI-----------
Q45123_BACFG/7-242-----------------------------LAKEIN..................GQAVATEIARH---EL-----------
Q9ZIP2_FUSNU/13-276-----------------------------GSQNE...................KEKDDRVYKTT---GI-----------
TRAI6_ECOLX/12-252-----------------------------TDE.....Q...........G...KTERLGHVRVT---NC-----------
Q9R2J7_9ZZZZ/61-315-----------------------------KDG.....C...........E...WVNFYGVTCFH---NC-----------
Q9Z361_STAEP/8-242-----------------------------EK...........................RAVEKS---GL-----------
LTRB_LACLM/34-307-----------------------------SNPDKTMS............KQLVSGHGITNVYDA---AN-----------
Q9XAW2_PSEAC/12-285-----------------------------CERDHIDP...............ETGAVERRECST---ET-----------
Q51927_PASMD/14-247-----------------------------LN...........................KPDDTA---QI-----------
TRAI5_ECOLX/12-252-----------------------------TDA.....Q...........S...KDHRLGHVQAT---NC-----------
Q54883_STRPN/11-264-----------------------------LNPSKTKN............LTLVSDFGMRNYLDF---PS-----------
RLX1_STAAU/8-238-----------------------------EE...........................RAEEKS---GL-----------
RLX2_STAAU/8-239-----------------------------EK...........................RAEEKS---GL-----------
Q57087_9ZZZZ/9-280-----------------------------LGQDRPMHEKTEQWLQDHQLERPVELTNCRAVAVG---GT-----------

PF01076

65KD_ZYMMA/1-192-----------------------------KTVGTIKAA---------------SLHMTRGRET......-----------
O54530_9ZZZZ/1-186-----------------------------AKMGNVAAS---------------LKHAYRERET......-----------
O87277_9STAP/1-193-----------------------------K.SAGLKGM---------------QFHNQRERKSR...TN-----------
P71098_BACTI/20-220-----------------------------R.NSHIDQS---------------RSHENKYLVQK...DV-----------
O32791_9LACT/1-193-----------------------------K.SGNLVGV---------------GNHNQRNTDNH...SN-----------
Q45448_BACIU/1-193-----------------------------K.KDRLNGT---------------QKHNQREFQKS...KN-----------
PRE_STRAG/1-194-----------------------------K.AGNLGGA---------------FKHNERVFETH...SN-----------
PRE1_STAAU/1-198-----------------------------KGSSNTNGI---------------QRHNQRENKNY...NN-----------
PREA_BACTU/1-192-----------------------------Q.ISDVQGI---------------QKHNQRQGKSK...SN-----------
Q52058_9ZZZZ/3-190-----------------------------KSAIAVRRR---------------LKHNSRINQP......-----------
Q09026_OENOE/1-199-----------------------------K.KGNLSKL---------------ENHNSRRYLHD...NN-----------
Q53618_STAAU/1-198-----------------------------KSKTNTKGI---------------QKHVQRQNKNY...EN-----------
Q48524_LACCA/1-194-----------------------------K.ADNLVGL---------------GNHDQRRTQHH...KN-----------
O05418_CLOPF/6-219-----------------------------T.ASDVSKA---------------ERHNERKNETY...EN-----------
Q52050_BUTFI/1-198-----------------------------K.IQACGGI---------------QAENNRQADKQKDFKA-----------
PREA_LACPN/1-194-----------------------------K.ADNLVGI---------------GNHDQRKTTNH...SN-----------
P71520_MARHA/20-221-----------------------------R.NDHIDFS---------------KSDRNVYLVKN...DL-----------
Q53620_STAAU/1-198-----------------------------KSGTNTTGI---------------QKHVQRENNNY...EN-----------

PF00799

REP_BGYMV/7-120-------------------------------------------------------YFLTYPRCTIP--------------
REP_PHUV/7-120-------------------------------------------------------YFLTYPQCSIS--------------
REPA_PASVK/17-125-------------------------------------------------------TFLTYSKCPLE--------------
REPA_MSVK/10-118-------------------------------------------------------TFLTYPKCPEN--------------
REPA_CSMV/34-142-------------------------------------------------------VFLTYPRCPIS--------------
REP_TLCVA/7-120-------------------------------------------------------YFLTYPKCSLT--------------
REPA_TYDVA/11-118-------------------------------------------------------VFLTYPRCSSS--------------
REPA_WDVS/9-127-------------------------------------------------------LFLTYPECTLE--------------
REP_CLVK/6-119-------------------------------------------------------VFLTYPKCSIP--------------
REP_SLCV/8-122-------------------------------------------------------IFLTYPRCDVP--------------
REP_BCTVC/7-120-------------------------------------------------------IFLTYPQCSLS--------------

PF05840

VGA_BPG4/115-441.KILEESTMKS......RRGFTVQRLMNAMRTAHSKGW---------------YVVFDTLTLADDRLKDFYDN.......
REPA_BPPHX/74-400.RLLEASTMKS......RRGFAIQRLMNAMRQAHADGW---------------FIVFDTLTLADDRLEAFYDN.......
VGA_BPPHK/49-381.KYMEKMQEKT......RKNRMTQKVINEMRIAHQKGW---------------FFVFDTLTLADDRLQAFNEN.......
Q8W759_9CAUD/122-510EHDLWDMVKKSVSNPAIRRHELMVRCRGCEDIGNELGL---------------QGLFLTLT.TPSKYHNSYKKGGFIDH.
VPA_BP186/139-507RISLIEKYDGSVANPAIRRCELMARIRGFENICNELGY---------------VGEFYTLT.APSKYHATTKAGYRNSK.
VPA_BPP2/133-515RIDLISKVMGSISNPEIRRMELMNTIAGIERYAAAEGD---------------VGMFITLT.APSKYHPTRQVGKGESKT
ENDP2_SALTI/193-568TLDMEDVVNASNSNPAHRRNEMMACVKGLELIAEMRGD---------------CAVFYTIT.CPSRFHATLNNGRPNPK.
Q8XBG0_ECO57/179-564TIDLETVYYAGVSNPVHRKAEMMATMKGLELLAEARGD---------------KAVFLTVT.CPSKYHATTENGHPNPK.
P12_BPPM2/101-478TLDLAEVFKGSVSNPEIRRVELMVRIRGYEEYAQEQGM---------------KAVFYTIT.APSKYHANSKK.......
REP_BPHP1/204-578QVELFDMFLKSSSNPALRRNEMMVRLRGLEEWAEENNN---------------EALFLTLT.APSSFHA....GNGNKK.
O80256_9VIRU/150-506WFTLQELAAKSLSNPTIRRAEMFVRLKAFEDICKESGH---------------VAMFYTVT.APSRFHV.FKGDDINPK.

PF02407

REP9_FBNY2/3-82--------------------------------------------------------------------------------
Q8AYY2_GOCV/9-96--------------------------------------------------------------------------------
REP7_FBNY2/6-83--------------------------------------------------------------------------------
Q7T7M5_9VIRU/6-94--------------------------------------------------------------------------------
REP_PCV2/14-100--------------------------------------------------------------------------------
Q66005_9VIRU/5-93--------------------------------------------------------------------------------
MREP_SCSVF/5-83--------------------------------------------------------------------------------
Q9NJY0_GIAIN/7-96--------------------------------------------------------------------------------
REP1_FBNY2/3-82--------------------------------------------------------------------------------
Q65378_BBTV/5-83--------------------------------------------------------------------------------
Q83026_BBTV/5-92--------------------------------------------------------------------------------
REP1_MDV1/6-84--------------------------------------------------------------------------------
REP_CACV/9-93--------------------------------------------------------------------------------
Q8QME8_9VIRU/5-87--------------------------------------------------------------------------------
REP6_SCSVF/6-86--------------------------------------------------------------------------------
REP3_MDV1/6-85--------------------------------------------------------------------------------
Q8QTK9_BBTV/3-90--------------------------------------------------------------------------------
Q91GA3_PICV/36-120--------------------------------------------------------------------------------
REP2_SCSVF/2-88--------------------------------------------------------------------------------

PF01446

O52769_STRPN/89-314----------------------------DEAIKEQPKG---------------RFLFLTLTVKNVP..G-----------
Q45447_BACIU/96-338----------------------------EEANRQYGCG---------------.WIFLTLTVRNVE..G-----------
Q04140_9ZZZZ/8-257----------------------------EAVNQRENVQ---------------.WLFLTLTVRNTS..P-----------
P94343_PAEPP/119-370----------------------------HTAMESTNLR---------------.WVFLTLTVKNVS..G-----------
Q52233_9ZZZZ/88-315----------------------------EEAMIRKPKG---------------RFLFLTLTVENVS..G-----------
REP_LACHI/82-313----------------------------DEAHKQRKTG---------------RFLFLTLTAENAS..G-----------
Q9Z9H4_LACPN/83-316----------------------------AEAHRRHSTA---------------RFIFLTLTEENSVD.G-----------
Q45962_CLOBU/94-350----------------------------PQL..EQYKG---------------QLYHLTLTLPNCS..G-----------
Q55003_SELRU/109-342----------------------------.DAILAEKKA---------------RFIFVTLTVENVK..G-----------
O31146_ZYMMB/105-328----------------------------PAIIKEYPKA---------------RFLFLTLTVKNCH..I-----------
O33866_BACPU/97-340----------------------------EEANRQYKPA---------------.WIFLTLTVKNVE..G-----------
P96459_STAAU/94-329----------------------------EEVVKEKPTA---------------RWLFLTLSTKNAID.G-----------
Q48548_LACFE/83-313----------------------------DIAHVKNPNA---------------IYLFLTLTEENSE..I-----------
REP_BACSP/64-306----------------------------EEANRQYGCG---------------.WIFLTLTVRNVK..G-----------
Q99135_9ZZZZ/88-313----------------------------PKIVVDYPSS---------------RWLFLTLTVRNCE..I-----------
Q9ZNC0_9PROT/105-304----------------------------TASQSDLKPY---------------LVTLTVKNGPDLQERF-----------
Q51313_9NOSO/107-321----------------------------PQLLIDYPKA---------------RWLFVTLTVKNCA..I-----------
REP_LACPN/80-316----------------------------AEAVAREPKG---------------RFLFLTLTVKNAHS.A-----------
Q48836_LACRE/82-310----------------------------DTAYKKDPSA---------------IFLFLTLTEESSK..L-----------
Q06460_9SYNC/106-332----------------------------PQIVEAYPKH---------------RFIFLTLTVRNCE..L-----------
Q48905_MICAE/1-247----------------------------QKSVLTYPKA---------------RFIFLTLTVRNCP..L-----------
O30850_STRTR/89-312----------------------------DEAIKQEPKG---------------RFLFLTLTVKNIE..G-----------
REPB_STAAU/1-233----------------------------AEVIKQKPTV---------------RWLFLTLTVKNVYD.G-----------
Q01536_9ZZZZ/1-236----------------------------NEAMKRYPKG---------------RFLFLTLTIKNIS..G-----------
O87867_STASA/94-328----------------------------EAVIQEKPSA---------------RWLFLTLSNRNSVD.G-----------

PF07232

Y35K_HALSI/1-316VGFDMPNRFTPEYREMLYAKAQSLERGLRERWGSLLHT---------------GMVTLTASSTDDEGRL-----------
Y36K_HALSN/1-328VGFRTPNRFTPEYREMLYAKAQSLERGLREEWGDLLHT---------------AMVTLTASTTEEDGGP-----------

PF02217

LT_POVBO/129-222--------------------------------------------------------------------------------
LT_POVMK/151-247--------------------------------------------------------------------------------
Q80FI2_9POLY/134-228--------------------------------------------------------------------------------
Q9DPC0_POVJC/137-230--------------------------------------------------------------------------------
LT_POVLY/200-298--------------------------------------------------------------------------------
Q20HY2_9POLY/139-233--------------------------------------------------------------------------------
Q9J7C9_SV40/136-229--------------------------------------------------------------------------------
Q20HX6_9POLY/120-214--------------------------------------------------------------------------------
LT_POVHA/261-354--------------------------------------------------------------------------------
Q9IBK8_BFPYV/111-204--------------------------------------------------------------------------------
LT_POVMC/285-377--------------------------------------------------------------------------------

PF03389

MOBA2_ECOLX/17-218-------------AE....SGHMP.EF....VER.---------....PADYWD--------AA---DLYE.R-------
MOBL_THIFE/17-244-------------SELIL.PGGGT.......ADR.---------.....AEFWN--------GV---EAHHKR-------
O87207_9LACT/17-239-------------ESFILLPENAPEWA....KDR.---------.....QKLWN--------EV---EAVDRK-------
Q9R6F0_RHIRD/17-243-------------EEFLL.PDHAPKWVRMLIADRS---------VAGASEAFWN--------RV---EAFEKR-------
TRAA_RHISN/17-243-------------EEFVI.PAESPEWLRSMIADRS---------VASASEAFWN--------KV---EDFEKR-------
Q52001_9ZZZZ/11-235-------------EAFILKPDYVPNEF....LDR.---------.....QTLWN--------KM---ELAEKS-------
Q9ZA19_BIFLN/2-224-------------ARCC..PRARPAST....STR.---------.....SVCST--------PS---RWPRNV-------
TRAA_AGRT5/17-243-------------QEFIL.PADAPKWVRALIADCS---------VAGASEAFWN--------KV---EAFEKR-------
Q53632_STAAU/17-218-------------SEILL.PNNADDKF....KDR.---------.....EYLWN--------KV---HDVENR-------

PF03432

Q9WW30_PEDPE/8-248-------------N...LDVDYAKSQL----KQV---------------REVYG........NQ........G-------
RLX3_STAAU/8-236-------------N...CDIDYAKSSF----KAT---------------REMYG........KT........D-------
Q56424_BACFG/7-242-------------EG...TPEQMAEQF----ELQ---------------TLLND........KV.........-------
VIRD2_RHIRD/16-264-------------PVPPDQIRELAQSW----VTE---------------AGIYD........ESQS..DDDRQ-------
Q45123_BACFG/7-242-------------YG..CTGAEMVQEM----KPY---------------HIDFP........NVK.......N-------
Q9ZIP2_FUSNU/13-276-------------NVS.DDYKKAFKEM----MLT---------------KELHC........KL........D-------
TRAI6_ECOLX/12-252-------------EA..NTLPAVMAEV----MAT---------------QHGNT........RS........E-------
Q9R2J7_9ZZZZ/61-315-------------TS..LETAAADMEY----IAR---------------QAHYA........KD........D-------
Q9Z361_STAEP/8-242-------------N...CDVDYAKSSF----KAS---------------RELYG........KT........D-------
LTRB_LACLM/34-307-------------EF..IATKKLKALS----KGT---------------DFNFDPQTGKVRFNVES..LEKNN-------
Q9XAW2_PSEAC/12-285-------------NC..LDKDTAWREM----KAV---------------SDMNG........RV.........-------
Q51927_PASMD/14-247-------------L....QGDPRLSQS----IAD---------------SLDFN........NT.........-------
TRAI5_ECOLX/12-252-------------EA..GSIQDAITEV----LAT---------------QHTNT........RA........K-------
Q54883_STRPN/11-264-------------YK..ELVKMYNDNF----LSN---------------DTLYE........FRHDRQEVNQR-------
RLX1_STAAU/8-238-------------N...CDVDYAKSYF----KQT---------------RALYG........KE........N-------
RLX2_STAAU/8-239-------------N...CDVDYAKSAF----KQT---------------RALYG........KE........D-------
Q57087_9ZZZZ/9-280-------------NG..IDPFIAKEQF----DVI---------------RQLHN........QTK.......E-------

PF01076

65KD_ZYMMA/1-192-------------QNADPDRKELNEILKG...STD---------PSADVKSMLN--------KIQKETGKPLR-------
O54530_9ZZZZ/1-186-------------PNADASRTPENEHWAAS.STDE---------AMGRLRELLP--------EKR....RK..-------
O87277_9STAP/1-193-------------DDIDHERTRENYDLKND.KNID---------YNERVKEIIE--------SQKTGT.RKTR-------
P71098_BACTI/20-220-------------KDLYEKEFGEVLEKYNA.KQKR---------NDRKIDDYYK--------HIQ....SSKK-------
O32791_9LACT/1-193-------------KDIDVERSHLNYDLVN..RTEN---------YKRDIEQFIN--------DNKSSS.RAVR-------
Q45448_BACIU/1-193-------------ENIDRERTHLNYDLVNE.KPIS---------YSKAIHEKIE--------GRV..K.RKVR-------
PRE_STRAG/1-194-------------KDINPSRSHLNYELTDRDRSVS---------YEKQIKDYVN--------ENKVSN.RAIR-------
PRE1_STAAU/1-198-------------KDINHEETYKNYDLINA.QNIK---------YKDKIDETID--------ENYSGK.RKIR-------
PREA_BACTU/1-192-------------LDIDYSKSEQNYDLLNQ.QKIR---------YESTIKQEIS--------ERV..K.RKPR-------
Q52058_9ZZZZ/3-190-------------ENANPEKSNLNQYFNS......---------YDEALEIYKK--------QLP....EKVR-------
Q09026_OENOE/1-199-------------KNIRPELSKNNIQFIDH..KGT---------LTQDVKARTD--------QRLNNK.RAIR-------
Q53618_STAAU/1-198-------------MDIDLEKSYLNYDLVND.SPID---------YNQKIEEKIE--------QNYNGK.RKIR-------
Q48524_LACCA/1-194-------------PDIDVDRSALNYDLVAG.RTGH---------FKTDIEAYIN--------EHKTSQ.RAVR-------
O05418_CLOPF/6-219-------------MNVIEERIPYNVHFKKP.FAPT---------YMEQLKQMET--------DGMVSL.RGLR-------
Q52050_BUTFI/1-198-------------SDIDWDRTNENEFLIQS...MN---------LQQDIKKELK--------EHG...IDKWR-------
PREA_LACPN/1-194-------------EDIDVSRSHLNYDLVAG.RTDN---------FKTDIEAYIN--------ENKASK.RAVR-------
P71520_MARHA/20-221-------------RELYEREFGAAKDRYND.KQQR---------RDRKIDDYYK--------HVQ....QGKK-------
Q53620_STAAU/1-198-------------EDIDHSKTYLNYDLVNA.NKQN---------FNNLIDEKIE--------QNYTGK.RKIR-------

PF00799

REP_BGYMV/7-120-------------KE--EALSQLQKIH-----------------TTTNKK.FIK--------VCEERHDN----------
REP_PHUV/7-120-------------KE--ERLAQLQNLS-----------------TPVNKK.YIK--------ICKESHED----------
REPA_PASVK/17-125-------------PE--FIGEHLFRLT-----------------REYEPA.YIL--------VVRETHTD----------
REPA_MSVK/10-118-------------PE--IACQMIWELV-----------------VRWIPK.YIL--------CAREAHKD----------
REPA_CSMV/34-142-------------PE--EAGQKIADRL-----------------KNKKCN.YIY--------ISREFHAD----------
REP_TLCVA/7-120-------------KE--EALSQLNNLE-----------------TPTSKK.YIK--------VCRELHEN----------
REPA_TYDVA/11-118-------------AE--NLRDFLWDKL-----------------SRFAIF.FIA--------IATELHQD----------
REPA_WDVS/9-127-------------PQ--YALDSLRTLL-----------------NKYEPL.YIA--------AVRELHED----------
REP_CLVK/6-119-------------KE--HLLSFIQTLS-----------------LQSNPK.FIK--------ICRELHQN----------
REP_SLCV/8-122-------------KE--EVLEMLLHLS-----------------WSVVKPNYVR--------VAREEHSD----------
REP_BCTVC/7-120-------------KE--EALEQIQGIQ-----------------LSSNKK.YIK--------IARELHED----------

PF05840

VGA_BPG4/115-441.............PN..ALRDYFRDIGRMVLTAE.---------........GR--------SVHDSSSDCYQYFCVPEY
REPA_BPPHX/74-400.............PN..ALRDYFRDIGRMVLAAE.---------........GR--------KANDSHADCYQYFCVPEY
VGA_BPPHK/49-381.............PN..ALRDYFRTVGRAVLRAE.---------........GR--------SVKDSYNDCYRYLCVPEF
Q8W759_9CAUD/122-510......WNG.AS.PR..DAQAYLNKKW.QLIRAKL---------NRDEIRWFGV--------RVAEPHHD..........
VPA_BP186/139-507......WNG.AS.PS..DTQSYLTGLW.ARIRAKL---------HREEIRIFGI--------RVAEPHHD..........
VPA_BPP2/133-515VQLNHGWNDEAFNPK..DAQRYLCHIW.SLMRTAF---------KDNDLQVYGL--------RVVEPHHD..........
ENDP2_SALTI/193-568......WTS.AT.VR..QSSDYLVDTF.AAFRKAM---------HKAGLRWYGV--------RVAEPHHD..........
Q8XBG0_ECO57/179-564......WNG.AT.MR..DSSDYLVNTFFAAVRKKL---------NRDGLRWYGI--------RTVEPHHD..........
P12_BPPM2/101-478......YNN.AT.PK..ETQAFLVNQW.AKARAEL---------NKIDVPVFGV--------RVVEPHHD..........
REP_BPHP1/204-578......WLG.VN.PR..ETQNYLNKVW.QQFRALL---------SKRNIKFYGM--------RVAEPHKD..........
O80256_9VIRU/150-506......WLE.AGKPSAIDAHHHLMGVT.NAFRKAL---------DKAKIKIYGL--------RIVEPHHD..........

PF02407

REP9_FBNY2/3-82-------------E.......VPVLSF------------------DERVQYAVW--------QHERV...----------
Q8AYY2_GOCV/9-96-------------FE..DYCSVVEFCN------------------LDNCKFAIV--------GEEKGEKE----------
REP7_FBNY2/6-83-------------S.......IPEINW------------------TADVQYSIW--------QHERV...----------
Q7T7M5_9VIRU/6-94-------------AT..APD.LVPLFE------------------NTHVSYACW--------QEEESPTT----------
REP_PCV2/14-100-------------ED..E.RKKIREPP------------------ISLFDYFIV--------GEEGNEEG----------
Q66005_9VIRU/5-93-------------EE..EAANVVRRIE------------------SLNLVYAIV--------GDEVAPST----------
MREP_SCSVF/5-83-------------........LAPLSL------------------HESMKYLVY--------QTEAGDN.----------
Q9NJY0_GIAIN/7-96-------------REFDYSRWMERLYT------------------SGVVKFVCG--------QLEEGHET----------
REP1_FBNY2/3-82-------------A.......LPLLSF------------------DERVQYAVW--------QHERG...----------
Q65378_BBTV/5-83-------------........TTLPVM------------------RDEIKYMVY--------QVERGQE.----------
Q83026_BBTV/5-92-------------AA..ERENFLSLLK------------------EEDVHYAVV--------GDEVAPAT----------
REP1_MDV1/6-84-------------D.......APSLSF------------------NERVQYACW--------QHERV...----------
REP_CACV/9-93-------------AE..E.EAKVRALL------------------PGEFHFAIC--------GKERGEQ.----------
Q8QME8_9VIRU/5-87-------------........PPFLSL------------------PDGCSYLVY--------QREKCPQT----------
REP6_SCSVF/6-86-------------E.......IPILPF------------------NESVQYACW--------QHERV...----------
REP3_MDV1/6-85-------------E.......IPILPF------------------NERVQYACW--------QHERV...----------
Q8QTK9_BBTV/3-90-------------AT..ERGKFLATLK------------------EEDVHYAVV--------GDETAPNT----------
Q91GA3_PICV/36-120-------------EE..E.IKSLETWL------------------VSDFHYAIV--------GKEVGEQ.----------
REP2_SCSVF/2-88-------------EI..ERETFLSLFS------------------QDELNYFVV--------GDETATT.----------

PF01446

O52769_STRPN/89-314-------------KELNATISQLTQSFDRLFRRAK.........VKKNLIGFLR--------SVEVTHNQ.EE-------
Q45447_BACIU/96-338-------------DGLKPMIADMMKGWNRLFGYKR.........VKVATLGYFR--------ALEITKNH.EE-------
Q04140_9ZZZZ/8-257-------------ESLPETISAMFEGFNRLTKYKA.........FKTSVKGYFR--------ALEVTKNR.DP-------
P94343_PAEPP/119-370-------------DKLSDEMDHLTKSFRRLFQRKR.........FKKTVLGFFR--------GLEVTYNK.DK-------
Q52233_9ZZZZ/88-315-------------EGLNNELSLLSEAFNRLMKYKK.........VSKNILGFLR--------ATEVTINE.SM-------
REP_LACHI/82-313-------------ENLKQEVRKMGRAISKLFQYKK.........PAKNLLGYVR--------STEITIN..KN-------
Q9Z9H4_LACPN/83-316-------------VDLKRRLKALTHAFFKLVHYKK.........VSKNLLGFVR--------STEITTN..AN-------
Q45962_CLOBU/94-350-------------NDLRLTIKHMSKCFLRLVQFLDGRKKIRGINFGQAFQGAIR--------SLEVTFKN..D-------
Q55003_SELRU/109-342-------------EELRATIKRMNEGFKCLVQDKKGMAASA..TFRANLMGYMK--------AIEVTYNT.KR-------
O31146_ZYMMB/105-328-------------EDLSDTLRIMNSGWQRLKDRKEFK..........SVLGWIR--------STEVTKGK..D-------
O33866_BACPU/97-340-------------DDLKQTISDMMKGFNRLMKYKK.........VDSSVLGYFR--------ALEITKNH.EQ-------
P96459_STAAU/94-329-------------DHLEQSLKHMSKAFNKLKMYTK.........VKKNLVGFLR--------STEVTVNK.ND-------
Q48548_LACFE/83-313-------------GELKINLKNMNSSVRRLIQYKK.........VAKNMIGYVR--------SSEITVNR.DN-------
REP_BACSP/64-306-------------ERLKPQISEMMEGFRKLFQYKK.........VKTSVLGFFR--------ALEITKNH.EE-------
Q99135_9ZZZZ/88-313-------------GELGTVLTAMNAAFKRMEKRKELS..........PVQGWIR--------ATEVTRGK..D-------
Q9ZNC0_9PROT/105-304-------------VHLRKAMRSMFKSRRNTNQGQR......FVEFSKSEGGFHS--------.IEVTNRG..N-------
Q51313_9NOSO/107-321-------------TDLRETLTWMNKSFKRFSELKAF...........PAEGYIK--------TVEVTRGKTPD-------
REP_LACPN/80-316-------------EELKVSLRALTKAFNKLTRYKK.........VTKNLLGYLR--------STEITVNE.QD-------
Q48836_LACRE/82-310-------------GELRKNLTSMNRSIYRLFQYKD.........VKKDLLGYVR--------STEITVNR.DS-------
Q06460_9SYNC/106-332-------------GQLRETITGMNQAWGRLVKRAKW...........PADGWIR--------SLEVTRGK..D-------
Q48905_MICAE/1-247-------------EDLRETIAWMNASWLKMIKRKNF...........PALGWIK--------CIEVTPGE..T-------
O30850_STRTR/89-312-------------KALNSTISQLTKSFDRLFKRAK.........VQRNLLGYLR--------SVEVTHNE.ND-------
REPB_STAAU/1-233-------------EELNKSLSDMAQGFRRMMQYKK.........INKNLVGFMR--------ATEVTINN.KD-------
Q01536_9ZZZZ/1-236-------------EKLNKSISEIGRAFNRLMKYKK.........VDKNVIGYLR--------ATEVTYST.EH-------
O87867_STASA/94-328-------------ETLEKSLKQMNIAFNRMFKYKK.........VSKNLIGFMR--------ATEVTVNE.KD-------

PF07232

Y35K_HALSI/1-316-------------RPPLEHFEDLLESWEAVRRALAR--------VLEGREWEYL--------AILEPHE......S----
Y36K_HALSN/1-328-------------RPLVDHLRDLLSSWSAVYDALRH--------TLEDREFEYL--------AIIEPTTPAGNGPA----

PF02217

LT_POVBO/129-222-------------KEYVSNALFTNRTY--------------------NCFIIFT--------TAEKGKEL----------
LT_POVMK/151-247-------------MEYLSCAILSNKTL--------------------PCFLIYT--------TLEKVELL----------
Q80FI2_9POLY/134-228-------------ESCLLAKKSIQSCP--------------------EVHLLIT--------SNSKLQEL----------
Q9DPC0_POVJC/137-230-------------HAFLSQAVFSNKTV--------------------ASFAVYT--------TKEKAQIL----------
LT_POVLY/200-298-------------YSFLSHAIYSNKTM--------------------NSFLIYT--------TLEKARQL----------
Q20HY2_9POLY/139-233-------------EACLLAAKSIQSCP--------------------EGHLVVT--------THQKLQEL----------
Q9J7C9_SV40/136-229-------------LSFLSHAVFSNRTL--------------------ACFAIYT--------TKEKAALL----------
Q20HX6_9POLY/120-214-------------EACLLTAKSVQSCP--------------------DAHLIIT--------TCNKLQNL----------
LT_POVHA/261-354-------------RGFLSHAIFSNKTQ--------------------NAFIIYS--------TKEKCEVL----------
Q9IBK8_BFPYV/111-204-------------EAYLLTPRSVQSCP--------------------DCHLLIT--------SITKMPQL----------
LT_POVMC/285-377-------------TGYLSHAIYSNKTF--------------------PAFLVYS--------TKEKCKQL----------

PF03389

MOBA2_ECOLX/17-218----A-------NGRLFKEVEFALPVEL--TL------DQQKALASEFAQHLTGAERLPYTLAIHA..............
MOBL_THIFE/17-244----G-------DAVLVREIEISLPTEL--TA------EQRKALAVGYARALADRYGVAADVALHAPRTVTDRELEKHPD
O87207_9LACT/17-239----V-------NSRYAKEFNVALPIEL--SE------DEQKELLTEYVQKIFVDKGMVADVAIHR..............
Q9R6F0_RHIRD/17-243----I-------DAQLAKDLTVALPLEL--TA------EQNIALVRDFVEKHILSRGMVADWVYH...............
TRAA_RHISN/17-243----S-------DAQLAKDVTIALPIEL--TT------EQNIVLVRDFVERHVTAKGMVADWVYH...............
Q52001_9ZZZZ/11-235----P-------NAQLCREVNVALPIEL--NN------SDQRMLIEDFVKDNFVNEGMIADVAIHR..............
Q9ZA19_BIFLN/2-224----P-------TRGPRRRSWSPCPASS--TP------ANAFRALEDFISWNITANGYACTYAIHT..............
TRAA_AGRT5/17-243----S-------DAQLARDLTIALPREL--TS------EQNIALVRDFVEKHILGKGMVADWVYH...............
Q53632_STAAU/17-218----K-------NSQVAREIIIGLPNEF--DP------NSNIELAKEFAES.LSNEGMIVDLNIHK..............

PF03432

Q9WW30_PEDPE/8-248----K-------TQAYASRISFSPKE.L--DPTNENDQQKALEIAKEVYQK-TYP.NQQVALYEHA--------------
RLX3_STAAU/8-236----G-------NEGHVVIQSFKPNE.V--TP......EQCNQLGLELAEK-IAP.NHQVAVYTHN--------------
Q56424_BACFG/7-242----K-------NTVGHTSLNFSPED..--GERLKTDDALMLQIAHDYMAK-MGIENTQYIVARHT--------------
VIRD2_RHIRD/16-264----Q-------DLTTHIIVSFPAGTDQ--TA...AYEASREWAAEMFGSG-YGGGRYNYLTAYHV--------------
Q45123_BACFG/7-242----N-------CLRFEVSPSIEESATF--TD......ADWAELGNDFMQR-MGLANHQYIIIRHS--------------
Q9ZIP2_FUSNU/13-276----G-------RQYRHHIQSFKPGE.V--DE......ETAHKMAVEFAEK-NFK.GFDVFISTHI--------------
TRAI6_ECOLX/12-252----A-------DKTYHLLVSFRAGE..--KP..DA..ETLRAIEDRICAG-LGFAEHQRVSAVHH--------------
Q9R2J7_9ZZZZ/61-315----T-------DPVFHYILSWQSHE..--SP..RP..EQIYDSVRHTLKS-LGLADHQYVSAVHT--------------
Q9Z361_STAEP/8-242----G-------NQGHVIIQSFKPGE.V--TP......EQCNQLGLALAEK-LAP.NHQVAVYTHA--------------
LTRB_LACLM/34-307----A-------VLGHHLIQSFSPDDNL--TP......EQIHEIGRQTILE-FTGGEYEFVIATHV--------------
Q9XAW2_PSEAC/12-285----K-------DPVYHFTVSWPAHEKP--TD......AQVFEAGREGMKS-LGMEGHQYLAAVHR--------------
Q51927_PASMD/14-247----Y-------TAGCLSFEESDLPEIQ--KR......EIMARFEKAMFAG-LEPEQYNIAWVQHT--------------
TRAI5_ECOLX/12-252----G-------DKTYHLIVSFRAGE..--QP..SA..DTLRAIEERICVG-LGYGEHQRISAVHN--------------
Q54883_STRPN/11-264----K-------IHSHHIIQSFSPDDHL--TP......EQINRIGYEAAKE-LTGGRFRFIVATHV--------------
RLX1_STAAU/8-238----G-------VQAHTVIQSFKPGE.V--TA......KECNEIGLELAKK-IAP.DYQVAVYTHT--------------
RLX2_STAAU/8-239----G-------IQAHTVIQSFKPGE.V--TP......EQCNQLGLELAEK-IAP.NHQVAVYTHT--------------
Q57087_9ZZZZ/9-280----S-------NQVLRITQSFALDE.L--NPKVQKDWQKANDLGVELAEN-LYP.NHQSAVYTHL--------------

PF01076

65KD_ZYMMA/1-192----K-------NGVQAIELFFGMSPEWS.KQATPEKLEHWKTITQQWAEQTFGE.NNLVSLQLHA--------------
O54530_9ZZZZ/1-186----.-------DAVLAVEYVMTASPEWW.KSASQEQQAAFFEKAHKWLADKYGA.DRIVTASIHR--------------
O87277_9STAP/1-193----K-------DAVLVNELLVTSDRDFF.EQLDPGEQKRFFEESYKLFSERYGK.QNIAYATVHN--------------
P71098_BACTI/20-220----T-------SLQQEMIVQVGDMKDFN.YRADYEKANEILLDWFKDFEKRNPN.LKVYNAVIHN--------------
O32791_9LACT/1-193----K-------DAVLINEWIITSDNPFF.KDKDDKEIKDFFDTAKSYFADKFGD.NNIRYAQVHL--------------
Q45448_BACIU/1-193----A-------DAVLVSEFLITASPDYM.NGLSDEEQRRYFETAVDHLKEKYSA.ENMLYATVHM--------------
PRE_STRAG/1-194----K-------DAVLCDEWIITSDKDFF.EKLDEEQTRTFFETAKNYFAENYGE.SNIAYASVHL--------------
PRE1_STAAU/1-198----S-------DAIRHVDGLVTSDKDFF.DDLSGEEIERFFKDSLEFLENEYGK.ENMLYATVHL--------------
PREA_BACTU/1-192----A-------NSVVLSEFVVTASPDYM.HSLSLEEQKRYFESSLDFIQKRYGK.QNTLYAMVHM--------------
Q52058_9ZZZZ/3-190----K-------NAVHAVEILITASPEIL.SKMTFQEQKNYFNQSLAWAENQLGGREILLSACIHR--------------
Q09026_OENOE/1-199----S-------DANLISEIVVGADDKYF.QTLTDQKKIDFGRTATKLIQERYGK.ENVLRSYLHL--------------
Q53618_STAAU/1-198----K-------DAVKHIDGLITSGNEFS.KNQTLEETKQFFEHAKTFLEQEYGK.DNLLYATVHM--------------
Q48524_LACCA/1-194----K-------DAVLVNEWIISSDSHFF.ADLTAADMRKYFETAKDYFAEKFGE.ENIRYAIVHL--------------
O05418_CLOPF/6-219----K-------DATLFNEIVIDVNTMYFERNGGYEYAKQFYEEAFHFIEEKFGA.DNVISAVMHA--------------
Q52050_BUTFI/1-198----K-------DAVVCIDGLYTASPEFF.EGKTKEECMEYFKDCLEYHEKTYG...VTINAVIHF--------------
PREA_LACPN/1-194----K-------DAVLVNEWIITSDKDFF.EQLDEAETRKYFETAKQYFADNYGD.ENIRYAVVHM--------------
P71520_MARHA/20-221----T-------RPQQEMIVQIGEQDQFQDNEPNREMAKEVLQEWFQEFQQRNPQ.LKMYNAVIHD--------------
Q53620_STAAU/1-198----T-------DAIKHIDGLITSDNDFF.DNQTPEDTKQFFEYAKEFLEQEYGK.DNLLYATVHM--------------

PF00799

REP_BGYMV/7-120----G-------EPHLHALIQFEG--------------K-FICTNKRLF-----------DLVSTTR.------------
REP_PHUV/7-120----G-------QPHLHVLIQFEG--------------K-YQCTNNRFF-----------DLVSSTR.------------
REPA_PASVK/17-125----G-------TWHCHALLQCIK--------------P-CTTRDERYF-----------DIDR....------------
REPA_MSVK/10-118----G-------SLHLHALLQTEK--------------P-VRISDSRFF-----------DING....------------
REPA_CSMV/34-142----G-------EPHLHAFVQLEA--------------N-FRTTSPKYF-----------DLDE....------------
REP_TLCVA/7-120----G-------EPHLHVLIQFEG--------------K-FQCKNQRFF-----------DLVSPTR.------------
REPA_TYDVA/11-118----G-------TPHLHCLIQLDK--------------R-SNIRDPSFF-----------DLEG....------------
REPA_WDVS/9-127----G-------SPHLHVLVQNKL--------------R-ASITNPNAL-----------NLRMDTSP------------
REP_CLVK/6-119----G-------EPHLHALIQFEG--------------K-ITITNNRLF-----------DCVHPSC.------------
REP_SLCV/8-122----G-------SPHLHCLIQLSG--------------K-SNIKDAGFF-----------DLTHPRR.------------
REP_BCTVC/7-120----G-------QPHLHVLLQLEG--------------K-VQITNIRLF-----------DLVSPTR.------------

PF05840

VGA_BPG4/115-441GTQHG-------RLHFHAVHLMRTLPLGSLDPNFGKLVR-INRQINSLQNTWPYGYSMPIAVRYSQDAFSRAGWL.....
REPA_BPPHX/74-400GTANG-------RLHFHAVHFMRTLPTGSVDPNFGRRVR-NRRQLNSLQNTWPYGYSMPIAVRYTQDAFSRSGWL.....
VGA_BPPHK/49-381GGQHG-------RLHWHVVHMVRTLPLGSHDPNFGRPVR-NYRQINSFRGMWPYGFTQPIAVRYQHDAYSRKGWL.....
Q8W759_9CAUD/122-510....G-------TPHWHLLIWVRK..............E-DISAVRDTFITY........ATEEDRGELHPEFEKEKQKP
VPA_BP186/139-507....G-------TPHWHMLMFMLP..............E-DVERVRLIIRDY........AWEEDHYELRSDKAK.....
VPA_BPP2/133-515....G-------TPHWHMMLFCNP..............R-QRNQIIEIMRRY........ALKEDGDE...RGAA.....
ENDP2_SALTI/193-568....G-------TVHWHLLCFMRK..............K-DRRSITALLRKF........AIREDREELGANT.......
Q8XBG0_ECO57/179-564....G-------TVHWHMMVFAHP..............E-EIDTIVSHTRDI........AIQEDRHELGDDI.......
P12_BPPM2/101-478....A-------TPHWHMLLFMLP..............E-HEQVTTKALRGY........AMQIDGDE...KGAE.....
REP_BPHP1/204-578....G-------TPHWHALAYVPA..............E-HKEEVIRLFKQK........ALELDGNE...KGAA.....
O80256_9VIRU/150-506....G-------TPHNHFLFFMLP..............E-HESVVTRILGDC........ALSDSPNE...SGAK.....

PF02407

REP9_FBNY2/3-82----N-------HDHIQGVIQLKK--------------K.AKMNTVKNI-------------------------------
Q8AYY2_GOCV/9-96----G-------TPHLQGFLSLRK--------------N.AKAAALEEK-------------------------------
REP7_FBNY2/6-83----G-------HDHLQGYIQMKK--------------H.VSLKKMKEL-------------------------------
Q7T7M5_9VIRU/6-94----R-------RRHLQGYLQLKG--------------Q.RTLNQVKAI-------------------------------
REP_PCV2/14-100----R-------TPHLQGFANFVK--------------K.QTFNKVKWY-------------------------------
Q66005_9VIRU/5-93----G-------QRHLQGFIHLKT--------------G.RRLQGLKTV-------------------------------
MREP_SCSVF/5-83----G-------TIHYQGYVEMKK--------------R.TSLVQMKKL-------------------------------
Q9NJY0_GIAIN/7-96----G-------NLHLQYMVQLDR--------------S.RRLAHLRTA-------------------------------
REP1_FBNY2/3-82----T-------HDHIQGVIQLKK--------------K.ARFSTVKEI-------------------------------
Q65378_BBTV/5-83----G-------TRHVQGYVEMKR--------------R.SSLKQMRGF-------------------------------
Q83026_BBTV/5-92----G-------QKHLQGYLSLKK--------------R.IRLGGLKKK-------------------------------
REP1_MDV1/6-84----S-------HDHLQGYIQMKK--------------R.STLKMMKEL-------------------------------
REP_CACV/9-93----G-------TPHLQGFLHFKK--------------K.QRLSALKKL-------------------------------
Q8QME8_9VIRU/5-87----D-------KEHWQGFITFVG--------------Q.KRLNTVKSL-------------------------------
REP6_SCSVF/6-86----G-------HDHLQGFIQFKS--------------RNTTLRQAKYI-------------------------------
REP3_MDV1/6-85----G-------HDHLQGFIQMKA--------------Q.QSLGQMKAI-------------------------------
Q8QTK9_BBTV/3-90----G-------RKHLQGYLSLKK--------------R.FRISGIKKK-------------------------------
Q91GA3_PICV/36-120----G-------TPHLQGFVHLKQ--------------K.KRLTQLKQL-------------------------------
REP2_SCSVF/2-88----G-------QKHLQGFVSFKN--------------K.IRLGGLKKK-------------------------------

PF01446

O52769_STRPN/89-314----E.....TYHPHIHVLMMVKSSYFSG...AGDNYVS-QEEWGRMWEQSL........KVDY----------------
Q45447_BACIU/96-338----D.....TYHPHFHVLLPVKKSYFT......HNYIK-QSEWTSLWKRAM........KLDY----------------
Q04140_9ZZZZ/8-257----HSEWFGTYHPHFHVLLCVPSSYFKK...K.ELYIT-EQEWTDLWKKAM........KLDY----------------
P94343_PAEPP/119-370----D.....TYHPHYHVLLAVTPDYFT......RNYIK-KSEWSELWRDAA........RLDY----------------
Q52233_9ZZZZ/88-315----D.....TYHPHIHVLLFISPTYFK....NKNNYIS-QDEWTELWKKSA........KLDY----------------
REP_LACHI/82-313----G.....TYHQHMHVLLFVKPTYFK....DSANYIN-QAEWSKLWQRAM........KLDY----------------
Q9Z9H4_LACPN/83-316----G.....SYHQHLHVLLFVKSAYFK....GTGNYLS-QVDWTNLWQKAL........KSSY----------------
Q45962_CLOBU/94-350----N......YHPHYHVALVLNNFKMTDKKYKNKYSYN-NKHGIKELTRLFSAEEILIQKIWY----------------
Q55003_SELRU/109-342----N.....DFHPHIHCIFELAPKYFRG...KEGGYLT-HEDWRVMWRSVM........KLDY----------------
O31146_ZYMMB/105-328----G.....SAHPHFHILLMVPPSWFT......HSYVK-KSRWAELWAYCA........RLDY----------------
O33866_BACPU/97-340----N.....TYHPHFHVLIPVKRSYFTG.....KSYIK-QAEWTSLWKRAM........KLDY----------------
P96459_STAAU/94-329----G.....SYNQHMHVLLCVENAYFR....KKENYIT-QTEWVDLWKKAL........QVDY----------------
Q48548_LACFE/83-313----Y.....TFHQHMHLLLLMKTSYFN.....SKNYLT-KDDWIKLWRRAR........KLDY----------------
REP_BACSP/64-306----D.....TYHPHFHVLIPVRKNYFG......KNYIK-QAEWTSLWKKAM........KLDY----------------
Q99135_9ZZZZ/88-313----G.....SAHPHFHCLLMVQPSWFKG.....KNYVK-HERWVELWRDCL........RVNY----------------
Q9ZNC0_9PROT/105-304----G......WHPHVHMIWLCREKPDQ........SAL-SAEWREITGDSH........VVDV----------------
Q51313_9NOSO/107-321----G.....SAHPHFHVLMMVKPSYFG......VGYLS-QAKWVEMWRKSL........RVDY----------------
REP_LACPN/80-316----G.....SYNQHLHVLLFVKSSYFK....NSNNYLA-QAEWAKLWQKAL........KVDY----------------
Q48836_LACRE/82-310----L.....TFHQHVHILLMVKSSYFS.....KGHYLT-QENWSQLWKRAR........KLDY----------------
Q06460_9SYNC/106-332----G.....SAHPHFHCLLMVKASYFS......HGYIS-QEVWTKLWEESL........RINY----------------
Q48905_MICAE/1-247----D.....FAHPHFHCLLMVNSNYFT......INYIS-QANWTKMWKECL........KVDY----------------
O30850_STRTR/89-312----N.....SYHPHIHVLMMMRPSYFKG...G..NYIS-QKEWGNLWSQSL........KVSY----------------
REPB_STAAU/1-233----N.....SYNQHMHVLVCVEPTYFK....NTENYVN-QKQWIQFWKKAM........KLDY----------------
Q01536_9ZZZZ/1-236----E.....NYHPHLHVLLFVKSSYFTG...NNTNYIS-QEEWTKLWAKAM........KLDY----------------
O87867_STASA/94-328----G.....SYNQHMHVLMCVESKYFR....GSDNYIS-QDEWLELWQKAL........KVDY----------------

PF07232

Y35K_HALSI/1-316----G-------YVHIHLGVFVRGPVVA----------EQFEPVLDAHLRNCPTAGEDAHQ.VFDENGDEDAV-------
Y36K_HALSN/1-328----G-------YAHIHLGVFVKGPVVA----------EQFQDVLDAHVKNSEGAGREAHRAVVEDDEDEAAV-------

PF02217

LT_POVBO/129-222------------YPCIQ.....AAYKCT------------FIAL.YMYNGDS----------------------------
LT_POVMK/151-247------------YNKLS....EEVLSPR------------FNQVDHKYGRKY----------------------------
Q80FI2_9POLY/134-228------------QPLIL.....QHFSTK------------GYVT.AQWAGGY----------------------------
Q9DPC0_POVJC/137-230------------YKKLM.....EKYSVT------------FISR.HGFGGHN----------------------------
LT_POVLY/200-298------------YKTVEKSKIVVDFKAS------------FSYQ.DEEGEGC----------------------------
Q20HY2_9POLY/139-233------------QSSLL.....NHFDTA------------GHLV.CKWGTDF----------------------------
Q9J7C9_SV40/136-229------------YKKIM.....EKYSVT------------FISR.HNSYNHN----------------------------
Q20HX6_9POLY/120-214------------RPQLM.....TNFTTR------------GHIQ.AVWDSSY----------------------------
LT_POVHA/261-354------------YEQI......DKYNPD------------YKGI.FIMKQTE----------------------------
Q9IBK8_BFPYV/111-204------------KAHLY.....EHFGIK------------GHML.AHWTGIA----------------------------
LT_POVMC/285-377------------YDTI......GKFRPE------------FKCL.VHYEEGG----------------------------

PF03389

MOBA2_ECOLX/17-218............GG--GE-----------NPHCHLM-------ISER---------------------------------
MOBL_THIFE/17-244QYHETDPKTGRRHN--.G-----------NWHAHIL-------LSAC---------------------------------
O87207_9LACT/17-239...........DHD--.E-----------NPHAHVM-------LTNR---------------------------------
Q9R6F0_RHIRD/17-243...........DNP--.G-----------NPHIHLM-------TTLR---------------------------------
TRAA_RHISN/17-243...........DAP--.G-----------NPHVHLM-------TTLR---------------------------------
Q52001_9ZZZZ/11-235...........DDE--.N-----------NPHAHIM-------LTMR---------------------------------
Q9ZA19_BIFLN/2-224...........DKD--GR-----------NPHAHIL-------VANR---------------------------------
TRAA_AGRT5/17-243...........DNP--.G-----------NPHIHLM-------TTLR---------------------------------
Q53632_STAAU/17-218...........INE--.E-----------NPHAHLL-------CTLR---------------------------------

PF03432

Q9WW30_PEDPE/8-248-----------D....TN-----------ALHVHAV-------IGAI---------------------------------
RLX3_STAAU/8-236-----------D....TD-----------HVHNHIV-------INSI---------------------------------
Q56424_BACFG/7-242-----------D....RE-----------HPHCHIV-------FNRV---------------------------------
VIRD2_RHIRD/16-264-----------D....RD-----------HPHLHVV-------VNRR---------------------------------
Q45123_BACFG/7-242-----------GTESKKE-----------QAHLHIL-------ANRV---------------------------------
Q9ZIP2_FUSNU/13-276-----------D....KG-----------HIHNHII-------INTV---------------------------------
TRAI6_ECOLX/12-252-----------D....TD-----------NLHIHIA-------INKI---------------------------------
Q9R2J7_9ZZZZ/61-315-----------D....TD-----------NLHVHVA-------VNRV---------------------------------
Q9Z361_STAEP/8-242-----------D....TD-----------HVHNHIV-------MNSI---------------------------------
LTRB_LACLM/34-307-----------D....RE-----------HIHNHII-------FNST---------------------------------
Q9XAW2_PSEAC/12-285-----------D....TD-----------NVHGHFM-------VNRV---------------------------------
Q51927_PASMD/14-247-----------D....KG-----------RLELNFV-------IPNV---------------------------------
TRAI5_ECOLX/12-252-----------D....TD-----------NLHIHIA-------INKI---------------------------------
Q54883_STRPN/11-264-----------D....KG-----------HIHNHII-------LNSI---------------------------------
RLX1_STAAU/8-238-----------D....KD-----------HYHNHII-------INSV---------------------------------
RLX2_STAAU/8-239-----------D....KD-----------HYHNHIV-------INSV---------------------------------
Q57087_9ZZZZ/9-280-----------DG..KNH-----------VLHNHII-------VNKV---------------------------------

PF01076

65KD_ZYMMA/1-192-----------D----ET...........TPHLTGF.......MVPR---------------------------------
O54530_9ZZZZ/1-186-----------D----ET...........SPHMTAF.......VVPL---------------------------------
O87277_9STAP/1-193-----------D----EQ...........TPHMHLG.......VVPM---------------------------------
P71098_BACTI/20-220-----------D----EA...........SPHMHLNFVPVASGYKRG---------------------------------
O32791_9LACT/1-193-----------D----ET...........TPHMHLG.......IVPF---------------------------------
Q45448_BACIU/1-193-----------D----EA...........TPHMHVG.......IVPI---------------------------------
PRE_STRAG/1-194-----------D----ES...........TPHMHMG.......VVPF---------------------------------
PRE1_STAAU/1-198-----------D----ER...........VPHMHFG.......FVPL---------------------------------
PREA_BACTU/1-192-----------D----EA...........TPHMHIG.......VMPI---------------------------------
Q52058_9ZZZZ/3-190-----------D----EA...........TPHLHMI.......FMPL---------------------------------
Q09026_OENOE/1-199-----------D----EVD.........DNGIQHPGLH...VDLVPM---------------------------------
Q53618_STAAU/1-198-----------D----EK...........TPHMHYG.......VVPI---------------------------------
Q48524_LACCA/1-194-----------D----ES...........TPHMHMG.......IVPF---------------------------------
O05418_CLOPF/6-219-----------D----EINVAATEELGKEVYHYHLHA.....MVLPV---------------------------------
Q52050_BUTFI/1-198-----------D----EA...........TPHMHCQS....VPLVER---------------------------------
PREA_LACPN/1-194-----------D----EK...........TPHMHMG.......IVPF---------------------------------
P71520_MARHA/20-221-----------D----EA...........SPHMHMNFVPVATGYKKG---------------------------------
Q53620_STAAU/1-198-----------D----EK...........TPHMHYG.......VVPI---------------------------------

PF00799

REP_BGYMV/7-120----------------SA-----------HFHPNIQ-------GAKS---------------------------------
REP_PHUV/7-120----------------SA-----------HFHPNIQ-------GAKS---------------------------------
REPA_PASVK/17-125----------------..-----------.YHGNIQ-------SAKS---------------------------------
REPA_MSVK/10-118----------------..-----------.FHPNIQ-------SAKS---------------------------------
REPA_CSMV/34-142----------------..-----------.FHPNIQ-------AARQ---------------------------------
REP_TLCVA/7-120----------------SA-----------HFHPNIQ-------GAKS---------------------------------
REPA_TYDVA/11-118----------------..-----------.NHPNIQ-------PAKN---------------------------------
REPA_WDVS/9-127----------------FS-----------IFHPNIQ-------AAKD---------------------------------
REP_CLVK/6-119----------------ST-----------SFHPNIQ-------GAKS---------------------------------
REP_SLCV/8-122----------------SA-----------RFHPNIQ-------AAKD---------------------------------
REP_BCTVC/7-120----------------SA-----------HFHPNIQ-------GAKS---------------------------------

PF05840

VGA_BPG4/115-441...........W----PV-----------DSKGEPL-------KATS---------------------------------
REPA_BPPHX/74-400...........W----PV-----------DAKGEPL-------KATS---------------------------------
VGA_BPPHK/49-381...........W----PV-----------DKSGKAM-------QSKP---------------------------------
Q8W759_9CAUD/122-510FRKGVYVGPLDY----RP-----------RCDFGYI-------DPTK---------------------------------
VPA_BP186/139-507............----KA-----------RFHAEAI-------DPEK---------------------------------
VPA_BPP2/133-515............----RN-----------RFQAKHL-------N..Q---------------------------------
ENDP2_SALTI/193-568............----GP-----------RFKPELI-------NPRK---------------------------------
Q8XBG0_ECO57/179-564............----TP-----------RFKAEYV-------DGSK---------------------------------
P12_BPPM2/101-478............----QA-----------RFTAENI-------DPSK---------------------------------
REP_BPHP1/204-578............----EH-----------RCKVEKC-------DKTK---------------------------------
O80256_9VIRU/150-506............----KY-----------RFKAEKI-------DFKK---------------------------------

PF02407

REP9_FBNY2/3-82----------------IG-----------G.NPHLE-------KMK.---------------------------------
Q8AYY2_GOCV/9-96----------------LG-----------G.RAWLS-------RAR.---------------------------------
REP7_FBNY2/6-83----------------LP-----------G..AHLE-------MAK.---------------------------------
Q7T7M5_9VIRU/6-94----------------FG-----------DLKPHLE-------KQRA---------------------------------
REP_PCV2/14-100----------------LG-----------A.RCHIE-------KAK.---------------------------------
Q66005_9VIRU/5-93----------------LG-----------NDRIHLE-------PTR.---------------------------------
MREP_SCSVF/5-83----------------LP-----------G..AHLE-------KRR.---------------------------------
Q9NJY0_GIAIN/7-96----------------IC-----------N.RSHWE-------PVY.---------------------------------
REP1_FBNY2/3-82----------------IG-----------G.NPHVE-------KMK.---------------------------------
Q65378_BBTV/5-83----------------FP-----------G..AHLE-------KRK.---------------------------------
Q83026_BBTV/5-92----------------YG-----------S.RAHWE-------IAR.---------------------------------
REP1_MDV1/6-84----------------LP-----------G..AHLE-------VSK.---------------------------------
REP_CACV/9-93----------------L.-----------A.RAHWE-------KAR.---------------------------------
Q8QME8_9VIRU/5-87----------------AG-----------GNNWHWE-------VAR.---------------------------------
REP6_SCSVF/6-86----------------FN-----------GLNPHLE-------IAR.---------------------------------
REP3_MDV1/6-85----------------IP-----------G..AHFE-------KMRA---------------------------------
Q8QTK9_BBTV/3-90----------------YS-----------S.RAHWE-------KAR.---------------------------------
Q91GA3_PICV/36-120----------------F.-----------K.RAHWE-------KAR.---------------------------------
REP2_SCSVF/2-88----------------FG-----------N.RAHWE-------IAR.---------------------------------

PF01446

O52769_STRPN/89-314----------------VP-----------MVDIRSV-------KEIG.........KG....L..K..............
Q45447_BACIU/96-338----------------TP-----------IVDIRRV-------KGRA.KIDAEQIESDVREAMMEQ..............
Q04140_9ZZZZ/8-257----------------TP-----------IVHVQRV-------KPKEQLEDMETYEEQLKNAIREQ..............
P94343_PAEPP/119-370----------------DP-----------VVDVRVV-------KDGR.......RVGKEQEILVDKG.............
Q52233_9ZZZZ/88-315----------------RP-----------IVDVRSI-------KPKN.........EKT.SDI..R..............
REP_LACHI/82-313----------------QP-----------IVNVEAV-------RSNK.........AKGKNSL..I..............
Q9Z9H4_LACPN/83-316----------------KP-----------IVNVEAV-------RTNK.........SKGKSSL..L..............
Q45962_CLOBU/94-350----------------LL-----------INNITVT-------RQNIEALKDG...YSCCMEKFSE..............
Q55003_SELRU/109-342----------------EP-----------QVDVRAI-------KNTT..................A..............
O31146_ZYMMB/105-328----------------SP-----------VVDIRTV-------KNCV......PEASSGLTEGLKA..............
O33866_BACPU/97-340----------------TP-----------IVHVQRV-------KGKK.GIDAEAIEKEVREAMEEQ..............
P96459_STAAU/94-329----------------RP-----------VANIKSI-------KPNQ.........KG.DKDI..Q..............
Q48548_LACFE/83-313----------------DP-----------IIDIRKI-------RTKS.........KHGQSAL..V..............
REP_BACSP/64-306----------------TP-----------IVDIRRV-------KGKA.KIDAELIENDVREAMMEQ..............
Q99135_9ZZZZ/88-313----------------EP-----------NIDIRAV-------KTKT......GEVVANVAEQLQS..............
Q9ZNC0_9PROT/105-304----------------RP-----------LTD..PV-------DG...................................
Q51313_9NOSO/107-321----------------KP-----------ILDVQSL-------NPQ..............DSLIG...............
REP_LACPN/80-316----------------EP-----------VVHVQAV-------KANK.........RKGTDSL..Q..............
Q48836_LACRE/82-310----------------KP-----------IVNIKKI-------RASK.........KD..NSL..I..............
Q06460_9SYNC/106-332----------------RP-----------IVHVQAV-------RP.........KNKETLDTLQ................
Q48905_MICAE/1-247----------------TP-----------IVNVKRV-------RDRK......HKSKQTVDSIDNTTVDTINNRPVDNPI
O30850_STRTR/89-312----------------KP-----------MIDIRTV-------KETG.........KG....L..R..............
REPB_STAAU/1-233----------------DP-----------NVKVQMI-------RPKN.........KY.KSDI..Q..............
Q01536_9ZZZZ/1-236----------------TP-----------VVDIRTV-------KAHK.........RK...NL..K..............
O87867_STASA/94-328----------------KP-----------VANIKAI-------KPNK.........KG.NNAI..E..............

PF07232

Y35K_HALSI/1-316----------------RV-----------RRSSHPS-------RSGG---------------------------------
Y36K_HALSN/1-328----------------SI-----------RRSARPD-------REDG---------------------------------

PF02217

LT_POVBO/129-222----------------V.-----------LYIITVG-------.KHR---------------------------------
LT_POVMK/151-247----------------VP-----------IFIITGT-------.KHR---------------------------------
Q80FI2_9POLY/134-228----------------AF-----------MLIILAN-------.STR---------------------------------
Q9DPC0_POVJC/137-230----------------I.-----------LFFLTPQ-------.RHR---------------------------------
LT_POVLY/200-298----------------L.-----------LFLITLG-------.KHR---------------------------------
Q20HY2_9POLY/139-233----------------AI-----------MLIILTT-------.GTR---------------------------------
Q9J7C9_SV40/136-229----------------I.-----------LFFLTPH-------.RHR---------------------------------
Q20HX6_9POLY/120-214----------------A.-----------LFVILME-------RPTR---------------------------------
LT_POVHA/261-354----------------AF-----------VMFMTPG-------.KHR---------------------------------
Q9IBK8_BFPYV/111-204----------------L.-----------LVLQLEK-------.PTR---------------------------------
LT_POVMC/285-377----------------M.-----------LFFLTMT-------.KHR---------------------------------

PF03389

MOBA2_ECOLX/17-218----IN..---DGIERPA------------....AQWFKRYNGKT...........PEKGGA.....-------------
MOBL_THIFE/17-244----HVQP---DGTLGKK------------...........................AVELD.....-------------
O87207_9LACT/17-239----PFNA---DGSWGQK------------.AKKEYILDENGNKT...........YTANGHAR..S-------------
Q9R6F0_RHIRD/17-243----PLTE---DGFGAKK------------....VAVIGEDGEPL...........RTKAGK.....-------------
TRAA_RHISN/17-243----PLTA---DGFGAKK------------....LAVVGPDGNSL...........RNDAGK.....-------------
Q52001_9ZZZZ/11-235----EVDS---EGNILNK------------.SHRIPKLDENGNQI...........FNEKGQRV..T-------------
Q9ZA19_BIFLN/2-224----RIDP---KTGRWAA------------KSRSEFALDANGRRIPVIDPDTGRQKIGARNRKVWKR-------------
TRAA_AGRT5/17-243----PLTE---DGFGAKK------------....VAVIGEDGQLV...........RTKSGK.....-------------
Q53632_STAAU/17-218----GLDK---NNEFEPK------------RKGNDYIR.............................-------------

PF03432

Q9WW30_PEDPE/8-248----DLET...GRKMHGN............WQEYREKLVHNTDEI-----------SQEHGLEVTQVD.....PNRYEKR
RLX3_STAAU/8-236----DLET...GKKFNNN............K.KALHDIRQANDEI-----------CVSHNLSIPEE.......KAKLRY
Q56424_BACFG/7-242----DND....GKTISDK............N..DFYRNEKVCKML-----------TAKYRLHFANG...........KD
VIRD2_RHIRD/16-264----ELLGHGWLKISRRH............PQLNYDGLRKKMAEI-----------SLRHGIVLDAT.............
Q45123_BACFG/7-242----SLS....GELYRDN............W..IGKKATEAANAI-----------AKERNFVQSQ..............
Q9ZIP2_FUSNU/13-276----NIDT...GMKFREL............NKNEYNQKKENNVEL-----------KSHEFYLEDLKKSSDEICLANNLS
TRAI6_ECOLX/12-252----HPTR...NTIHEPY............R..AYRALADLCATL-----------ERDYGLERDN.......HETRQRV
Q9R2J7_9ZZZZ/61-315----HPET...GYLNRLS............W..SQEKLSRACREL-----------ELKHGFAPDNGCW...VHAPGNRI
Q9Z361_STAEP/8-242----DLET...GKKFNNN............K.QALRNVRNFNDEV-----------CMEHGLSVPDKD......TARLRY
LTRB_LACLM/34-307----NLYT...GKQFDWKVIPKEKTKSGKAYDVTKNNFEKVSDKI-----------ASRYGAKIIEK.......SPGN..
Q9XAW2_PSEAC/12-285----NPET...YKAVYPD............R..DYFKLDKTMREM-----------ELRQGWSHDKGPY...AVHERNGQ
Q51927_PASMD/14-247----EMTS...GKRLQPY............YDRADRPLAENFKQV-----------INHEYSLSDPN.......NPIKQK
TRAI5_ECOLX/12-252----HPTR...HTMHEPY............Y..PHRALAELCTAL-----------ERDYGLERDN.......HEPRKRG
Q54883_STRPN/11-264----DQNS...DKKFLWD............Y.KAEHNLRMVSDRL-----------SKIAGAKIIEN...........RY
RLX1_STAAU/8-238----NLET...GNKYQSN............K.EQRDFIKKANDQL-----------CEERGLSVPEK.......SSEIRY
RLX2_STAAU/8-239----DLET...GKKYQSN............K.KQRDLVKKENDNI-----------CREHGLSVTERG......IAKMRY
Q57087_9ZZZZ/9-280----NLET...GKKLREQ............KGESVQRAREMNDRL-----------ASRENWHILEP........PKERQ

PF01076

65KD_ZYMMA/1-192----DPDT....GRLNAS---------------RWFDGRKALSAL-----------------------------------
O54530_9ZZZZ/1-186----TQDG.....RLSAK---------------EFIGNKAQMTRD-----------------------------------
O87277_9STAP/1-193----RDG......KLQGK---------------NVFN.RQELLWL-----------------------------------
P71098_BACTI/20-220----LEKQ.....VSFDR---------------AITQQDATLDKT-----------------------------------
O32791_9LACT/1-193----NDEH.....KLSAK---------------TVFN.RQALQAV-----------------------------------
Q45448_BACIU/1-193----TEDG.....RLSAK---------------DFFNGKLKMKAI-----------------------------------
PRE_STRAG/1-194----ENG......KLSSK---------------AMFD.REELKHI-----------------------------------
PRE1_STAAU/1-198----TEDG.....RLSAK---------------EQLGNKKDFTQL-----------------------------------
PREA_BACTU/1-192----TEDN.....RLSAK---------------DMFT.RKELISL-----------------------------------
Q52058_9ZZZZ/3-190----KEKK.....LNANY---------------YIGGSKHKMIEL-----------------------------------
Q09026_OENOE/1-199----TKNG.....KLSSD---------------ALWD.RKELFDF-----------------------------------
Q53618_STAAU/1-198----TEDG.....RLSAK---------------EVLGNKKALTEF-----------------------------------
Q48524_LACCA/1-194----DDEH.....KLSAK---------------RVFN.RTALRDV-----------------------------------
O05418_CLOPF/6-219----VEKEILWSKRCKDE---------------KLRGTVKEVVHQ-----------------------------------
Q52050_BUTFI/1-198----EDGS....FKLCAK---------------ELMGNIKQYHQR-----------------------------------
PREA_LACPN/1-194----DDDK.....KLSAK---------------RIFN.REALQHI-----------------------------------
P71520_MARHA/20-221----MDTQ.....VSFDR---------------AIKQQDATLNQT-----------------------------------
Q53620_STAAU/1-198----TDDG.....RLSAK---------------EVVGNKKALTAF-----------------------------------

PF00799

REP_BGYMV/7-120----SSDVK----EYIDK---------------D----------------------------------------------
REP_PHUV/7-120----SSDVK----TYIDK---------------D----------------------------------------------
REPA_PASVK/17-125----TDKVR----EYILK---------------D----------------------------------------------
REPA_MSVK/10-118----VNRVR----DYILK---------------E----------------------------------------------
REPA_CSMV/34-142----PASTL----KYCMK---------------H----------------------------------------------
REP_TLCVA/7-120----SSDVK----SYLEK---------------D----------------------------------------------
REPA_TYDVA/11-118----SEQVL----EYISK---------------D----------------------------------------------
REPA_WDVS/9-127----CNQVR----DYITK---------------E----------------------------------------------
REP_CLVK/6-119----SSDVK----SYLDK---------------D----------------------------------------------
REP_SLCV/8-122----TNAVK----NYITK---------------E----------------------------------------------
REP_BCTVC/7-120----SSDVK----SYVDK---------------D----------------------------------------------

PF05840

VGA_BPG4/115-441----YMAVGFYVAKYVNK---------------KSDID.......-----------------------------------
REPA_BPPHX/74-400----YMAVGFYVAKYVNK---------------KSDMD.......-----------------------------------
VGA_BPPHK/49-381----YQAVAWYVTKYVAK---------------QSDQR.......-----------------------------------
Q8W759_9CAUD/122-510----GTATG.YIAKYISK---------------NIDGYAMDG...-----------------------------------
VPA_BP186/139-507----GSATG.YVAKYISK---------------NIDGYALDG...-----------------------------------
VPA_BPP2/133-515----GGAAG.YIAKYISK---------------NIDGYALDG...-----------------------------------
ENDP2_SALTI/193-568----GTPTS.YIAKYISK---------------NIDGRGLAK...-----------------------------------
Q8XBG0_ECO57/179-564----GTPTX.YIATYIGK---------------NLDSRAVDGIDP-----------------------------------
P12_BPPM2/101-478----GSAVG.YIAKYISK---------------NINANHIEG...-----------------------------------
REP_BPHP1/204-578----GSATA.YIAKYIAK---------------NIDGFALAG...-----------------------------------
O80256_9VIRU/150-506----GSAVG.YVAKYLSK---------------NIDGQHI.....-----------------------------------

PF02407

REP9_FBNY2/3-82----GSIEE--ASAYAQK---------------E----------------------------------------------
Q8AYY2_GOCV/9-96----GSDED--NEEYCSK---------------E----------------------------------------------
REP7_FBNY2/6-83----.APKK--AIEYCQK---------------K----------------------------------------------
Q7T7M5_9VIRU/6-94----RKTDE--ACDYCMK---------------E----------------------------------------------
REP_PCV2/14-100----GTDQQ--NKEYCSK---------------E----------------------------------------------
Q66005_9VIRU/5-93----GSDEQ--NRDYCSK---------------E----------------------------------------------
MREP_SCSVF/5-83----GSQGE--ARAYAMK---------------E----------------------------------------------
Q9NJY0_GIAIN/7-96----GSNTQ--AKAYCTK---------------E----------------------------------------------
REP1_FBNY2/3-82----GTIEE--ASAYVQK---------------E----------------------------------------------
Q65378_BBTV/5-83----GSQEE--ARSYCMK---------------E----------------------------------------------
Q83026_BBTV/5-92----GTDEE--NSKYCSK---------------E----------------------------------------------
REP1_MDV1/6-84----GTPEE--ASDYAMK---------------E----------------------------------------------
REP_CACV/9-93----GSDHD--NEEYCSK---------------E----------------------------------------------
Q8QME8_9VIRU/5-87----GKNTE--CRAYCTK---------------E----------------------------------------------
REP6_SCSVF/6-86----.DVEK--AQLYAMK---------------E----------------------------------------------
REP3_MDV1/6-85----LNSDQ--AKAYAMK---------------E----------------------------------------------
Q8QTK9_BBTV/3-90----GSDYD--NKAYCSK---------------E----------------------------------------------
Q91GA3_PICV/36-120----GSDED--NEKYCSK---------------D----------------------------------------------
REP2_SCSVF/2-88----GSDSQ--NRDYCCK---------------E----------------------------------------------

PF01446

O52769_STRPN/89-314....GAILE--TAKYPIK---------------PIKLDVENK...-----------------------------------
Q45447_BACIU/96-338....KAVLE--ISKYPVK---------------DTDVVRGNKVT.-----------------------------------
Q04140_9ZZZZ/8-257....NAILE--VSKYPVK---------------DTDVIKGNKVT.-----------------------------------
P94343_PAEPP/119-370YIDPGIVSE--MSKYTVK---------------SSQYLFKDDER.-----------------------------------
Q52233_9ZZZZ/88-315....SAILE--TAKYPVK---------------PMELNYDSA...-----------------------------------
REP_LACHI/82-313....ASAQE--TAKYQVK---------------SKDILTNDQE..-----------------------------------
Q9Z9H4_LACPN/83-316....ASAQE--TAKYQVK---------------SADYMTDDDN..-----------------------------------
Q45962_CLOBU/94-350....NDYAE--LFKYMTK---------------VTGEDGFTLT..-----------------------------------
Q55003_SELRU/109-342....KAVAE--VAKYPVK---------------VDGLLKVKDKE.-----------------------------------
O31146_ZYMMB/105-328.....AVAE--TLKYSVK---------------PSDMIE......-----------------------------------
O33866_BACPU/97-340....KAILE--ISKYPVK---------------DTDVIRGNEVT.-----------------------------------
P96459_STAAU/94-329....AAIKE--TSKYSVK---------------SSDFLTDDDE..-----------------------------------
Q48548_LACFE/83-313....DSAKE--VAKYQVK---------------NSDYITNDQE..-----------------------------------
REP_BACSP/64-306....KAVLE--ISKYPVK---------------DTDVVRGNKVT.-----------------------------------
Q99135_9ZZZZ/88-313.....AVAE--TLKYSVK---------------PEDMAN......-----------------------------------
Q9ZNC0_9PROT/105-304......FLE--VCKYALK---------------FSDLEPG.....-----------------------------------
Q51313_9NOSO/107-321.....LLAE--VIKYSVK---------------ESDLT.......-----------------------------------
REP_LACPN/80-316....ASAEE--TAKYEVK---------------SADYMTADDE..-----------------------------------
Q48836_LACRE/82-310....ASAKE--VSKYQVK---------------DYDYITDDEK..-----------------------------------
Q06460_9SYNC/106-332.....AILE--TLKYSVK---------------PDDLIGESEEP.-----------------------------------
Q48905_MICAE/1-247DDIIAGVLE--TIKYSVK---------------PADLIGEDYMF.-----------------------------------
O30850_STRTR/89-312....GAVLE--TAKYPTK---------------PIKLDIENK...-----------------------------------
REPB_STAAU/1-233....SAIDE--TAKYPVK---------------DTDFMTDDEE..-----------------------------------
Q01536_9ZZZZ/1-236....SAIIE--TAKYPVK---------------PFDVDTEDVTLF-----------------------------------
O87867_STASA/94-328....SAIKE--TSKYAVK---------------ASDYLTSDQE..-----------------------------------

PF07232

Y35K_HALSI/1-316----VENLGAYLAAYMAG---------------EYGSEPSEMP-------------------------------------
Y36K_HALSN/1-328----IENLGAYLAAYMAG---------------EYGVEALAMP-------------------------------------

PF02217

LT_POVBO/129-222----VNAMENLCSKKCTV---------------S----------------------------------------------
LT_POVMK/151-247----VSAVFNYCATYCSV---------------S----------------------------------------------
Q80FI2_9POLY/134-228----VSTLINFCCKHCTV---------------S----------------------------------------------
Q9DPC0_POVJC/137-230----VSAINNYCQKLCTF---------------S----------------------------------------------
LT_POVLY/200-298----VSAVKHFCVSQCTF---------------S----------------------------------------------
Q20HY2_9POLY/139-233----ISTVLNFCKKHCTV---------------S----------------------------------------------
Q9J7C9_SV40/136-229----VSAINNYAQKLCTF---------------S----------------------------------------------
Q20HX6_9POLY/120-214----VSTVGNFCKKHCTV---------------S----------------------------------------------
LT_POVHA/261-354----VAAVKSYCCKFCTV---------------S----------------------------------------------
Q9IBK8_BFPYV/111-204----ISTVHNFCKKYCTI---------------S----------------------------------------------
LT_POVMC/285-377----VSAVKNYCSKLCSV---------------S----------------------------------------------

PF03389

MOBA2_ECOLX/17-218---------------------------------..QKTEAL.KPKAWLEQ---TREAWADHANRALERAGHDAR------
MOBL_THIFE/17-244---------------------------------..PIHCQRAKIENLVDR---ERVRWGELANAALEHHGHAAR------
O87207_9LACT/17-239---------------------------------RKIWLVDW.DKVGKVEE---WRKAWADHVNSVFQEKNIDER------
Q9R6F0_RHIRD/17-243---------------------------------..IVYELWAGGTDDFNA---FRYAWFERMNHHLALNGINLR------
TRAA_RHISN/17-243---------------------------------..IVYELWAGSLDDFNA---FRDGWFACQNRHLALAGLDIR------
Q52001_9ZZZZ/11-235---------------------------------VSIKTNDW.GRKSLVSE---IRKDWADKVNQYLKDRNIDQQ------
Q9ZA19_BIFLN/2-224---------------------------------VNVSNNPL.DSKEFLER---LRREWADSCNALLPGYAV...------
TRAA_AGRT5/17-243---------------------------------..ILYELWAGSTDDFNV---VRDGWFERLNHHLTLGGIDLK------
Q53632_STAAU/17-218---------------------------------......DW.NTKEKHNE---WRKRWENVQNKHLEKNGFSVR------

PF03432

Q9WW30_PEDPE/8-248TMAEIKMQA......................KGQPTWKDQIRQAVDKTMANR.LVTDFQTFRDD-LKQKTVDVW...ERG
RLX3_STAAU/8-236TQAEYSVLN..................K....GKTSWKDEIRHAIDQSQ.....AASYEELGND-LQQNGIKIE..RITD
Q56424_BACFG/7-242NIKEERLRP........................YDKAKHEVYKALKGELP...HARSWNELKEA-LSERDIELKFKVSRT
VIRD2_RHIRD/16-264SRAERGIAER.......................PITYAEHRRLERMQAQK.....IQFEDTDFD-ETSPEEDRR...DLS
Q45123_BACFG/7-242...DIGKVN........................KAEIKEAMDGVLKKMQG.....FDFTKFKEE-LGKRGFKVREARAST
Q9ZIP2_FUSNU/13-276VIPQKEKAESQNIYN.........RREYNVVMNKTSYKMELAKDIKRASKN...CKSKEDFIKA-LDEKGVIVD.WEDHK
TRAI6_ECOLX/12-252SENRANDMER...................HAGVESLVGWIKRECLPELQA....AQSWEDLHRV-LRENGLKLR..ERGN
Q9R2J7_9ZZZZ/61-315VRKTAVERDRQ..............NAWTRGKKQTFREYIAQTAVAGLRSE..PVHDWLSLHRR-LAEDGLYLS..QMDG
Q9Z361_STAEP/8-242TQTEKAIAD.................PNTKSTAQYSWKDEIREAIDQSQ.....ATNMNEFKDH-LNQHGIEIE..RVTP
LTRB_LACLM/34-307SHLKYTKWQ.......................TQSIYKSQIKQRLDYLLE...MSSDIEDFKRK-ATALNLSFD...FSG
Q9XAW2_PSEAC/12-285KVVDWAKDEPSHRQPDREKLPGKARQMEVMTGNESLTTYAQGQPKKDALEALNKGGGWHELHEA-LGRHGLEIR..QKGQ
Q51927_PASMD/14-247NLIDRKDLP.....................TDKKQALQAITDGLTALANAG..QINDRQDVINA-LERAGFEIA..RITP
TRAI5_ECOLX/12-252AEGRAADMER...................HAGVESLVGWIKRECLDEIKG....AQSWQELHQV-MRDNGMELR..VRAN
Q54883_STRPN/11-264SHRQYEVYR........................KTNYKYEIKQRVYFLIE...NSKNFEDLKKK-AKALHLKID...FRH
RLX1_STAAU/8-238TLAEQNMI......................DKDKRSWKNDIRMAVEETKD...NAVAFEEFNTL-LKEKGVEIT..RVTK
RLX2_STAAU/8-239TQAEKGIVF.....................DRDEYSWKDELRDLIENAKT...HTSNLETFSEH-LEEKGVGV...KLRG
Q57087_9ZZZZ/9-280TETEKELIA......................KNEYSYMDDLRERINKSLQDV.SVSSYETFKER-LSDNGVILSERGQTF

PF01076

65KD_ZYMMA/1-192-----------------------------------------------------QT....GYAAS-MEPLG..LA------
O54530_9ZZZZ/1-186-----------------------------------------------------QT....TFAAA-VADLG..LQ------
O87277_9STAP/1-193-----------------------------------------------------QD....KFPEH-MKKQGFELK------
P71098_BACTI/20-220-----------------------------------------------------RPFDDWREKEV-QLLEKALKE------
O32791_9LACT/1-193-----------------------------------------------------QD....ELPKY-LNERGFELE------
Q45448_BACIU/1-193-----------------------------------------------------QD....DFHRH-MVENGFDLV------
PRE_STRAG/1-194-----------------------------------------------------QE....DLPRY-MSDHGFELE------
PRE1_STAAU/1-198-----------------------------------------------------QD....RFNEY-VNEKGYELE------
PREA_BACTU/1-192-----------------------------------------------------QQ....DFPLE-MREKGFDVD------
Q52058_9ZZZZ/3-190-----------------------------------------------------QD....DFYKN-VGQK.FKMD------
Q09026_OENOE/1-199-----------------------------------------------------HT....YMAKG-LQANGFQLE------
Q53618_STAAU/1-198-----------------------------------------------------QD....RFNEH-INSCGYDLS------
Q48524_LACCA/1-194-----------------------------------------------------QD....QLPAY-LPQHGLNIQ------
O05418_CLOPF/6-219-----------------------------------------------------IS....HSKKW-KSDIPLTDE------
Q52050_BUTFI/1-198-----------------------------------------------------QN....EFHEE-VGLK.YGLE------
PREA_LACPN/1-194-----------------------------------------------------QE....ELPQY-LKENGFDVQ------
P71520_MARHA/20-221-----------------------------------------------------HPFEDWREREI-GFLEEKINA------
Q53620_STAAU/1-198-----------------------------------------------------QD....RFNEH-VKQRGYDLE------

PF00799

REP_BGYMV/7-120------------------------------------------------------G....VTI----EWGQFQVD--G---
REP_PHUV/7-120------------------------------------------------------G....DTV----EWGEFQID--G---
REPA_PASVK/17-125------------------------------------------------------P...KDKW----EKGTYIPR--K---
REPA_MSVK/10-118------------------------------------------------------P...LAVF----ERGTFIPR--K---
REPA_CSMV/34-142------------------------------------------------------P...ESSW----EFGKFLKP--K---
REP_TLCVA/7-120------------------------------------------------------G....DTL----EWGEFQID--G---
REPA_TYDVA/11-118------------------------------------------------------G....NVI----TKGEFKKH--R---
REPA_WDVS/9-127------------------------------------------------------VDSDVNTA----EWGTFVAV--S---
REP_CLVK/6-119------------------------------------------------------G....DTV----EWGQFQID--G---
REP_SLCV/8-122------------------------------------------------------G....DYC----ESGQYKVS--G---
REP_BCTVC/7-120------------------------------------------------------G....DTI----EWGEFQID--G---

PF05840

VGA_BPG4/115-441------------------------------.....MAVKGLGNKEWNNSLKTKINLIPKKVF----RIRMSRNF--G---
REPA_BPPHX/74-400------------------------------.....LAAKGLGAKEWNNSLKTKLSLLPKKLF----RIRMSRNF--G---
VGA_BPPHK/49-381------------------------------.....QKAITERQKKCKNPLMA...ICLKKEF----RVRSSRKL--G---
Q8W759_9CAUD/122-510------------------------------.....DISDET.GKPVKDMARN..VSAWKSRW----SIRQFQFF--G---
VPA_BP186/139-507------------------------------.....ETDDES.GELLKETAPA..VSAWAARW----HIRQFQFI--G---
VPA_BPP2/133-515------------------------------.....QLDNDT.GRPLKDTAAA..VTAWASTW----RIPQFKTV--G---
ENDP2_SALTI/193-568------------------------------.....EISKET.GRSLRDSAEH..VSAWASLH----RVQQFRFF--G---
Q8XBG0_ECO57/179-564------------------------------KTGKPRVDHET.GKSMTESVER..AIGWARLH----RVRQFQFF--G---
P12_BPPM2/101-478------------------------------.....EKDNETGGEFNNENGLVLNVGAWASRW----RIRQFQFV--G---
REP_BPHP1/204-578------------------------------.....EVSDEDPTLSLHDNALR..VRAWASRW----GIRQFQFY--G---
O80256_9VIRU/150-506------------------------------.....DFDRNS.NKSGTEAAQS..VVSFNRLN----GVRQFQFY--G---

PF02407

REP9_FBNY2/3-82--------------------------------------------------------------------------------
Q8AYY2_GOCV/9-96--------------------------------------------------------------------------------
REP7_FBNY2/6-83--------------------------------------------------------------------------------
Q7T7M5_9VIRU/6-94--------------------------------------------------------------------------------
REP_PCV2/14-100--------------------------------------------------------------------------------
Q66005_9VIRU/5-93--------------------------------------------------------------------------------
MREP_SCSVF/5-83--------------------------------------------------------------------------------
Q9NJY0_GIAIN/7-96--------------------------------------------------------------------------------
REP1_FBNY2/3-82--------------------------------------------------------------------------------
Q65378_BBTV/5-83--------------------------------------------------------------------------------
Q83026_BBTV/5-92--------------------------------------------------------------------------------
REP1_MDV1/6-84--------------------------------------------------------------------------------
REP_CACV/9-93--------------------------------------------------------------------------------
Q8QME8_9VIRU/5-87--------------------------------------------------------------------------------
REP6_SCSVF/6-86--------------------------------------------------------------------------------
REP3_MDV1/6-85--------------------------------------------------------------------------------
Q8QTK9_BBTV/3-90--------------------------------------------------------------------------------
Q91GA3_PICV/36-120--------------------------------------------------------------------------------
REP2_SCSVF/2-88--------------------------------------------------------------------------------

PF01446

O52769_STRPN/89-314------------------------------......QVVGDLYNGLYRKRQLGYGGLFKEIR....KRLQLSNV--E..N
Q45447_BACIU/96-338------------------------------..EDNLNTVFYLDDALSARRLIGYGGILKEIH....KELNLGDA--E..D
Q04140_9ZZZZ/8-257------------------------------..AENVETVLALDNALANKRLIGYGGLLKQVH....KELNLGDP--E..D
P94343_PAEPP/119-370------------------------------...LTDKVVLTFERALSGRRLFAFGGLLKEVYNCLKNQVALDDA--ESDK
Q52233_9ZZZZ/88-315------------------------------......KVVDDLQKGLYRKRQIAFGGLFKQIK....KELELDDI--E..N
REP_LACHI/82-313------------------------------...RDLQVVEDLEQGLAGSRQISYGGLFKEIR....KQLQLEDV--...D
Q9Z9H4_LACPN/83-316------------------------------...RNQQVIDDLEQALAGTRQIGYGGLLKQIK....QQLKLDDA--D..N
Q45962_CLOBU/94-350------------------------------.....YENFVALYYGLYRIKQIQGYGVLYNIT....DDGDLEKL--EEEY
Q55003_SELRU/109-342------------------------------...KAAQALIQLKHGIHNCRFITFGGDFREYK....RRLALDDI--E..T
O31146_ZYMMB/105-328------------------------------....GNNWFLQMTKQVHRKRFIASGGVLKNIL....RESQETNE--....
O33866_BACPU/97-340------------------------------..EENLDTVYYLDNALNARRLIGYGGILKEIH....KELNLTDA--E..D
P96459_STAAU/94-329------------------------------...RNQEIVNDLEKGLYRKRMLSYGGLLKQKH....KILNLDDA--E..D
Q48548_LACFE/83-313------------------------------...SDLVILNELEKGLQGSRQLSFGGLLKDIR....HSLLFDEN--...E
REP_BACSP/64-306------------------------------..EDNLNTVLYLDDALAARRLIGYRGILKEIH....KELNLGDA--E..D
Q99135_9ZZZZ/88-313------------------------------....DPEWFLDVTRQLHKRRFISTGGALKNVL....QLDRETNE--....
Q9ZNC0_9PROT/105-304------------------------------.......HLFEAYKILSGSRLVDSHGLMRGVR........LPD.--....
Q51313_9NOSO/107-321------------------------------...SDREWFLELTRQLHRTKAIAVGGILREYL....RDLEQEPE--....
REP_LACPN/80-316------------------------------...RNLVVIKNLEYALAGTRQISYGGLLKQIK....QDLKLEDV--E..N
Q48836_LACRE/82-310------------------------------...GDLVVVDELEHALAGTRQLSFAGLLKEIH....HELLLDEK--...E
Q06460_9SYNC/106-332------------------------------.TEENKQWLVELTTQLHKTRAVATGGILKEYL....KELEKEPE--....
Q48905_MICAE/1-247------------------------------.VTP.QDWLAELTRQLHKTRSIALGGIFKQYL....SEDE..PE--....
O30850_STRTR/89-312------------------------------......QVVDDLYNGLYRKRQLGYGGLFKIIK....KQLALDDV--E..S
REPB_STAAU/1-233------------------------------...KNLKRLSDLEEGLHRKRLISYGGLLKEIH....KKLNLDDT--E..E
Q01536_9ZZZZ/1-236------------------------------SEMVKERITEDLTNGLHRKRQIGFGKLFKKIK....AELALDDV--E..E
O87867_STASA/94-328------------------------------...KDLEVVNDLEQGLYKKRMISYGGLLKIKH....KELNLGNA--E..D

PF07232

Y35K_HALSI/1-316---------------------------------ENVRAFYATMWASGRQWFRPSNGAQELMQ----PEEDDEGD--SIEE
Y36K_HALSN/1-328---------------------------------AHVRAFYAAMWATGTQWFRPSNGAQRHMQ----PES.DDEE--SVEE

PF02217

LT_POVBO/129-222--------------------------------------------------FLQAKGVLKP--------------------
LT_POVMK/151-247--------------------------------------------------FIVVKGVIKE--------------------
Q80FI2_9POLY/134-228--------------------------------------------------PYVVRGVKKH--------------------
Q9DPC0_POVJC/137-230--------------------------------------------------FLICKGVNKE--------------------
LT_POVLY/200-298--------------------------------------------------FIHCKAVVKP--------------------
Q20HY2_9POLY/139-233--------------------------------------------------PLCVRGLKKH--------------------
Q9J7C9_SV40/136-229--------------------------------------------------FLICKGVNKE--------------------
Q20HX6_9POLY/120-214--------------------------------------------------LCIVRGIKKN--------------------
LT_POVHA/261-354--------------------------------------------------FLLCKAVTKP--------------------
Q9IBK8_BFPYV/111-204--------------------------------------------------ICSVRGIKKN--------------------
LT_POVMC/285-377--------------------------------------------------FLMCKAVTKP--------------------

PF03389

MOBA2_ECOLX/17-218--IDHRTLEAQGIERLPGVHLGPN--------VVEMEGR
MOBL_THIFE/17-244--IDHRSHAKRGIEAEPTRHLGPA--------AAGIERR
O87207_9LACT/17-239--ISEKTLEAQGINDIATQHVGVT--------GNRDER.
Q9R6F0_RHIRD/17-243--VDGRSYEKQGIDLVPTIHLGVG--------AKAIERK
TRAA_RHISN/17-243--IDGRSFEKQGIELTPTIHLGVG--------TKAIERK
Q52001_9ZZZZ/11-235--ITEKSHAELGKKELPTIHEGFY--------SKKLEDK
Q9ZA19_BIFLN/2-224--IDHRSFKARGIERIPTIHEGYA--------SREMEKR
TRAA_AGRT5/17-243--IDGRSYEKQGIDLEPTIHLGVG--------AKAISRK
Q53632_STAAU/17-218--VSADSYKNQNIDLEPTKKEGWK--------ARKFEDE

PF03432

Q9WW30_PEDPE/8-248KDLTYQLTGTN..YKARGNKLGTA..YEKGEIYHELERR
RLX3_STAAU/8-236KTITYRHLEED..KKVRGKKLGED..YDKGGLEIGFNRQ
Q56424_BACFG/7-242TKEVQGVKFEYGGISFSGSKVSRE..FSYMNIDYRLRRN
VIRD2_RHIRD/16-264QSFDPFRSDPS..TGEPDRATRHD..KQPLEQHARFQES
Q45123_BACFG/7-242GKLNGYYVTARSGTEYKASEIGKG..YTLAHIERTQSKL
Q9ZIP2_FUSNU/13-276KHITFKFKDEKK.KSIRLANLEKT..FQDETFKKEYLEQ
TRAI6_ECOLX/12-252GFIFEAGDG....TTVKASTVSRD..LSKPKLEARFGAF
Q9R2J7_9ZZZZ/61-315KFLVMDGWDRNR.EGVQLDSFGPS..WCAEKLMKKMGDY
Q9Z361_STAEP/8-242KSITYRHLVED..KKVRGRKLGED..YNKGGIEDGFERQ
LTRB_LACLM/34-307KWTTYRLLDEPQMKNTRGRNLDKN..RPEKYNLESIIER
Q9XAW2_PSEAC/12-285GFAIHSKTDPEQ.TPIKASTMAQE..LGGGKLTKRIGPY
Q51927_PASMD/14-247KNLSIKTDGQN..LRLKGAFYEQD.FRFSTDLSADITER
TRAI5_ECOLX/12-252GLVFEAGDG....TMVKASTVARD..LSKPSLEARLGPF
Q54883_STRPN/11-264KHVTYFMTDSNMKQVVRDSKLSRKQPYNETYFEKKFVQR
RLX1_STAAU/8-238NNVTYRHIEED..KKVRGNKLGDS..YDKGVIENGFAIE
RLX2_STAAU/8-239ETISYKPENEN..KWVRGRTLGSE..YEKGAIDHEHERH
Q57087_9ZZZZ/9-280SYAFLDANNKQ..RRARETRLGSD..FGRETILHELEKR

PF01076

65KD_ZYMMA/1-192-------------RGVKG...SKA-----THQRVQRHYG
O54530_9ZZZZ/1-186-------------RGIEG...SKA-----RHTRIQAFYE
O87277_9STAP/1-193-------------RGERG...SDR-----KHIETAKFKK
P71098_BACTI/20-220-------------RGI......ER-----KLVGTNEYKD
O32791_9LACT/1-193-------------RGEKG...SER-----KNLTVPEYKK
Q45448_BACIU/1-193-------------RGEP....SEK-----KHENVHQYKI
PRE_STRAG/1-194-------------RGKLN...SEA-----KHKTVAEFKR
PRE1_STAAU/1-198-------------RGTSKE.VTER-----EHKAMDQYKK
PREA_BACTU/1-192-------------RGEG....SEK-----KHLSPQAFKE
Q52058_9ZZZZ/3-190-------------RGRPAA.ITKA-----KHLNSRDYLA
Q09026_OENOE/1-199-------------RGEEY...SRT-----KHLDPNVYKA
Q53618_STAAU/1-198-------------RGITRG.VTPR-----RHEQISRYKN
Q48524_LACCA/1-194-------------RGVQE...SGR-----KSLAVPGYKA
O05418_CLOPF/6-219-------------KGNP....LLR-----KNGKPMFRAS
Q52050_BUTFI/1-198-------------RGQVQDREERR-----EHLDTLEFKT
PREA_LACPN/1-194-------------RGNKN...KER-----KNLSVPEYKA
P71520_MARHA/20-221-------------RGI......DR-----ELVGTNDYED
Q53620_STAAU/1-198-------------RGQSRQ.VTNA-----KHEQISQYKQ

PF00799

REP_BGYMV/7-120---------------------------------------
REP_PHUV/7-120---------------------------------------
REPA_PASVK/17-125---------------------------------------
REPA_MSVK/10-118---------------------------------------
REPA_CSMV/34-142---------------------------------------
REP_TLCVA/7-120---------------------------------------
REPA_TYDVA/11-118---------------------------------------
REPA_WDVS/9-127---------------------------------------
REP_CLVK/6-119---------------------------------------
REP_SLCV/8-122---------------------------------------
REP_BCTVC/7-120---------------------------------------

PF05840

VGA_BPG4/115-441----------------------M.......KLLSMAHL-
REPA_BPPHX/74-400----------------------M.......KMLTMTNL-
VGA_BPPHK/49-381----------------------M.......ELPSMAHL-
Q8W759_9CAUD/122-510----------------------GAPVTTYRELRRLANQ-
VPA_BP186/139-507----------------------GAPVTVYRELRRMADP-
VPA_BPP2/133-515----------------------LPTMGAYRELRKLPRG-
ENDP2_SALTI/193-568----------------------IPGRQAYRELRLLAGQ-
Q8XBG0_ECO57/179-564----------------------IPSRQVWRELRRLASQ-
P12_BPPM2/101-478----------------------GASVGVWREIRRAKPE-
REP_BPHP1/204-578----------------------GASICVWRELRRLISG-
O80256_9VIRU/150-506----------------------GCSVSVWREMRRLRDE-

PF02407

REP9_FBNY2/3-82---------------------------------------
Q8AYY2_GOCV/9-96---------------------------------------
REP7_FBNY2/6-83---------------------------------------
Q7T7M5_9VIRU/6-94---------------------------------------
REP_PCV2/14-100---------------------------------------
Q66005_9VIRU/5-93---------------------------------------
MREP_SCSVF/5-83---------------------------------------
Q9NJY0_GIAIN/7-96---------------------------------------
REP1_FBNY2/3-82---------------------------------------
Q65378_BBTV/5-83---------------------------------------
Q83026_BBTV/5-92---------------------------------------
REP1_MDV1/6-84---------------------------------------
REP_CACV/9-93---------------------------------------
Q8QME8_9VIRU/5-87---------------------------------------
REP6_SCSVF/6-86---------------------------------------
REP3_MDV1/6-85---------------------------------------
Q8QTK9_BBTV/3-90---------------------------------------
Q91GA3_PICV/36-120---------------------------------------
REP2_SCSVF/2-88---------------------------------------

PF01446

O52769_STRPN/89-314GDLVYISDDNDEMSKGT......KIVAIWNATKQNYFV-
Q45447_BACIU/96-338GDLVKIEEEDDEVANEA.....FEVMAYWHPGIKNYII-
Q04140_9ZZZZ/8-257GDLVHVSEE.DEIANGA.....FEVMAKWHIGFRDYWI-
P94343_PAEPP/119-370ADLLRVDDDLSNCTCPTCNSTLLEEMYRWLPDRGAYHR-
Q52233_9ZZZZ/88-315GDLINIGDEENPISDGE......IISVLWNHERQNYYV-
REP_LACHI/82-313AHLINVDDDKVKIDEVVR.....EVVAKWDYNKQNYFI-
Q9Z9H4_LACPN/83-316GDLVNV.DGDKLSEPTEA....ELIVARWDQQRKNYLI-
Q45962_CLOBU/94-350ENYIEQLKQKESPVAS.......YEAPQDLIKDTEYML-
Q55003_SELRU/109-342GDLVHVETDKQELNAVA......MILFKYRADVGAYIC-
O31146_ZYMMB/105-328.DLIFADNLNEISDRS.......RIAFNWRQSEKCYRR-
O33866_BACPU/97-340GDLVRIEEDDDEVANET.....FEVMARWHVGIKNYIV-
P96459_STAAU/94-329GNLINTSDEDKTTDEEEK...AHSITAIWNFEKQNYYL-
Q48548_LACFE/83-313DDLINVSATNDDSEIVKK......VMYKWNCSVSDYVS-
REP_BACSP/64-306GDLVKIRKKMTRLQMVH.....LRLWLIGILHIKNYII-
Q99135_9ZZZZ/88-313.DLVIADDVGDGTDDGK......RTAFVWDSGKRRYKR-
Q9ZNC0_9PROT/105-304.DLVDEPLQGLPFVEL........FYRFLPGTGYTYVY-
Q51313_9NOSO/107-321.DLVGNDNEGDVD....E....GHLYFGWKQKQKKYKL-
REP_LACPN/80-316GDLVHVGDEDYTKEQMEA...AEEVVAKWDFNKQNYFI-
Q48836_LACRE/82-310DDLINVDDEKEKDDVVDT......VIYRWNSKVSNYVR-
Q06460_9SYNC/106-332.DLIHADDDSEP..DNSI....ASVIFDWEQRIKKYAM-
Q48905_MICAE/1-247.DLINAEIEEESDLDEEG....YNYIFEWREIMRRYAY-
O30850_STRTR/89-312GDLIHTSDDKETLSKGT......EIVAIWNATKQNYYL-
REPB_STAAU/1-233GDLIHTDDDEKADEDG......FSIIAMWNWERKNYFI-
Q01536_9ZZZZ/1-236GNLVQTGAEESAESTGR......EIVAFWNWDRKNYFV-
O87867_STASA/94-328GNLIQTG.EEKISDEEEK...ANSIMAIWNYEKQNYFL-

PF07232

Y35K_HALSI/1-316WEMVGIAPEGDLGD.IIEVDPSEPRSDPYRRLRTPPPGG
Y36K_HALSN/1-328WEMVGIAPEGDLEDEIIEVDPEQPRDDPYRRLRTPPPGG

PF02217

LT_POVBO/129-222---------------------------------------
LT_POVMK/151-247---------------------------------------
Q80FI2_9POLY/134-228---------------------------------------
Q9DPC0_POVJC/137-230---------------------------------------
LT_POVLY/200-298---------------------------------------
Q20HY2_9POLY/139-233---------------------------------------
Q9J7C9_SV40/136-229---------------------------------------
Q20HX6_9POLY/120-214---------------------------------------
LT_POVHA/261-354---------------------------------------
Q9IBK8_BFPYV/111-204---------------------------------------
LT_POVMC/285-377---------------------------------------

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window