Sequence alignment for CL0170

PF05951

Q9CNZ9_PASMU/32-183--------------VSTPKPRILRFRNINTGEKFSAEFLPSKGFSSVALKKLDYLM--RDKRNNHMHRMDPKLFL---KF
Q9A852_CAUCR/63-213--------------KPAVDPRWVHLHNVHTGEKLEAVYWENGDYVPDAVSALDKVL--RDYRNDEVHPIDRGLYD---LL
E8VLY5_VIBVM/19-169--------------SYPDQPRTLALNNLHTGELLETCYFDGSTYLIEELARIDKIC--RDFRQNEVHPMDRRLFD---HL
Q8YE08_BRUME/24-176--------------QASAETRSLKLYYVHTGEKAEIAFKKDGRFLPDGLKRLNVFL--RDWRRNEPTRMDPRLFD---LI
Q9KSI7_VIBCH/29-179--------------SYAAKPRELALSNLHTGESIETRYFNGKNYVRSELKRLNHLC--RDFRRDEVHAMDKLLFD---QL
Q989B8_RHILO/15-167--------------SAFAETRALKIQHLHTGEKAEIVFKRNGRYDQAGLKKIDFML--RDWRRNEPTRMDPRLLD---LV
Q92JX1_RHIME/6-158--------------EAAGQTRTLKLYFIHTKEKAQITYKRNGRYDQKGLQQINRFL--RDWRRNEPTKMDPRLLD---LV
Q98H74_RHILO/14-166--------------GASAETRSLKLYHLHTHEKAEIVYKRNGRYLPEGLRKINIIL--RDWRRNEPTKMDPRLLD---LV
Q8EF76_SHEON/32-182--------------RSTKGVRELSLFNRHTGEYNNGSYWVDGHYQSEVLADFSHLL--RDHRQNVAAPMDKRLFD---LL
Q7CT90_AGRT5/14-166--------------EAAAETRSLKLYYIHTREKAVITFKRNGKYDQKGLQELNRFL--RDWRRNQPTRMDPRLFD---LV

PF08291

Q7Y5M4_BPSP6/6-108------------------------------------KYFKRNEFACRCGCGTSTVD..............AELLQ---VV
Q5LM88_SILPO/18-119------------------------------------PNFSPEEIACRST.GKVGID..............PQAMD---KL
Q8PSL7_METMA/55-157------------------------------------KNFKVKELAATDGARYARIS..............PELVA---GL
Q8VPZ8_RUMAL/197-303------------------------------------PHFHSREFACDCG.NTHTID..............QNLIN---KL
CBPM_STRAL/126-241------------------------------------VNFTYAELNRCNSDWSGGKV..SAATARANA...LVTMW---KL
Q5N402_SYNP6/73-183------------------------------------EHFTVGEVFQFDDFRRQRVT..AENKRRI.....VKLAA---RL
Q8YUC7_NOSS1/127-243------------------------------------NELVVAGIPLTWGEITKGCDPQRNPESKTIINNIIKAAR---GF
Q64TT2_BACFR/11-127------------------------------------KYFTIKELSHSDTAVARGID..NTPTGEVVHNLTELVEN---VL
Q64PK4_BACFR/2-135------------------------------------KYFTIKECTQSSTARARRID..NTPNSEHLAHIRESIET---LV
Q6UGH3_BPSP6/4-106------------------------------------KYFKRNEFACRCGCGTSTVD..............AELLQ---VV
Q6UGC4_9CAUD/4-106------------------------------------KYFKRKEFACRCGCGTSTVD..............AELLQ---VV
Q64PJ8_BACFR/2-135------------------------------------KHFNISECTRSETATAKGID..NTPGVEHLAHIVETVET---LL
Q5NX34_AROAE/55-166------------------------------------AYLQY..LLRDVRANRQGLV..HPQI........VSNLA---WV
Q9AKY5_LEGPN/7-112------------------------------------PNFRRDELKCKHT.GECNMH..............PEMMR---IL
Q64TI5_BACFR/2-118------------------------------------KYFTIKELSHSDTAVARGID..NYPTAEAIHNLTKLVEN---VL
Q88L27_PSEPK/5-119------------------------------------PHFTLDEMTVSQLAAREGFD..NAPPLEARANL.QLLCG---AL
Q92KB7_RHIME/323-423------------------------------------ARLTPSGLILQTEKVETGCF.............KPELLD---IL
Q8CJR3_STRCO/116-230------------------------------------VHFTYAELNKCNSDWSGGAV..SAATAKSNA...LKTMW---KL
Q7MNT8_VIBVY/105-217------------------------------------AHFKWSEFSCNDK......D..NTPVPQDLRTNVKNLAS---QL

PF01085

HH_DROME/85-244CGPGR..GLGRHR.ARNLYPLVLKQTIPNLSEYTNSASGPLEGVIRRDSPKFKDLV--PNYNRDILFRDEEGTGADRLMS
DHHA_XENLA/23-184CGPGRGPVGRRRY.MRKLVPLHYKQFVPNVPEKTLGASGKSEGKIHRGSERFIELV--PNYNPDIIFKDEEKTGADRLMT
IHH_DANRE/24-184CGPGR..GYGKRRTPRKLTPLAYKQFSPNVAEKTLGASGRYEGKVTPSSERFKELT--PNYNPDIIFKDEENTGADRMMT
O17499_BRAFL/28-188CGPGG..RFGRRRHPRKLTPFVYKQQMPAVSENTFGASGLFNGRITRDSERFHTLK--QNFNTDIIFKDEEKTGADRFMT

PF02557

YODJ_BACSU/120-250------------------------------------KRYIRKEAADALKTM.FDAA-----------------KK---E.
Q65US8_MANSM/26-185------------------------------------NHFLQPQALKAFQAL.QKSA-----------------VK---N.
O83250_TREPA/106-230------------------------------------SLLLTKIAYEALHQL.IQAA-----------------AR---D.
Q63C99_BACCZ/98-228------------------------------------KKKMRKEAAGALEEM.FQQA-----------------DK---E.
Q8Y645_LISMO/113-243------------------------------------KAQLRKEAATALEEM.FVAA-----------------NK---D.
VANY_ENTFC/105-222------------------------------------NIYMSKEIAQKFSEM.VNDA-----------------VK---G.
Q7WZ84_9ACTO/63-172------------------------------------LTGLTDGARAAFTAARAEAL-----------------WR---H.
Q5NHB6_FRATT/26-155------------------------------------DLLLEKNTYKAWLEL.KQAA-----------------TD---D.
Q7V800_PROMM/59-190------------------------------------GIELHHEAADALSSM.RAAA-----------------SA---D.
Q7VCA8_PROMA/98-229------------------------------------GLKVHKDTYSALKKM.RAAA-----------------AA---D.
Q55957_SYNY3/161-291------------------------------------SESLDQEAATAFKKM.QADA-----------------QV---Q.
Q632I9_BACCZ/97-214------------------------------------NLRLSKDVVKKFLNV.VDAA-----------------GK---D.
Q7U788_SYNPX/101-232------------------------------------GIVLHLDAANALDAM.LQAG-----------------LA---E.
Q9JN36_ENTGA/31-162------------------------------------DVYLQPEVAKQWERL.VRAT-----------------GL---E.
Q7NI07_GLOVI/108-238------------------------------------PILLHKGAVESYRQL.VQAA-----------------RA---E.
Q9LA11_PAEPP/102-219------------------------------------EIKLSEEIAGKFSEM.IAAA-----------------EE---D.
Q799B4_9PSEU/77-185------------------------------------VTRLDPALLSALRRA.ATAA-----------------AD---G.
Q55454_SYNY3/106-237------------------------------------RLKLRQAAADQFLLM.QRDA-----------------KA---Q.
AEPE_BPA50/18-205------------------------------------AGGMYKITSDKTRNV.IKKM-----------------AK---E.
Q97E20_CLOAB/88-217------------------------------------VNQMESEAATGLENM.FNAA-----------------SK---D.
Q73Q11_TREDE/110-234------------------------------------DIYLAKIAERPLQKL.AEAA-----------------KK---E.
Q9KHM1_ENTFL/124-254------------------------------------GERVNHRIYEPLMEM.LNAA-----------------RE---EN
VANY_ENTFA/114-247------------------------------------GERIDIRISPYLQDL.FDAA-----------------RA---D.
Q5YUU3_NOCFA/122-230------------------------------------TDGLDPALAVAYTLA.EQAA-----------------HA---E.
Q8ESQ8_OCEIH/43-171------------------------------------ASELHPVVEKAKNEL.VDQA-----------------SK---K.
Q8RQJ7_BACCE/14-156------------------------------------NMKIDSRIATSYQDM.VAAA-----------------KK---E.
Q7N3J3_PHOLL/21-178------------------------------------NHRLQPEAANAFFSM.QQAA-----------------EK---A.
Q5QTZ2_IDILO/20-179------------------------------------GHKLHPDAAEAYLAM.QKAA-----------------AA---E.
Q9KHL8_ENTFL/43-173------------------------------------NILMKRDVANVLQLI.FEKI-----------------SA---..
Q8E2A2_STRA5/89-225------------------------------------NIYLDKRITKQATQF.LEAA-----------------RA---I.
Q8K621_STRP3/87-223------------------------------------GISVDKRIEQATSDF.LAAA-----------------QA---I.
Q633S7_BACCZ/108-238------------------------------------KTLLRKDAADALENM.FEAA-----------------KK---E.
Q7V1U4_PROMP/94-224------------------------------------NIQVHIDMSEALLKM.REDA-----------------IK---D.
Q8EEB5_SHEON/50-206------------------------------------RFKLESQTALAFQAM.ADSA-----------------AK---D.
Q9KBW4_BACHD/101-218------------------------------------DIYLSEDVARRFSEM.VAAA-----------------QK---E.
Q8W6J4_9CAUD/231-375------------------------------------IESMKPELQTGLTAMFNEAP-----------------DQ---VK
Q8CU74_STAES/77-207------------------------------------NPGENPKAQKALKQL.FDGA-----------------QK---D.
Q67QI3_SYMTH/121-251------------------------------------RRLMRAEAAAALEEM.FAAA-----------------EE---D.
Q87MI5_VIBPA/23-179------------------------------------AFLMHPDVANDLLNM.IEAA-----------------KK---A.
O51529_BORBU/101-225------------------------------------TIKVRKILIEDLIRL.IKDA-----------------KK---F.
Q5KZM0_GEOKA/119-249------------------------------------KRHMRAEAAAALEEM.FAAA-----------------RR---D.
Q63B61_BACCZ/95-225------------------------------------KSYLRKEAAEALERL.FDLA-----------------NK---E.
Q8PBI7_XANCP/80-208------------------------------------PLWLSAGAARAWRQL.RAAA-----------------LR---E.
Q5WJW5_BACSK/100-228------------------------------------RRYLRVEAAEALEAL.FAAA-----------------AE---E.
Q8DWH5_STRMU/90-226------------------------------------GVKVDSRIAENTRKF.LAAA-----------------QE---I.
Q5MZB2_SYNP6/93-224------------------------------------AIRLRSPAAKAFDEL.QAAA-----------------AR---E.
Q6D7N5_ERWCT/20-177------------------------------------HHRLQPEAVTAFLAL.QHAA-----------------KT---V.
Q5M1U2_STRT1/104-240------------------------------------GVSVDARIAKNVEEF.LATA-----------------QE---I.
Q9CM23_PASMU/28-187------------------------------------HHFLHQDCLVAFQCL.QQSA-----------------AK---H.
Q7VNB4_HAEDU/28-186------------------------------------NHYLQAEVVTAFLGL.QHAA-----------------KR---A.
Q8EZA8_LEPIN/48-196------------------------------------IHYLRKEVLEKLLEL.FQAY-----------------QR---E.
Q93A45_ENTFL/33-163------------------------------------NILVDPMVAIQLEKL.IKTT-----------------GL---D.
Q8YQW0_NOSS1/118-249------------------------------------RIRMRRNAAQRFQEM.AQAA-----------------RT---A.
Q9PEZ7_XYLFA/74-202------------------------------------PLLLTVDAARAWHAM.RQAA-----------------VR---D.
Q8DQQ1_STRR6/87-213------------------------------------NPGENPTAKAELVKL.IKAM-----------------QE---A.
Q7NMR7_GLOVI/149-279------------------------------------KEYLSNEAAWAFTRM.RAAA-----------------AK---A.
Q8XKL5_CLOPE/109-238------------------------------------RNRVSNVLKKDLENL.FSDA-----------------KK---A.
Q9CGZ2_LACLA/85-226------------------------------------GIQVDQRIASAVQQF.LAAA-----------------QQ---I.
Q97KB0_CLOAB/144-267------------------------------------LSSLNPYVALLAQRF.LNLC-----------------TA---N.
Q5QL26_GEOKA/14-137------------------------------------LSGLHPLVADKARAL.IRKA-----------------YE---E.
Q8DKC7_THEEB/90-221------------------------------------QIKLRRAAAERFRAM.VAAA-----------------QQ---E.
Q8EST6_OCEIH/190-320------------------------------------KKYMRQAAADALEEL.FADA-----------------LE---E.
Q6LTW9_PHOPR/50-207------------------------------------QHLLHKDMQPAFAAL.QQAA-----------------QL---A.

PF01427

VANX_ENTFA/1-202------------------------------------MENGFLFLDEMLHGVRWDAK-----------------YA---TW
DDPX_SYNY3/31-240------------------------------------KSLKPHPYAQVGADYQGRSP-----------------YV---LR
DDPX_ECOLI/3-187------------------------------------DTTELVDLAVIFPDLEIELK-----------------YA---CA
VANX_ENTFC/1-202------------------------------------MEIGFTFLDEIVHGVRWDAK-----------------YA---TW
O53850_MYCTU/62-256------------------------------------RAAGLVDVRGVVPDAAIDLR-----------------YA---TA

PF13539

A8ASL5_BPA50/72-136----------------------------------------------------NA.K-----------------GG---Q-
B1QZK9_CLOBU/207-275----------------------------------------------------SG.T-----------------GR---.-
Q3J4T3_RHOS4/201-266----------------------------------------------------RG.G-----------------SA---.-
A1ATB8_PELPD/203-268----------------------------------------------------RG.G-----------------SK---.-
Q6F913_ACIAD/194-260----------------------------------------------------RA.R-----------------GY---Q-
D1PEW6_9BACT/147-232----------------------------------------------------SH.T-----------------HT---.-
A9WTX9_RENSM/144-210----------------------------------------------------ISGS-----------------TD---.-
A3TM69_9MICO/118-184----------------------------------------------------ISGS-----------------TS---.-
A4SFK8_PROVI/119-180----------------------------------------------------NA.R-----------------GG---R-
D4MUA4_9FIRM/428-503----------------------------------------------------RGKN-----------------SS---.-
Q6LSS8_PHOPR/126-215----------------------------------------------------SG.Q-----------------RS---.-
C4L6K0_EXISA/116-185----------------------------------------------------NA.K-----------------AG---Q-
B5PLN0_SALET/45-107----------------------------------------------------KK.G-----------------SG---I-
B2GW16_BURPE/142-232----------------------------------------------------TG.R-----------------AE---.-
Q1QI98_NITHX/92-153----------------------------------------------------RG.S-----------------AT---K-
C4SEH9_YERMO/33-102----------------------------------------------------NG.S-----------------SK---T-
D5U8W6_BRAM5/259-337----------------------------------------------------SK.S-----------------AS---.-
A6LVB0_CLOB8/192-260----------------------------------------------------SG.T-----------------GR---.-
CWLK_BACSU/94-164----------------------------------------------------YA.R-----------------GG---E-
C2N1K8_BACCE/54-120----------------------------------------------------KG.A-----------------SQ---T-
B7RRA8_9RHOB/214-277----------------------------------------------------RGAP-----------------GR---.-
D4I121_ERWAC/54-123----------------------------------------------------SG.K-----------------SQ---T-
B1IKM8_CLOBK/171-239----------------------------------------------------AG.T-----------------NL---.-
B5U3R2_9CAUD/70-134----------------------------------------------------AENS-----------------MA---.-
C9MEJ1_HAEIF/54-128----------------------------------------------------KK.A-----------------TK---T-
A9G830_SORC5/143-223----------------------------------------------------NS.Y-----------------RG---A-
B3VGP8_9CAUD/82-143----------------------------------------------------KNN.-----------------..---.-
C1I574_9CLOT/169-237----------------------------------------------------QD.T-----------------GR---.-
C7NA70_LEPBD/121-197----------------------------------------------------RP.N-----------------GI---.-
E6VS38_DESAO/135-213----------------------------------------------------VG.E-----------------NR---.-
B7VJV8_VIBSL/123-214----------------------------------------------------TG.G-----------------GG---.-
C9MVB8_9FUSO/246-328----------------------------------------------------YA.N-----------------GV---T-
D1CHT9_THET1/273-355----------------------------------------------------TGRP-----------------GV---.-
Q5DN15_9CAUD/21-99----------------------------------------------------RG.A-----------------SK---T-
B3VFY1_9CAUD/64-131----------------------------------------------------PTNS-----------------VA---.-
A0RNH9_CAMFF/569-634----------------------------------------------------SK.T-----------------DL---.-
A3UWI6_VIBSP/67-136----------------------------------------------------QL.D-----------------GY---S-
Q8ESQ8_OCEIH/97-167----------------------------------------------------HA.Q-----------------GG---E-
A7XF57_9CAUD/52-120----------------------------------------------------EG.K-----------------SK---T-
C6LLE4_9FIRM/274-349----------------------------------------------------RGG.-----------------..---.-
C4Z3D8_EUBE2/109-193----------------------------------------------------SY.S-----------------TK---.-
B2U374_SHIB3/219-287----------------------------------------------------TG.K-----------------SQ---T-
E6VQR6_DESAO/135-213----------------------------------------------------AG.K-----------------DV---.-
Q2SJV2_HAHCH/187-252----------------------------------------------------T..P-----------------AK---.-
B5UY55_BACCE/196-257----------------------------------------------------NA.R-----------------GG---E-
B7GIP5_ANOFW/70-132----------------------------------------------------NA.K-----------------GG---Y-
B4AH26_BACPU/73-136----------------------------------------------------NA.K-----------------GG---Q-
B3VGG0_9CAUD/70-142----------------------------------------------------QDNS-----------------VD---.-
Q1ZSD0_PHOAS/130-219----------------------------------------------------EG.T-----------------SS---.-
C8XIK2_NAKMY/139-205----------------------------------------------------VNNP-----------------SV---.-
D9SKR7_CLOC7/252-312----------------------------------------------------NA.K-----------------AG---Q-
C7R275_JONDD/65-131----------------------------------------------------IRGA-----------------ST---.-
C3WMV9_9FUSO/63-140----------------------------------------------------NV.D-----------------GY---K-
A8ATB8_9CAUD/56-121----------------------------------------------------NG.K-----------------SQ---T-
C6ANB6_AGGAN/178-255----------------------------------------------------SG.T-----------------KR---.-
A6FEU3_9GAMM/129-218----------------------------------------------------AG.K-----------------RS---.-
A7ILH7_XANP2/449-509----------------------------------------------------ND.P-----------------SK---.-
Q854X2_9CAUD/66-133----------------------------------------------------PTNS-----------------VA---.-
C9QJ38_VIBOR/123-214----------------------------------------------------TG.G-----------------TS---.-
Q7D1F2_AGRT5/53-126----------------------------------------------------RG.A-----------------SK---T-
Q2P050_XANOM/208-274----------------------------------------------------RA.G-----------------SW---Q-
A5MZT7_CLOK5/187-255----------------------------------------------------SG.T-----------------SL---.-
B1YFG8_EXIS2/71-136----------------------------------------------------YA.K-----------------GG---K-
Q0RZ25_RHOSR/75-142----------------------------------------------------WDND-----------------IA---.-
C4SJV6_YERFR/38-106----------------------------------------------------AG.A-----------------SQ---T-
A6SU28_JANMA/93-182----------------------------------------------------TN.G-----------------KA---.-
C6RGB5_9PROT/616-681----------------------------------------------------EG.T-----------------KR---.-
B2S3I3_TREPS/209-287----------------------------------------------------SD.S-----------------RQ---.-
C4ZCU4_EUBR3/194-278----------------------------------------------------SH.T-----------------TK---.-
Q7NS81_CHRVO/52-121----------------------------------------------------QG.A-----------------SR---T-
D4J1D4_BUTFI/117-201----------------------------------------------------SH.T-----------------TK---.-
A9DC71_9RHIZ/63-156----------------------------------------------------KS.G-----------------KA---.-
B9KTY8_RHOSK/205-268----------------------------------------------------RGST-----------------SS---.-
Q1B8J0_MYCSS/185-266----------------------------------------------------PGSQ-----------------A.---.-
A3ID77_9BACI/3-33----------------------------------------------------T...-----------------..---.-
A1SG61_NOCSJ/370-446----------------------------------------------------TGRP-----------------GV---.-
A7HN00_FERNB/195-263----------------------------------------------------AN.S-----------------NQ---.-
B5EIM6_GEOBB/377-491----------------------------------------------------PGRP-----------------GV---.-
A9WKC4_CHLAA/591-661----------------------------------------------------RSNP-----------------TT---.-
Q4ES87_LISMN/56-121----------------------------------------------------SG.A-----------------SQ---T-
C8T4A1_KLEPR/54-122----------------------------------------------------QG.K-----------------SM---T-
B2FJL7_STRMK/100-166----------------------------------------------------QV.G-----------------RG---S-
C9S248_GEOSY/68-133----------------------------------------------------NA.R-----------------GG---Y-
A6TN75_ALKMQ/198-278----------------------------------------------------EG.T-----------------QR---.-
D4E385_SEROD/163-231----------------------------------------------------TG.K-----------------SQ---T-
A3X9V1_9RHOB/202-265----------------------------------------------------RGTT-----------------NS---.-
D1AMG7_SEBTE/126-206----------------------------------------------------TG.K-----------------KS---.-
E8WNQ9_GEOS8/380-487----------------------------------------------------PGKP-----------------GV---.-
D2AZ54_STRRD/158-239----------------------------------------------------TGSS-----------------S.---.-
B1YI53_EXIS2/118-187----------------------------------------------------NA.R-----------------GG---E-
C0D0F9_9CLOT/238-322----------------------------------------------------TG.G-----------------GK---.-
C4K5R3_HAMD5/92-182----------------------------------------------------TG.G-----------------AS---.-
Q0A7S9_ALHEH/202-267----------------------------------------------------RG.G-----------------SS---.-
B2K031_YERPB/45-107----------------------------------------------------RA.G-----------------TG---I-
D2PPJ5_KRIFD/298-379----------------------------------------------------TGNP-----------------YA---.-
B4SDT7_PELPB/113-173----------------------------------------------------NA.K-----------------GG---F-
Q2B7L2_9BACI/116-186----------------------------------------------------NA.K-----------------GG---E-
D1ALL6_SEBTE/63-140----------------------------------------------------SL.D-----------------GY---N-
B0MC55_9FIRM/144-230----------------------------------------------------EG.T-----------------SH---.-
A7ZD12_CAMC1/602-665----------------------------------------------------AG.T-----------------NR---.-
Q3STE6_NITWN/103-162----------------------------------------------------AG.S-----------------KN---.-
A5ECX3_BRASB/184-253----------------------------------------------------AD.T-----------------GR---.-
A9KN76_CLOPH/502-575----------------------------------------------------LS.Q-----------------ST---L-
A7FDS7_YERP3/58-127----------------------------------------------------NG.H-----------------SK---T-
D1B2W5_SULD5/592-657----------------------------------------------------AG.T-----------------NR---.-
C8X9H1_NAKMY/210-289----------------------------------------------------TGGV-----------------G.---.-
A0NQA8_9RHOB/173-238----------------------------------------------------RG.G-----------------SN---.-
B9NP89_9RHOB/203-268----------------------------------------------------RG.G-----------------NT---.-
B0NZY2_9CLOT/146-232----------------------------------------------------SG.T-----------------TK---.-
B1JRT0_YERPY/56-124----------------------------------------------------KG.A-----------------SQ---T-
Q5WK03_BACSK/108-178----------------------------------------------------NA.K-----------------GG---Q-
C9XQ42_CLODC/189-268----------------------------------------------------AG.T-----------------NV---.-
B3Q3Z4_RHIE6/222-285----------------------------------------------------RGSA-----------------KS---.-
C4XNT5_DESMR/200-269----------------------------------------------------AG.T-----------------RR---.-
A5UTX9_ROSS1/590-659----------------------------------------------------DDTA-----------------DS---.-
D3EJK7_GEOS4/101-171----------------------------------------------------NA.K-----------------AG---E-
D4BTB0_PRORE/43-105----------------------------------------------------AN.G-----------------SG---I-
D3ADD3_9CLOT/85-148----------------------------------------------------NA.P-----------------GS---S-
Q7VJM2_HELHP/173-242----------------------------------------------------AD.S-----------------PN---.-
Q7MR54_WOLSU/185-254----------------------------------------------------AG.S-----------------SI---.-
A9DET4_9CAUD/64-132----------------------------------------------------KG.A-----------------SK---T-
C0CNE7_9FIRM/225-310----------------------------------------------------TG.G-----------------GA---.-
C6LBK9_9FIRM/257-343----------------------------------------------------SG.S-----------------RS---.-
B9JYE5_AGRVS/104-165----------------------------------------------------RG.K-----------------SA---.-
D9QLQ3_BRESC/53-121----------------------------------------------------AG.A-----------------SR---T-
B0VVC4_ACIBS/347-415----------------------------------------------------NA..-----------------.G---P-
C4K6W4_HAMD5/53-119----------------------------------------------------KG.A-----------------SK---T-
B2UP36_AKKM8/129-194----------------------------------------------------IG.G-----------------KA---.-
C4L144_EXISA/57-123----------------------------------------------------KG.V-----------------SG---T-
Q97KB0_CLOAB/198-263----------------------------------------------------DA.Q-----------------GG---D-
Q856Y8_9CAUD/70-151----------------------------------------------------EDNS-----------------VY---.-
Q5J5L5_9CAUD/70-137----------------------------------------------------PTNS-----------------VP---.-
D0LWT6_HALO1/218-298----------------------------------------------------RH.D-----------------PK---R-
A4G1C9_HERAR/140-229----------------------------------------------------TN.G-----------------DA---.-
Q0FH91_9RHOB/197-262----------------------------------------------------RG.G-----------------SS---.-
D4CCJ4_9CLOT/58-129----------------------------------------------------NA.K-----------------GS---S-
D0LQS8_HALO1/317-391----------------------------------------------------QDAD-----------------KR---A-
B6V2R4_BPSP1/74-136----------------------------------------------------NA.R-----------------GG---Y-
Q7WHP8_BORBR/53-127----------------------------------------------------QG.V-----------------SQ---T-
A9KQC6_CLOPH/237-321----------------------------------------------------EG.T-----------------TT---.-
C6WMZ1_ACTMD/132-213----------------------------------------------------TGGT-----------------A.---.-
A3K5D3_9RHOB/148-231----------------------------------------------------AG.T-----------------SR---.-
A4FKJ2_SACEN/154-235----------------------------------------------------PGSG-----------------R.---.-
Q5YZK4_NOCFA/71-135----------------------------------------------------RENL-----------------VR---.-
Q1DAC7_MYXXD/63-125----------------------------------------------------K..A-----------------SP---A-
D1BDT0_SANKS/65-131----------------------------------------------------IAGS-----------------TD---.-
C7N3P8_SLAHD/215-297----------------------------------------------------PG.T-----------------TV---.-
A6Q7D6_SULNB/126-212----------------------------------------------------TG.S-----------------KN---.-
B6VNP6_PHOAA/57-126----------------------------------------------------DG.H-----------------SQ---T-
Q73V53_MYCPA/145-206----------------------------------------------------PG.S-----------------DR---.-
D7VN70_9SPHI/69-137----------------------------------------------------NA.K-----------------GG---Q-
B5LJL3_9CAUD/69-133----------------------------------------------------ATND-----------------VW---.-
A8LRY3_DINSH/108-171----------------------------------------------------RNSR-----------------SA---.-
C9MWB5_9FUSO/152-227----------------------------------------------------R..G-----------------SF---.-
D0LZM8_HALO1/111-191----------------------------------------------------AG.T-----------------ER---.-
C9DBZ2_9CAUD/70-142----------------------------------------------------QDNT-----------------VD---.-
D7VVF1_9FLAO/66-136----------------------------------------------------NA.K-----------------AG---Q-
Q2SDK8_HAHCH/53-121----------------------------------------------------AR.K-----------------SK---T-
C7RR41_ACCPU/164-241----------------------------------------------------QG.T-----------------KR---.-
A1SCY8_NOCSJ/370-428----------------------------------------------------AG.S-----------------TT---.-
B6FXG7_9FIRM/394-474----------------------------------------------------AG.T-----------------KV---.-
B6WQA8_9DELT/218-285----------------------------------------------------AG.E-----------------QR---.-
A4T1K8_MYCGI/149-230----------------------------------------------------PGSD-----------------S.---.-
Q7NR04_CHRVO/206-271----------------------------------------------------QA.K-----------------GG---E-
D4CX41_9FUSO/55-123----------------------------------------------------QG.K-----------------SK---T-
B8J0M5_DESDA/248-315----------------------------------------------------AG.E-----------------TR---.-
A8EV90_ARCB4/175-243----------------------------------------------------SR.T-----------------NR---.-
C6PUE1_9CLOT/429-508----------------------------------------------------RD.S-----------------DS---.-
D9SMB1_CLOC7/196-264----------------------------------------------------SG.T-----------------GR---.-
Q73JG3_TREDE/215-293----------------------------------------------------AD.S-----------------GK---.-
B8ENP1_METSB/622-688----------------------------------------------------RGST-----------------TT---.-
C8Q0B7_9GAMM/78-152----------------------------------------------------TW.L-----------------NN---P-
C0QJJ2_DESAH/140-230----------------------------------------------------AG.G-----------------SR---.-
Q5DZ88_VIBF1/125-214----------------------------------------------------VG.K-----------------SS---.-
C9MUL4_9FUSO/1065-1128----------------------------------------------------KA.A-----------------PG---K-
C6D2R3_PAESJ/123-193----------------------------------------------------NV.K-----------------GG---A-
D1PX89_9BACT/178-263----------------------------------------------------KG.S-----------------RK---.-
C3XMD6_9HELI/163-232----------------------------------------------------AN.T-----------------DR---.-
Q70K75_9ACTO/100-167----------------------------------------------------PPTN-----------------AT---.-
C3K4K2_PSEFS/131-227----------------------------------------------------TG.R-----------------PG---.-
Q2LPY2_SYNAS/102-181----------------------------------------------------FI.A-----------------GT---R-
A8GLN1_SERP5/79-147----------------------------------------------------TG.K-----------------SQ---T-
C0AQZ5_9ENTR/54-123----------------------------------------------------EG.K-----------------SK---T-
D1RF68_LEGLO/59-140----------------------------------------------------TDRP-----------------GE---.-
C6BUG1_DESAD/184-249----------------------------------------------------RQ.G-----------------SR---.-
Q2LQQ3_SYNAS/55-131----------------------------------------------------KI.V-----------------TW---T-
C7PFT3_CHIPD/191-256----------------------------------------------------RGSR-----------------KT---.-
A8ATR6_9CAUD/73-134----------------------------------------------------NA.K-----------------GG---Q-
C0ZX75_RHOE4/85-149----------------------------------------------------AAND-----------------VA---.-
D0DDG3_9RHOB/197-267----------------------------------------------------SG.T-----------------DR---.-
A6W8P6_KINRD/95-156----------------------------------------------------RN.P-----------------KY---.-
A7HJ25_FERNB/74-137----------------------------------------------------KI.V-----------------TY---L-
B4WAV9_9CAUL/53-121----------------------------------------------------AG.A-----------------SR---T-
D2XRK5_9CAUD/70-137----------------------------------------------------PTNS-----------------VP---.-
B5EHY6_GEOBB/165-227----------------------------------------------------RGSP-----------------R.---.-
B1YH87_EXIS2/72-135----------------------------------------------------NA.R-----------------GG---Q-
A7ZFD8_CAMC1/46-110----------------------------------------------------TG.K-----------------SK---T-
B8KYV5_9GAMM/51-117----------------------------------------------------SV.G-----------------AF---S-
B2VDM6_ERWT9/41-110----------------------------------------------------SG.K-----------------SH---T-
B9JF39_AGRRK/850-911----------------------------------------------------AG.T-----------------NK---.-
E3I7F8_RHOVT/190-269----------------------------------------------------AR.T-----------------TR---.-
A1K513_AZOSB/150-214----------------------------------------------------AA.R-----------------AW---E-
B4V6Z2_9ACTO/133-214----------------------------------------------------VGDP-----------------AK---.-
D0TJH0_9BACE/157-246----------------------------------------------------TGST-----------------TK---.-
Q0AVH5_SYNWW/269-331----------------------------------------------------DS.A-----------------KG---.-
D3VE22_XENNA/59-122----------------------------------------------------AK.K-----------------SQ---T-
A8S209_9CLOT/64-127----------------------------------------------------NA.P-----------------GS---N-
C6VVI7_DYAFD/85-145----------------------------------------------------RG.S-----------------SG---.-
C4SXE4_YERIN/30-99----------------------------------------------------TD.K-----------------SQ---T-
A5FFV9_FLAJ1/170-242----------------------------------------------------SG.T-----------------NR---.-
B2Q011_PROST/55-124----------------------------------------------------NG.Q-----------------SQ---T-
Q98H40_RHILO/198-268----------------------------------------------------AG.T-----------------DQ---.-
D1AEC5_THECD/163-244----------------------------------------------------TG.S-----------------GN---.-
D4DZ54_SEROD/54-122----------------------------------------------------EG.K-----------------SQ---T-
Q1MS64_LAWIP/228-297----------------------------------------------------AG.E-----------------KR---.-

PF03411

MEPA_SHIFL/35-274------------------------------------QSIGSFSNGCIVGADTLPIQ-----------------SE---HY
Q44614_BRUAO/61-309------------------------------------QSIGFYAKGCLAGAVALPTD-----------------GP---NW
MEPA_HAEIN/42-281------------------------------------SPIGSYTNGCIIGAQALPPK-----------------GE---GY

PF05951

Q9CNZ9_PASMU/32-183YRLQASLGL--------RNTEIQIICGYRSPVSNAAMHRRSRG-VASN--------------------------------
Q9A852_CAUCR/63-213DQIARKTQS--------KGP.FQVISGYRSPATNRLLSKRSGE-VAKK--------------------------------
E8VLY5_VIBVM/19-169TQIQKLIGT--------ENE.VQIISGYRSPQTNAALRAKSSG-VAKK--------------------------------
Q8YE08_BRUME/24-176WQVYQSTGS--------REY.ITVVSAYRSPATNAMLRSSTRG-VAKK--------------------------------
Q9KSI7_VIBCH/29-179CQIQLLLGT--------QAE.VHIVSGYRSPATNKQLRSKSKG-VAKK--------------------------------
Q989B8_RHILO/15-167WQAYRASGS--------SAY.IHVVSAYRSPATNAMLRSRSKG-VARE--------------------------------
Q92JX1_RHIME/6-158WEVYQKSGS--------RDY.IHVVSAYRSPATNGMLRSRSKG-VAKK--------------------------------
Q98H74_RHILO/14-166WEAYRESGA--------TDY.IQVVCGYRSPATNSMLRSRSRG-VAEK--------------------------------
Q8EF76_SHEON/32-182YTLKSTLNT--------DKE.IHVISGYRSPKTNAMLAGKSGG-VAKK--------------------------------
Q7CT90_AGRT5/14-166WEVYRRSGA--------TDY.INVVSAFRSPETNGLLRTRTKG-VAEK--------------------------------

PF08291

Q7Y5M4_BPSP6/6-108TDVREYFGL..........P-VVITSGHRCSDHNRRV-----G-GAAS--------------------------------
Q5LM88_SILPO/18-119QALRDRLGA..........P-LMLNSAYRSPEHNRAE-----G-GAPA--------------------------------
Q8PSL7_METMA/55-157QRIRDRVGS..........A-VVLNSGYRHNVLNETV-----G-GADE--------------------------------
Q8VPZ8_RUMAL/197-303EQLYTKLNC.........SK-IIVNSGYRDPNCSVAV-----G-GGYD--------------------------------
CBPM_STRAL/126-241QAMRHAMGD.........KP-ITVNGGFRSVTCNSNV-----G-GASN--------------------------------
Q5N402_SYNP6/73-183DVLRKQFG...........P-LGVTSWFRDPVTNARV-----G-GVDD--------------------------------
Q8YUC7_NOSS1/127-243GKIRDKYDS..........P-ISINSAYRTSAVNRRI-----G-GARF--------------------------------
Q64TT2_BACFR/11-127DPLREKYGK..........P-IRVSSGYRSAVLNRSV-----N-GATS--------------------------------
Q64PK4_BACFR/2-135DPLREAWAEHCRMAKLGTAG-IRISSGYRGPKLNAAV-----G-GSRT--------------------------------
Q6UGH3_BPSP6/4-106TDVREYFGL..........P-VVITSGHRCSDHNRRV-----G-GAAS--------------------------------
Q6UGC4_9CAUD/4-106TDVREHFGS..........P-VVITSGHRCAKHNANV-----G-GAKN--------------------------------
Q64PJ8_BACFR/2-135DPLRDAWEDYCHHLGLGTPG-IRISSGYRGPVLNAAV-----G-GSIT--------------------------------
Q5NX34_AROAE/55-166QAWLAHWGL........KAP-IVATSGLRTEVTNREV-----G-GAHQ--------------------------------
Q9AKY5_LEGPN/7-112QDIRNELGR..........P-IFISSGYRSVKHPVEQ-----E-KDKP--------------------------------
Q64TI5_BACFR/2-118DPLREKYGK..........P-IRVSSGYRSAILNRSV-----N-GATS--------------------------------
Q88L27_PSEPK/5-119EQVRALFDA..........P-IIISSGYRSERVNRLI-----G-GASD--------------------------------
Q92KB7_RHIME/323-423KTVEGHYGR..........K-VMVTSGLRAIKVNRK.-----.-..RQ--------------------------------
Q8CJR3_STRCO/116-230EAMRHALGD.........VP-ITISSGFRSRACNSAV-----G-GSST--------------------------------
Q7MNT8_VIBVY/105-217EVIRSEIGK..........P-IKITSAYRTPEYNRKI-----G-GATN--------------------------------

PF01085

HH_DROME/85-244KRCKEKLNV----------LAYSVMNEWPGIRLLVTESWDEDYHHGQE--------------------------------
DHHA_XENLA/23-184ERCKDRVNA----------LAISVMNMWPGVKLRVTEGWDEDGHHAHD--------------------------------
IHH_DANRE/24-184QRCKDKLNS----------LAISVMNLWPGVRLRVTEGWDEDGLHSEE--------------------------------
O17499_BRAFL/28-188QRCKDKLNA----------LAISVMNQWEGVKLRVTEGWDEDGFHTEE--------------------------------

PF02557

YODJ_BACSU/120-250.GY....ELA..........-.A.VSGYRSYDRQKVIF..DNEVS..................LKGERKAKEAVAYPGE-
Q65US8_MANSM/26-185.GF....NLQ..........-.P.ASTFRDFARQQLIWNGKFNGERKVHDDQGNPLDLTALSCWEKAQAILRWSALPGA-
O83250_TREPA/106-230.GV....ALS..........-.V.GSAYRSFAYQKKLF..SWYAQ..................EHGMQEAMRFSAREGT-
Q63C99_BACCZ/98-228.RV....FLF..........-.A.VSGFRSFDRQKALN..TMYKK..................QDGEAKTAMSSAVPGT-
Q8Y645_LISMO/113-243.GK....KLF..........-.A.VSGYRSYKRQQEVF..QAEVN..................AKGDQKAREAVAYPGT-
VANY_ENTFC/105-222.GV....SHF..........-.IINSGYRDFDEQSVLY............................QEMGAEYALPAGY-
Q7WZ84_9ACTO/63-172.GQ....LVG..........-.L.TSGYRDPRVQQRMF..EEEVR.................RSGSVAAARMFVAPPAE-
Q5NHB6_FRATT/26-155.GI....SLF..........-.I.VSGFRSYEYQQKII.DRKLAN..................GQTLEEIIRVNALPGE-
Q7V800_PROMM/59-190.GV....DLR..........-.L.LSGYRSHDLQERIFFDIKSDR..................NQTAAERAKVSAPPGY-
Q7VCA8_PROMA/98-229.GI....YLT..........-.A.LSGFRSIDLQREIFYENKSIR..................NQIAIERAKVSAPPGY-
Q55957_SYNY3/161-291.GV....RLT..........-.I.ISGFRSIASQDALF.QNQIKR..................KGGKEAAARFSAPPGH-
Q632I9_BACCZ/97-214.GV....QHF..........-.LMNSGYRDFQEQRQLY............................EKMGSDYALPAGY-
Q7U788_SYNPX/101-232.GV....DLR..........-.L.LSGYRSLALQESIFFDIASER..................NQTAEERAQVSAPPGY-
Q9JN36_ENTGA/31-162.K.....DIR..........-.L.VDGYRTEKEQRRLW..EYSLK..................ENGLAYTKQFVALPGC-
Q7NI07_GLOVI/108-238.GV....ILV..........-.T.LSGFRSERYQQEVY.ARQLGK..................AGTTSTATLINAPPGY-
Q9LA11_PAEPP/102-219.GV....SNF..........-.LISSGYRDLDEQSRLY............................EEMGSDFALPAGH-
Q799B4_9PSEU/77-185.GV....ELC..........-.V.NSGWRSPEYQSRLL.REAVAK..................YGSAAAAARWVATPET-
Q55454_SYNY3/106-237.GI....SLV..........-.P.ISAFRTVTEQEQLFFDIKQQR..................NQEARQRAEVSAPPGY-
AEPE_BPA50/18-205.GI....YLC..........-.V.AQGYRSTAEQNALY.....AQ..................GRTKPGAIVTNAKGGQ-
Q97E20_CLOAB/88-217.GL....TLL..........-.A.VSGYRPYSYQQKLY..NEKVA..................RDGKAEADKYVAEPGT-
Q73Q11_TREDE/110-234.GI....EIM..........-.I.SSGYRSYIYQANLF..SKYVN..................VYGKKDVQFFSAPPGA-
Q9KHM1_ENTFL/124-254WGE....LPM..........-.V.VSGYRTQEKQQSLY..DEKIAKFKK.........EGYSDSEAVRQAEQWVAVPGH-
VANY_ENTFA/114-247.GV....YPI..........-.V.ASGYRTTEKQQEIM..DEKVAEYKA.........KGYTSAQAKAEAETWVAVPGT-
Q5YUU3_NOCFA/122-230.GV....PLS..........-.I.TSGYRTPAEQQALW.EDGLAT..................YGSPEEARRWVLPPEE-
Q8ESQ8_OCEIH/43-171.DI....DVM..........-.I.TDEVRSKERQDELY.....AR..................GRTTEGTVVTHAQGGE-
Q8RQJ7_BACCE/14-156.GI....HLY..........-.L.RSGYRAIKLQQTYY..DASVKSYKS.........QGLSDKEASAKALEYLQYPGA-
Q7N3J3_PHOLL/21-178.GI....NLQ..........-.P.ASTFRDFQRQQAIWNGKFRGERPVLDENSQPMDITQLSEGERCKAILRWSALPGG-
Q5QTZ2_IDILO/20-179.GI....ELA..........-.I.ASGFRSLDRQLSIWNRKWRGKLPLRSKEGELLDASNLSDVEKMHAILHWSSLPGS-
Q9KHL8_ENTFL/43-173.GN....SIV..........-.P.VSGYRSLEEQTAIY..DGSLK..................DNGEDFTRKYVALPNH-
Q8E2A2_STRA5/89-225.DS....REH..........-.L.ISGYRSVAYQEKLF..NSYVTQEMTS.......NPNLTRGQAEKLVKTYSQPAGA-
Q8K621_STRP3/87-223.DP....QEH..........-.L.ISGYRSVAYQAELY..QSYIKKEMAN.......DPTLTQEAAEALVQTYLQPPGA-
Q633S7_BACCZ/108-238.GL....ELT..........-.A.VSGYRSYKRQKSLH..DTYVR..................RQGKAEADSVSAIPGT-
Q7V1U4_PROMP/94-224.GI....YLV..........-.F.LSGYRSINLQKEIFYSLKSMR..................NQIAAERAKVSAPPGY-
Q8EEB5_SHEON/50-206.GI....KLA..........-.I.CSAYRPFDRQLAIWNAKASGKRVVLDINEQPVDITPLSESELVDLILLWSALPGA-
Q9KBW4_BACHD/101-218.GV....SHF..........-.LVSSGFRDFEEQRELY............................EERGAAYALPAGH-
Q8W6J4_9CAUD/231-375SGL....DILSGARSPERQA-QIIAENAKKYGLDRKAWLADVAEYGPEEA.......GRRWRPQFKASGMSKNIGAPGG-
Q8CU74_STAES/77-207.DI....HLY..........-.K.ISGYRSYPTQVKLY..NNYVK..................RDGKKAADKYSARPGY-
Q67QI3_SYMTH/121-251.GI....YLA..........-.G.VSGYRSYEYQEALF..ASYVS..................TDGLELAERYSARPGH-
Q87MI5_VIBPA/23-179.GF....KME..........-.I.ASGFRDFSRQRAIWNGKYEGELPILDSNSQPLNKAALSDEEKLKAILRWSALPGG-
O51529_BORBU/101-225.GI....EIK..........-.I.KSAYRTQEYQKFLF..DYNVK..................TYGRKVAETQSAIPGH-
Q5KZM0_GEOKA/119-249.GI....ELV..........-.A.VSAYRSYERQQVIF..AEEVR..................QKGKEKAVQAVAHPGQ-
Q63B61_BACCZ/95-225.GI....QLN..........-.A.VSGFRSYDYQKKLY..ANNVK..................RKGQEHTDRFSAKPGH-
Q8PBI7_XANCP/80-208.DV....VLD..........-.A.ISGYRSHDYQLGIF.ERKFAR..................GLTLAQILAVNAAPGF-
Q5WJW5_BACSK/100-228.GY....DLF..........-.A.ISGFRSYERQELLY..EEALE..................NQGEDQ..DLVAMPGH-
Q8DWH5_STRMU/90-226.DS....SEH..........-.L.ISGYRSVAYQEELY..NNYIAQEKAN.......NPSLSQEEAQKQVQTYSQPPGS-
Q5MZB2_SYNP6/93-224.GV....RLV..........-.P.LSGFRSKKDQEALFFDVKAER..................NQSVTERASVSAPPGY-
Q6D7N5_ERWCT/20-177.GF....NLQ..........-.P.ASTFRDFERQRQIWNSKFRGERAVMDANSQPLDISSLDDGERCEAILRWSAMPGS-
Q5M1U2_STRT1/104-240.NP....SYH..........-.L.ISGYRSVAYQTELY..NSYVQQEMAD.......DPTLTESQAEKKVQTYSQPPGA-
Q9CM23_PASMU/28-187.GF....NLQ..........-.P.ASSFRDFQRQQAIWNAKFYGERKVHDDQGNPLDLSTLSDWEKVQAILRWSALPGG-
Q7VNB4_HAEDU/28-186.DF....NLQ..........-.P.ASTYRDFNRQMLIWNAKFNGKRKIHNDASKQIDITTLTDLAKIKAILRWSAVPGA-
Q8EZA8_LEPIN/48-196.NPSEKQKPF..........-.I.VSAFRSFKDQKGIWEEKYSGKRKMRES......VKGKTPQEIISLILEFSSAPGT-
Q93A45_ENTFL/33-163.S.....QII..........-.T.IDGYRSKETQQALW..DETIQ..................EKGLEFAHKYVAKPGC-
Q8YQW0_NOSS1/118-249.GV....ILM..........-.P.ISGFRSVKEQEQLFFAIGAQR..................NQTPAQRAALSAPPGH-
Q9PEZ7_XYLFA/74-202.GI....VLD..........-.A.ISGYRSYAYQFGIF.ENKLAQ..................GKTLQEILTVNAAPGF-
Q8DQQ1_STRR6/87-213.GF....PIS..........-.DHYSGFRSYETQTKLY..QDYVN..................QDGKEAADRYSARPGY-
Q7NMR7_GLOVI/149-279.GV....RLI..........-.L.ISGFRDRTRQARIF.AKQIAR..................KGSLAAALKLVAPPGF-
Q8XKL5_CLOPE/109-238.GL....DLY..........-.L.SCAYRSYEEQEYLY..GRALE..................KE.KSDSSNLVALPGT-
Q9CGZ2_LACLA/85-226.SP....AEH..........-.L.ISGYRSVSYQEGLY..QSYVQAEMNGQGTVNSSGNPISEEEAIKNVQTYSQPPRS-
Q97KB0_CLOAB/144-267.GL....NVR..........-.V.IQAFRSWYEQDQLY.....TQ..................GRTMPGNIVTDAQGGD-
Q5QL26_GEOKA/14-137.GI....YII..........-.I.TQGFRTVEEQNRLY.....AL..................GRTKPGRIVTNARGGY-
Q8DKC7_THEEB/90-221.GV....VLI..........-.P.LSGFRSTQDQDYLFFEVKEHR..................AQRASERALVSAPPGY-
Q8EST6_OCEIH/190-320.NL....ELY..........-.A.QSGYRSYDRQDNIF..AANAA..................ENGEKHANTFSARPGE-
Q6LTW9_PHOPR/50-207.GF....DLQ..........-.L.ASAFRPFERQLLIWNNKFNGLRPLLDSNSQPLDASALSKLEKIEAILRWSALPGA-

PF01427

VANX_ENTFA/1-202DNFTGKPVDG--------------YEVNRIIGTKAVAL-ALREAQIHAAALGYGLLLWDGYRPKSAVDCFLRWAAQPEDN
DDPX_SYNY3/31-240TGVLKR...L--------------DQARLTLADIEPSW-EILVFDAYRPIAVQQFMVDHTFAEIVARDGLQGQVLTPEQK
DDPX_ECOLI/3-187DNITGK..AI--------------YQQARCLLHKDAIT-ALAKSISIAQLSGLQLVIYDAYRPQQAQ..AMLWQACPDPQ
VANX_ENTFC/1-202DNFTGKPVDG--------------YEVNRIVGTYELAE-SLLKAKELAATQGYGLLLWDGYRPKRAVNCFMQWAAQPENN
O53850_MYCTU/62-256NNFTGT.QLY--------------PPGARCLVHESMAE-GLAAAAAVLRPHGQVLVFWDCYRPHDVQ..VRMFDVVPNPA

PF13539

A8ASL5_BPA50/72-136-..-----------------------------------------------------------------------------
B1QZK9_CLOBU/207-275-.L-----------------------------------------------------------------------------
Q3J4T3_RHOS4/201-266-.L-----------------------------------------------------------------------------
A1ATB8_PELPD/203-268-.W-----------------------------------------------------------------------------
Q6F913_ACIAD/194-260-..-----------------------------------------------------------------------------
D1PEW6_9BACT/147-232-.V-----------------------------------------------------------------------------
A9WTX9_RENSM/144-210-.L-----------------------------------------------------------------------------
A3TM69_9MICO/118-184-.L-----------------------------------------------------------------------------
A4SFK8_PROVI/119-180-..-----------------------------------------------------------------------------
D4MUA4_9FIRM/428-503-..-----------------------------------------------------------------------------
Q6LSS8_PHOPR/126-215-.L-----------------------------------------------------------------------------
C4L6K0_EXISA/116-185-..-----------------------------------------------------------------------------
B5PLN0_SALET/45-107-TN-----------------------------------------------------------------------------
B2GW16_BURPE/142-232-.W-----------------------------------------------------------------------------
Q1QI98_NITHX/92-153-.W-----------------------------------------------------------------------------
C4SEH9_YERMO/33-102-LN-----------------------------------------------------------------------------
D5U8W6_BRAM5/259-337-.R-----------------------------------------------------------------------------
A6LVB0_CLOB8/192-260-.L-----------------------------------------------------------------------------
CWLK_BACSU/94-164-..-----------------------------------------------------------------------------
C2N1K8_BACCE/54-120-MR-----------------------------------------------------------------------------
B7RRA8_9RHOB/214-277-.T-----------------------------------------------------------------------------
D4I121_ERWAC/54-123-LN-----------------------------------------------------------------------------
B1IKM8_CLOBK/171-239-.L-----------------------------------------------------------------------------
B5U3R2_9CAUD/70-134-.N-----------------------------------------------------------------------------
C9MEJ1_HAEIF/54-128-MN-----------------------------------------------------------------------------
A9G830_SORC5/143-223-EI-----------------------------------------------------------------------------
B3VGP8_9CAUD/82-143-.G-----------------------------------------------------------------------------
C1I574_9CLOT/169-237-.L-----------------------------------------------------------------------------
C7NA70_LEPBD/121-197-.E-----------------------------------------------------------------------------
E6VS38_DESAO/135-213-.L-----------------------------------------------------------------------------
B7VJV8_VIBSL/123-214-.W-----------------------------------------------------------------------------
C9MVB8_9FUSO/246-328-SK-----------------------------------------------------------------------------
D1CHT9_THET1/273-355-.W-----------------------------------------------------------------------------
Q5DN15_9CAUD/21-99-MN-----------------------------------------------------------------------------
B3VFY1_9CAUD/64-131-.T-----------------------------------------------------------------------------
A0RNH9_CAMFF/569-634-.L-----------------------------------------------------------------------------
A3UWI6_VIBSP/67-136-KK-----------------------------------------------------------------------------
Q8ESQ8_OCEIH/97-167-..-----------------------------------------------------------------------------
A7XF57_9CAUD/52-120-MK-----------------------------------------------------------------------------
C6LLE4_9FIRM/274-349-.H-----------------------------------------------------------------------------
C4Z3D8_EUBE2/109-193-.L-----------------------------------------------------------------------------
B2U374_SHIB3/219-287-MN-----------------------------------------------------------------------------
E6VQR6_DESAO/135-213-.L-----------------------------------------------------------------------------
Q2SJV2_HAHCH/187-252-.K-----------------------------------------------------------------------------
B5UY55_BACCE/196-257-..-----------------------------------------------------------------------------
B7GIP5_ANOFW/70-132-..-----------------------------------------------------------------------------
B4AH26_BACPU/73-136-..-----------------------------------------------------------------------------
B3VGG0_9CAUD/70-142-.T-----------------------------------------------------------------------------
Q1ZSD0_PHOAS/130-219-.L-----------------------------------------------------------------------------
C8XIK2_NAKMY/139-205-.W-----------------------------------------------------------------------------
D9SKR7_CLOC7/252-312-..-----------------------------------------------------------------------------
C7R275_JONDD/65-131-.L-----------------------------------------------------------------------------
C3WMV9_9FUSO/63-140-LK-----------------------------------------------------------------------------
A8ATB8_9CAUD/56-121-MR-----------------------------------------------------------------------------
C6ANB6_AGGAN/178-255-.R-----------------------------------------------------------------------------
A6FEU3_9GAMM/129-218-.L-----------------------------------------------------------------------------
A7ILH7_XANP2/449-509-.M-----------------------------------------------------------------------------
Q854X2_9CAUD/66-133-.T-----------------------------------------------------------------------------
C9QJ38_VIBOR/123-214-.W-----------------------------------------------------------------------------
Q7D1F2_AGRT5/53-126-MN-----------------------------------------------------------------------------
Q2P050_XANOM/208-274-..-----------------------------------------------------------------------------
A5MZT7_CLOK5/187-255-.L-----------------------------------------------------------------------------
B1YFG8_EXIS2/71-136-..-----------------------------------------------------------------------------
Q0RZ25_RHOSR/75-142-.N-----------------------------------------------------------------------------
C4SJV6_YERFR/38-106-LN-----------------------------------------------------------------------------
A6SU28_JANMA/93-182-.A-----------------------------------------------------------------------------
C6RGB5_9PROT/616-681-.K-----------------------------------------------------------------------------
B2S3I3_TREPS/209-287-.K-----------------------------------------------------------------------------
C4ZCU4_EUBR3/194-278-.I-----------------------------------------------------------------------------
Q7NS81_CHRVO/52-121-MN-----------------------------------------------------------------------------
D4J1D4_BUTFI/117-201-.I-----------------------------------------------------------------------------
A9DC71_9RHIZ/63-156-.K-----------------------------------------------------------------------------
B9KTY8_RHOSK/205-268-.I-----------------------------------------------------------------------------
Q1B8J0_MYCSS/185-266-.W-----------------------------------------------------------------------------
A3ID77_9BACI/3-33-..-----------------------------------------------------------------------------
A1SG61_NOCSJ/370-446-.R-----------------------------------------------------------------------------
A7HN00_FERNB/195-263-.L-----------------------------------------------------------------------------
B5EIM6_GEOBB/377-491-.F-----------------------------------------------------------------------------
A9WKC4_CHLAA/591-661-.L-----------------------------------------------------------------------------
Q4ES87_LISMN/56-121-MR-----------------------------------------------------------------------------
C8T4A1_KLEPR/54-122-MN-----------------------------------------------------------------------------
B2FJL7_STRMK/100-166-..-----------------------------------------------------------------------------
C9S248_GEOSY/68-133-..-----------------------------------------------------------------------------
A6TN75_ALKMQ/198-278-.I-----------------------------------------------------------------------------
D4E385_SEROD/163-231-LN-----------------------------------------------------------------------------
A3X9V1_9RHOB/202-265-.L-----------------------------------------------------------------------------
D1AMG7_SEBTE/126-206-.F-----------------------------------------------------------------------------
E8WNQ9_GEOS8/380-487-.F-----------------------------------------------------------------------------
D2AZ54_STRRD/158-239-.W-----------------------------------------------------------------------------
B1YI53_EXIS2/118-187-..-----------------------------------------------------------------------------
C0D0F9_9CLOT/238-322-.L-----------------------------------------------------------------------------
C4K5R3_HAMD5/92-182-.W-----------------------------------------------------------------------------
Q0A7S9_ALHEH/202-267-.W-----------------------------------------------------------------------------
B2K031_YERPB/45-107-RN-----------------------------------------------------------------------------
D2PPJ5_KRIFD/298-379-.L-----------------------------------------------------------------------------
B4SDT7_PELPB/113-173-..-----------------------------------------------------------------------------
Q2B7L2_9BACI/116-186-..-----------------------------------------------------------------------------
D1ALL6_SEBTE/63-140-KK-----------------------------------------------------------------------------
B0MC55_9FIRM/144-230-.L-----------------------------------------------------------------------------
A7ZD12_CAMC1/602-665-.L-----------------------------------------------------------------------------
Q3STE6_NITWN/103-162-.W-----------------------------------------------------------------------------
A5ECX3_BRASB/184-253-.M-----------------------------------------------------------------------------
A9KN76_CLOPH/502-575-.L-----------------------------------------------------------------------------
A7FDS7_YERP3/58-127-MN-----------------------------------------------------------------------------
D1B2W5_SULD5/592-657-.L-----------------------------------------------------------------------------
C8X9H1_NAKMY/210-289-.F-----------------------------------------------------------------------------
A0NQA8_9RHOB/173-238-.Y-----------------------------------------------------------------------------
B9NP89_9RHOB/203-268-.L-----------------------------------------------------------------------------
B0NZY2_9CLOT/146-232-.L-----------------------------------------------------------------------------
B1JRT0_YERPY/56-124-MN-----------------------------------------------------------------------------
Q5WK03_BACSK/108-178-..-----------------------------------------------------------------------------
C9XQ42_CLODC/189-268-.V-----------------------------------------------------------------------------
B3Q3Z4_RHIE6/222-285-.V-----------------------------------------------------------------------------
C4XNT5_DESMR/200-269-.L-----------------------------------------------------------------------------
A5UTX9_ROSS1/590-659-.L-----------------------------------------------------------------------------
D3EJK7_GEOS4/101-171-..-----------------------------------------------------------------------------
D4BTB0_PRORE/43-105-SN-----------------------------------------------------------------------------
D3ADD3_9CLOT/85-148-YS-----------------------------------------------------------------------------
Q7VJM2_HELHP/173-242-.L-----------------------------------------------------------------------------
Q7MR54_WOLSU/185-254-.L-----------------------------------------------------------------------------
A9DET4_9CAUD/64-132-MR-----------------------------------------------------------------------------
C0CNE7_9FIRM/225-310-.L-----------------------------------------------------------------------------
C6LBK9_9FIRM/257-343-.L-----------------------------------------------------------------------------
B9JYE5_AGRVS/104-165-.L-----------------------------------------------------------------------------
D9QLQ3_BRESC/53-121-LN-----------------------------------------------------------------------------
B0VVC4_ACIBS/347-415-LQ-----------------------------------------------------------------------------
C4K6W4_HAMD5/53-119-MN-----------------------------------------------------------------------------
B2UP36_AKKM8/129-194-.T-----------------------------------------------------------------------------
C4L144_EXISA/57-123-MK-----------------------------------------------------------------------------
Q97KB0_CLOAB/198-263-..-----------------------------------------------------------------------------
Q856Y8_9CAUD/70-151-.T-----------------------------------------------------------------------------
Q5J5L5_9CAUD/70-137-.S-----------------------------------------------------------------------------
D0LWT6_HALO1/218-298-PL-----------------------------------------------------------------------------
A4G1C9_HERAR/140-229-.P-----------------------------------------------------------------------------
Q0FH91_9RHOB/197-262-.W-----------------------------------------------------------------------------
D4CCJ4_9CLOT/58-129-YS-----------------------------------------------------------------------------
D0LQS8_HALO1/317-391-RL-----------------------------------------------------------------------------
B6V2R4_BPSP1/74-136-..-----------------------------------------------------------------------------
Q7WHP8_BORBR/53-127-LR-----------------------------------------------------------------------------
A9KQC6_CLOPH/237-321-.L-----------------------------------------------------------------------------
C6WMZ1_ACTMD/132-213-.W-----------------------------------------------------------------------------
A3K5D3_9RHOB/148-231-.L-----------------------------------------------------------------------------
A4FKJ2_SACEN/154-235-.W-----------------------------------------------------------------------------
Q5YZK4_NOCFA/71-135-.N-----------------------------------------------------------------------------
Q1DAC7_MYXXD/63-125-GL-----------------------------------------------------------------------------
D1BDT0_SANKS/65-131-.I-----------------------------------------------------------------------------
C7N3P8_SLAHD/215-297-.M-----------------------------------------------------------------------------
A6Q7D6_SULNB/126-212-.W-----------------------------------------------------------------------------
B6VNP6_PHOAA/57-126-LN-----------------------------------------------------------------------------
Q73V53_MYCPA/145-206-.W-----------------------------------------------------------------------------
D7VN70_9SPHI/69-137-..-----------------------------------------------------------------------------
B5LJL3_9CAUD/69-133-.N-----------------------------------------------------------------------------
A8LRY3_DINSH/108-171-.I-----------------------------------------------------------------------------
C9MWB5_9FUSO/152-227-.K-----------------------------------------------------------------------------
D0LZM8_HALO1/111-191-.L-----------------------------------------------------------------------------
C9DBZ2_9CAUD/70-142-.T-----------------------------------------------------------------------------
D7VVF1_9FLAO/66-136-..-----------------------------------------------------------------------------
Q2SDK8_HAHCH/53-121-MR-----------------------------------------------------------------------------
C7RR41_ACCPU/164-241-.T-----------------------------------------------------------------------------
A1SCY8_NOCSJ/370-428-.L-----------------------------------------------------------------------------
B6FXG7_9FIRM/394-474-.L-----------------------------------------------------------------------------
B6WQA8_9DELT/218-285-.L-----------------------------------------------------------------------------
A4T1K8_MYCGI/149-230-.W-----------------------------------------------------------------------------
Q7NR04_CHRVO/206-271-..-----------------------------------------------------------------------------
D4CX41_9FUSO/55-123-LK-----------------------------------------------------------------------------
B8J0M5_DESDA/248-315-.L-----------------------------------------------------------------------------
A8EV90_ARCB4/175-243-.L-----------------------------------------------------------------------------
C6PUE1_9CLOT/429-508-.C-----------------------------------------------------------------------------
D9SMB1_CLOC7/196-264-.L-----------------------------------------------------------------------------
Q73JG3_TREDE/215-293-.L-----------------------------------------------------------------------------
B8ENP1_METSB/622-688-.L-----------------------------------------------------------------------------
C8Q0B7_9GAMM/78-152-FA-----------------------------------------------------------------------------
C0QJJ2_DESAH/140-230-.W-----------------------------------------------------------------------------
Q5DZ88_VIBF1/125-214-.L-----------------------------------------------------------------------------
C9MUL4_9FUSO/1065-1128-..-----------------------------------------------------------------------------
C6D2R3_PAESJ/123-193-..-----------------------------------------------------------------------------
D1PX89_9BACT/178-263-.L-----------------------------------------------------------------------------
C3XMD6_9HELI/163-232-.L-----------------------------------------------------------------------------
Q70K75_9ACTO/100-167-.Y-----------------------------------------------------------------------------
C3K4K2_PSEFS/131-227-.W-----------------------------------------------------------------------------
Q2LPY2_SYNAS/102-181-RL-----------------------------------------------------------------------------
A8GLN1_SERP5/79-147-LK-----------------------------------------------------------------------------
C0AQZ5_9ENTR/54-123-LN-----------------------------------------------------------------------------
D1RF68_LEGLO/59-140-.Y-----------------------------------------------------------------------------
C6BUG1_DESAD/184-249-.F-----------------------------------------------------------------------------
Q2LQQ3_SYNAS/55-131-RK-----------------------------------------------------------------------------
C7PFT3_CHIPD/191-256-.L-----------------------------------------------------------------------------
A8ATR6_9CAUD/73-134-..-----------------------------------------------------------------------------
C0ZX75_RHOE4/85-149-.N-----------------------------------------------------------------------------
D0DDG3_9RHOB/197-267-.L-----------------------------------------------------------------------------
A6W8P6_KINRD/95-156-.L-----------------------------------------------------------------------------
A7HJ25_FERNB/74-137-KN-----------------------------------------------------------------------------
B4WAV9_9CAUL/53-121-LR-----------------------------------------------------------------------------
D2XRK5_9CAUD/70-137-.S-----------------------------------------------------------------------------
B5EHY6_GEOBB/165-227-.I-----------------------------------------------------------------------------
B1YH87_EXIS2/72-135-..-----------------------------------------------------------------------------
A7ZFD8_CAMC1/46-110-MQ-----------------------------------------------------------------------------
B8KYV5_9GAMM/51-117-..-----------------------------------------------------------------------------
B2VDM6_ERWT9/41-110-LQ-----------------------------------------------------------------------------
B9JF39_AGRRK/850-911-.L-----------------------------------------------------------------------------
E3I7F8_RHOVT/190-269-.L-----------------------------------------------------------------------------
A1K513_AZOSB/150-214-..-----------------------------------------------------------------------------
B4V6Z2_9ACTO/133-214-.L-----------------------------------------------------------------------------
D0TJH0_9BACE/157-246-.I-----------------------------------------------------------------------------
Q0AVH5_SYNWW/269-331-.L-----------------------------------------------------------------------------
D3VE22_XENNA/59-122-MK-----------------------------------------------------------------------------
A8S209_9CLOT/64-127-YS-----------------------------------------------------------------------------
C6VVI7_DYAFD/85-145-.I-----------------------------------------------------------------------------
C4SXE4_YERIN/30-99-LN-----------------------------------------------------------------------------
A5FFV9_FLAJ1/170-242-.L-----------------------------------------------------------------------------
B2Q011_PROST/55-124-MN-----------------------------------------------------------------------------
Q98H40_RHILO/198-268-.L-----------------------------------------------------------------------------
D1AEC5_THECD/163-244-.W-----------------------------------------------------------------------------
D4DZ54_SEROD/54-122-MN-----------------------------------------------------------------------------
Q1MS64_LAWIP/228-297-.L-----------------------------------------------------------------------------

PF03411

MEPA_SHIFL/35-274QVM--------------------RTDQRRYFGHPDLVMFIQRLSSQVSNLGMGTVLIGDMGMPAGGRFNGGH--------
Q44614_BRUAO/61-309QVM--------------------RLSRNRRWGHPRMIALLEKLSHDAARDGWPGLLVGDISQPRGGPMLTGH--------
MEPA_HAEIN/42-281QVI--------------------RMNRNRYYGHPNMIQYLERLGQRAKAAGLPTMLVGDIAMPGGGRFLTGH--------

PF05951

Q9CNZ9_PASMU/32-183------------------------SYHT----------RG-----QAI------D--FRIDGV-PLAKLRQAAE------
Q9A852_CAUCR/63-213------------------------SLHM----------DG-----KAM------D--IFLEDV-ELKHVRAAAL------
E8VLY5_VIBVM/19-169------------------------SYHM----------LG-----RAI------D--FRLDGV-KLSTVRDAAL------
Q8YE08_BRUME/24-176------------------------SQHM----------LG-----RAM------D--YFIPGV-PLAKLRAIGM------
Q9KSI7_VIBCH/29-179------------------------SYHM----------SG-----QAI------D--FRLDGV-SLKKIREAAI------
Q989B8_RHILO/15-167------------------------SQHM----------VG-----RAM------D--FFLPDV-PLKKLRDIGL------
Q92JX1_RHIME/6-158------------------------SQHM----------LG-----KAM------D--FYIPDV-KLKTLREVGM------
Q98H74_RHILO/14-166------------------------SQHM----------LG-----KAM------D--FYIPGV-PLKKLRNIGL------
Q8EF76_SHEON/32-182------------------------SYHM----------QG-----MAM------D--IAIPGV-NLKTIRDAAL------
Q7CT90_AGRT5/14-166------------------------SQHM----------LG-----KAM------D--FYIPGV-KLATLREIGM------

PF08291

Q7Y5M4_BPSP6/6-108------------------------SMHM----------TG.....KAA------D--IKVKGK.DASAIASYLE.-----
Q5LM88_SILPO/18-119------------------------SEHL----------KA.....RAF------D--VSMINH.DPAEFEAAAR.-----
Q8PSL7_METMA/55-157------------------------SQHI----------TG.....RAA------D--IRASAK.SPLDLARIAL.-----
Q8VPZ8_RUMAL/197-303------------------------DAHT----------RG.....LAA------D--VVCYDK.NGNVIPCLTV.-----
CBPM_STRAL/126-241------------------------SRHM----------YG.....HAA------D--LGAGSQ.GFCALAQAAR.-----
Q5N402_SYNP6/73-183------------------------SYHL----------TG.....GAA------D--VSPLQF.NPLEFEQWCE.-----
Q8YUC7_NOSS1/127-243------------------------SQHI----------NG.....LAL------D--IAPVDG.NFGKLLQICR.-----
Q64TT2_BACFR/11-127------------------------SQHL----------LG.....QAA------D--ITVGSKEGNRRLFEIIR.-----
Q64PK4_BACFR/2-135------------------------SAHC----------HG.....YAF------D--LVPLNG.RMIEFKSFCRE-----
Q6UGH3_BPSP6/4-106------------------------SMHM----------TG.....KAA------D--IKVKGK.DASAIASYLE.-----
Q6UGC4_9CAUD/4-106------------------------SMHL----------TG.....KAA------D--IKVSGI.LPSEVHKYLT.-----
Q64PJ8_BACFR/2-135------------------------SAHC----------HG.....YAF------D--LIPLNQ.KMTEFKSFCRK-----
Q5NX34_AROAE/55-166------------------------SQHL----------PDNNGVFRAV------D--FWVPGA.NSEDVARMLE.-----
Q9AKY5_LEGPN/7-112------------------------GEHT----------YG.....MAV------D--ILCHGD.RAIKIIELAI.-----
Q64TI5_BACFR/2-118------------------------SQHR----------LG.....EAA------D--ITVGSKEENRKLFEIIR.-----
Q88L27_PSEPK/5-119------------------------SQHV----------QG.....LAA------D--FTVIEVSPRETVRRISK.-----
Q92KB7_RHIME/323-423------------------------SLHT----------RC.....EAA------D--IQVAGV.SKWELANFLR.-----
Q8CJR3_STRCO/116-230------------------------SRHL----------YG.....DAA------D--LTGSP..SFCRLAQQAR.-----
Q7MNT8_VIBVY/105-217------------------------SLHV----------TG.....KAA------D--LQVSGV.KPKDLYEKII.-----

PF01085

HH_DROME/85-244------------------------SLHY----------EG-----RAV------T--IATSDR-DQSKYGMLARL-----
DHHA_XENLA/23-184------------------------SLHY----------EG-----RAL------D--ITTSDR-DRNKYGMLARL-----
IHH_DANRE/24-184------------------------SLHY----------EG-----RAV------D--ITTSDR-DRNKYRMLARL-----
O17499_BRAFL/28-188------------------------SLHY----------EG-----RAV------D--ITTSDR-DRTKYGMLARL-----

PF02557

YODJ_BACSU/120-250------------------------SEHQ----------TG-----LAM------D--ISSRSNGF....EL....-----
Q65US8_MANSM/26-185------------------------SRHH----------WG-----TEI------D--FFDPDLLPQ.HQQLQLE.-----
O83250_TREPA/106-230------------------------SQHQ----------LG-----TVV------D--FGSI..............-----
Q63C99_BACCZ/98-228------------------------SEHQ----------TG-----LAM------D--ITSQSARF....QL....-----
Q8Y645_LISMO/113-243------------------------SEHQ----------TG-----LAM------D--ISSENQSY....EL....-----
VANY_ENTFC/105-222------------------------SEHN----------SG-----LSL------D--VGSS..............-----
Q7WZ84_9ACTO/63-172------------------------SNHV----------KG-----MAL------D--VRPH..............-----
Q5NHB6_FRATT/26-155------------------------SEHH----------TG-----RAI------D--LTTGDEKE...V.L....-----
Q7V800_PROMM/59-190------------------------SEHS----------TG-----YAI------D--LGDGTLPE...ANL....-----
Q7VCA8_PROMA/98-229------------------------SEHS----------TG-----YAI------D--LGDGDMRE...TDF....-----
Q55957_SYNY3/161-291------------------------SEHH----------TG-----YAL------D--IGDGANPA...NDL....-----
Q632I9_BACCZ/97-214------------------------SEHN----------LG-----LSL------D--VGST..............-----
Q7U788_SYNPX/101-232------------------------SEHS----------TG-----YAI------D--LGDGEAPE...TNL....-----
Q9JN36_ENTGA/31-162------------------------SEHQ----------IG-----LAI------D--VGLKKQEDD..DLI....-----
Q7NI07_GLOVI/108-238------------------------SEHH----------TG-----YAI------D--FGDGTVPG...ANL....-----
Q9LA11_PAEPP/102-219------------------------SEHN----------LG-----LSL------D--VGST..............-----
Q799B4_9PSEU/77-185------------------------SIHV----------AG-----KAV------D--IGPP..............-----
Q55454_SYNY3/106-237------------------------SEHH----------TG-----YAV------D--IGDGSAQA...THL....-----
AEPE_BPA50/18-205------------------------SNHN----------YG-----VAV------D--LCLYTNDGKDVIWESTTS-----
Q97E20_CLOAB/88-217------------------------SEHQ----------TG-----LAM------D--LLSTEYS.....SL....-----
Q73Q11_TREDE/110-234------------------------SQHQ----------LG-----TVI------D--LGSI..............-----
Q9KHM1_ENTFL/124-254------------------------SEHQ----------LG-----FAV------D--ING...............-----
VANY_ENTFA/114-247------------------------SEHQ----------LG-----LAV------D--INAD..............-----
Q5YUU3_NOCFA/122-230------------------------STHV----------SG-----QAV------D--VGPQ..............-----
Q8ESQ8_OCEIH/43-171------------------------SYHN----------YG-----LAI------D--YAIKNNNGNVLWDI....-----
Q8RQJ7_BACCE/14-156------------------------SEHH----------TG-----LAL------D--IISVEWQNT.VEDL....-----
Q7N3J3_PHOLL/21-178------------------------SRHH----------WG-----TDL------D--VYDPTMLPA.NQMLLLE.-----
Q5QTZ2_IDILO/20-179------------------------SRHH----------WG-----SDF------D--IYDPRPFQDSELKLQLVP-----
Q9KHL8_ENTFL/43-173------------------------SEHQ----------TG-----LAI------D--LGLNKKD.I..DFI....-----
Q8E2A2_STRA5/89-225------------------------SEHQ----------TG-----LAM------D--MSTVD.............-----
Q8K621_STRP3/87-223------------------------SEHH----------TG-----LAI------D--MSTVD.............-----
Q633S7_BACCZ/108-238------------------------SEHQ----------TG-----LAM------D--ISSKSAKF....QL....-----
Q7V1U4_PROMP/94-224------------------------SEHS----------TG-----FAI------D--IGDADKRE...TDF....-----
Q8EEB5_SHEON/50-206------------------------SRHH----------WG-----TDI------D--VFDAEKIEVKSLRLVE..-----
Q9KBW4_BACHD/101-218------------------------SEHN----------LG-----LAL------D--VGST..............-----
Q8W6J4_9CAUD/231-375------------------------SRHQ----------HG-----DAA------D--LGWNGG............-----
Q8CU74_STAES/77-207------------------------SEHQ----------TG-----LTF------D--VGGVDSDK....NL....-----
Q67QI3_SYMTH/121-251------------------------SEHQ----------TG-----LAM------D--ISGSTGEC....AA....-----
Q87MI5_VIBPA/23-179------------------------SRHH----------WG-----CDF------D--VYARNLLPP.DTKLQLE.-----
O51529_BORBU/101-225------------------------SQHH----------MG-----TAI------D--FINI..............-----
Q5KZM0_GEOKA/119-249------------------------SEHQ----------TG-----LAV------D--ISSRSAGC....QL....-----
Q63B61_BACCZ/95-225------------------------SEHQ----------TG-----LTM------D--VSSKSADN....EL....-----
Q8PBI7_XANCP/80-208------------------------SEHH----------SG-----DAV------D--IGTPGEPP...A......-----
Q5WJW5_BACSK/100-228------------------------SEHQ----------TG-----LAM------D--ISSASVDY....GL....-----
Q8DWH5_STRMU/90-226------------------------SEHQ----------TG-----LAI------D--MSTVD.............-----
Q5MZB2_SYNP6/93-224------------------------SEHH----------TG-----YAI------D--IGAADQPA...THL....-----
Q6D7N5_ERWCT/20-177------------------------SRHH----------WG-----SDL------D--IYDPDLLPA.GSSLQLE.-----
Q5M1U2_STRT1/104-240------------------------SEHQ----------TG-----LAI------D--MSTVD.............-----
Q9CM23_PASMU/28-187------------------------SRHH----------WG-----TEI------D--VFDPHLLPP.HQTLQLE.-----
Q7VNB4_HAEDU/28-186------------------------SRHH----------WG-----TEI------D--IFDPDLLPQ.GQHLQLE.-----
Q8EZA8_LEPIN/48-196------------------------SRHH----------WG-----TDV------D--LNALENSY...F......-----
Q93A45_ENTFL/33-163------------------------SEHE----------IG-----LAV------D--LGLATKE.N..DFI....-----
Q8YQW0_NOSS1/118-249------------------------SEHH----------TG-----YAV------D--IGDGAAPT...TNL....-----
Q9PEZ7_XYLFA/74-202------------------------SEHH----------SG-----EAL------D--IGMPGEPP...V......-----
Q8DQQ1_STRR6/87-213------------------------SEHQ----------TG-----LAF------D--VIGTD.............-----
Q7NMR7_GLOVI/149-279------------------------SEHH----------TG-----YAM------D--LGDALYPK...THL....-----
Q8XKL5_CLOPE/109-238------------------------SEHQ----------LG-----LAV------D--LTTRSIGF....QL....-----
Q9CGZ2_LACLA/85-226------------------------SEHQ----------TG-----LAI------D--MSNI..............-----
Q97KB0_CLOAB/144-267------------------------SYHN----------WG-----LAF------D--CAPVENG...........-----
Q5QL26_GEOKA/14-137------------------------SYHN----------FG-----LAF------D--VCV...............-----
Q8DKC7_THEEB/90-221------------------------SEHH----------TG-----YAV------D--IGDGAQPQ...THL....-----
Q8EST6_OCEIH/190-320------------------------SEHQ----------TG-----LAM------D--VTSPEVNF....NL....-----
Q6LTW9_PHOPR/50-207------------------------SRHH----------WG-----TDV------D--VYAKNCLPV.NTSLQLE.-----

PF01427

VANX_ENTFA/1-202LTKEKYYPNIERAELITKGYVASQSSHS----------RG-----STI------D--LTLYHLDTGELVSM---------
DDPX_SYNY3/31-240ENIYHQVYQIWAVPNNN...PLTPPPHS----------TG-----AAL------D--ITLL.DDLGQPVDM---------
DDPX_ECOLI/3-187YVVDVTVG................SNHS----------RG-----TAI------D--LTLR.DEHGNILDM---------
VANX_ENTFC/1-202LTKESYYPNIDRTEMISKGYVASKSSHS----------RG-----SAI------D--LTLYRLDTGELVPM---------
O53850_MYCTU/62-256WVARPGKYAHSHEAG.....RSVDVTFA----------SA-----QRQ------C--PSVRRSGELCLADM---------

PF13539

A8ASL5_BPA50/72-136------------------------SNHN..........YG-----VAV......D..LC........L.YTNDGK.....
B1QZK9_CLOBU/207-275------------------------SPHA..........YG-----ITI......D..LKSD....KRDYWKWASK.....
Q3J4T3_RHOS4/201-266------------------------SMHA..........WG-----IAV......D..LDPE....RNPLRWGRDR.....
A1ATB8_PELPD/203-268------------------------SMHA..........WG-----IAI......D..YDPE....RNQLTWGRER.....
Q6F913_ACIAD/194-260------------------------SYHQ..........FG-----LAA......D..VA........F..KRNGK.....
D1PEW6_9BACT/147-232------------------------SKHG..........RG-----LAV......D..INTL....YNPYHKRLKN.....
A9WTX9_RENSM/144-210------------------------SNHA..........SG-----TAI......D..CNAP....QHPLGKA........
A3TM69_9MICO/118-184------------------------SNHA..........SG-----TAI......D..CNAP....RHPLGAS........
A4SFK8_PROVI/119-180------------------------SNHN..........FG-----IAW......D..IG........IFTAEGGY.....
D4MUA4_9FIRM/428-503------------------------SEHC..........EG-----LAF......D..INSN....ENYMIQGKKV.....
Q6LSS8_PHOPR/126-215------------------------SLHA..........YG-----LAI......D..INPV....QNPFVEFSTT.....
C4L6K0_EXISA/116-185------------------------SYHN..........YG-----LAV......D..FV........I.IHNNKT.....
B5PLN0_SALET/45-107------------------------SLHT..........RR-----LAV......D..FN..........LFVNGQ.....
B2GW16_BURPE/142-232------------------------SMHA..........YG-----VAI......D..VNPV....QNPYVSFGED.....
Q1QI98_NITHX/92-153------------------------SNHA..........YA-----AAI......D..LNAA....ENGFGAGHGT.....
C4SEH9_YERMO/33-102------------------------SRHL..........TG-----HAV......D..LA........P.L.INNK.....
D5U8W6_BRAM5/259-337------------------------SYHS..........YG-----VAF......D..TLPKKNNGKQIYWAWTRV.....
A6LVB0_CLOB8/192-260------------------------SPHS..........YG-----IAI......D..LKSD....KRDYWKWSSE.....
CWLK_BACSU/94-164------------------------SYHN..........YG-----LAI......D..FA........L.QKKDGS.....
C2N1K8_BACCE/54-120------------------------SYHL..........VG-----QAL......D..FV........P.IQSNGT.....
B7RRA8_9RHOB/214-277------------------------STHA..........FG-----LSL......D..LN.........IDGKLDQ.....
D4I121_ERWAC/54-123------------------------SRHL..........TG-----HAV......D..LA........P.W.VNHS.....
B1IKM8_CLOBK/171-239------------------------SPHA..........FG-----IAI......D..LVRD....NRDYWKWATE.....
B5U3R2_9CAUD/70-134------------------------SNHN..........SA-----TAI......D..YNWN....KHPYQKW........
C9MEJ1_HAEIF/54-128------------------------SRHL..........TG-----HAV......D..LV........P.L....P.....
A9G830_SORC5/143-223------------------------SNHL..........FG-----IAI......D..IDPD....RNP...CCGC.....
B3VGP8_9CAUD/82-143------------------------SNHL..........SG-----VAV......D..VNAP....KYPWGTY........
C1I574_9CLOT/169-237------------------------SPHA..........YG-----IAI......D..LSRN....DADYWKWVDK.....
C7NA70_LEPBD/121-197------------------------SLHS..........LG-----RAI......D..INPD....ENPQLSPDGV.....
E6VS38_DESAO/135-213------------------------SMHA..........LG-----LAI......D..INPR....LNPYV..........
B7VJV8_VIBSL/123-214------------------------SKHA..........YG-----VAI......D..INPV....QNPFLEFDSN.....
C9MVB8_9FUSO/246-328------------------------SNHQIKSDG.....FG-----HAV......D..IF........PCGVVENG.....
D1CHT9_THET1/273-355------------------------SEHS..........YG-----WAI......D..INPV....QNPYV....T.....
Q5DN15_9CAUD/21-99------------------------SRHLPKVPKGGGEPVA-----HAV......D..LG........A.Y.VDGE.....
B3VFY1_9CAUD/64-131------------------------SNHL..........NG-----TAM......D..LNWN....SHPFKVL........
A0RNH9_CAMFF/569-634------------------------SAHS..........WG-----IAI......D..INVN....MSDYWQW........
A3UWI6_VIBSP/67-136------------------------SRHQ..........SG-----CAV......D..FV........V.YDENGK.....
Q8ESQ8_OCEIH/97-167------------------------SYHN..........YG-----LAI......D..YA........I.KNNNGN.....
A7XF57_9CAUD/52-120------------------------SRHL..........HG-----FAV......D..VV........A.Y.PKDK.....
C6LLE4_9FIRM/274-349------------------------SEHN..........TG-----TAI......D..INWT....ENYMVNVRTG.....
C4Z3D8_EUBE2/109-193------------------------SKHA..........LG-----LAV......D..INTL....YNPYVKYV.D.....
B2U374_SHIB3/219-287------------------------SRHL..........TG-----HAV......D..VV........A.Y.IGSQ.....
E6VQR6_DESAO/135-213------------------------SKHA..........YG-----RAI......D..INPQ....LNPYI..........
Q2SJV2_HAHCH/187-252------------------------SQHF..........IG-----HAI......D..CNLMDGDNWNSSATFSQG.....
B5UY55_BACCE/196-257------------------------SYHN..........WG-----LAF......D..AA........P.YENNSI.....
B7GIP5_ANOFW/70-132------------------------SYHN..........FG-----LAF......D..FA........I.LNANGS.....
B4AH26_BACPU/73-136------------------------SNHN..........YG-----LAI......D..YV........L.LSADGK.....
B3VGG0_9CAUD/70-142------------------------SNHP..........GG-----TGA......D..FNWN....GEDGRTF........
Q1ZSD0_PHOAS/130-219------------------------SLHA..........YG-----AAI......D..LNPV....QNPFVTFARA.....
C8XIK2_NAKMY/139-205------------------------SNHA..........SG-----TAI......D..LNSA....LHPNGAK........
D9SKR7_CLOC7/252-312------------------------SWHN..........FG-----LAI......D..VV........EIVNGAAQ.....
C7R275_JONDD/65-131------------------------SNHA..........SG-----TAV......D..FNAP....RHPLGAW........
C3WMV9_9FUSO/63-140------------------------SNHQIKFDG.....LG-----YAA......D..IG..........VIVNGE.....
A8ATB8_9CAUD/56-121------------------------SYHI..........VG-----QAF......D..FV..........MAKGKT.....
C6ANB6_AGGAN/178-255------------------------SAHA..........FG-----IAI......DFTLPNG....LGTYWQWSGC.....
A6FEU3_9GAMM/129-218------------------------SIHA..........YG-----LAI......D..INPK....QNPFVEFGEQ.....
A7ILH7_XANP2/449-509------------------------SAHA..........YG-----MAI......D..VNPS....ANPNGTTQSDLP...
Q854X2_9CAUD/66-133------------------------SNHL..........GG-----TAM......D..LNWS....DHPMGKA........
C9QJ38_VIBOR/123-214------------------------SKHA..........YG-----VAI......D..INPV....QNPFLAFGKN.....
Q7D1F2_AGRT5/53-126------------------------SRHLKAANG.....YS-----HAV......D..LA........A.L.VGGS.....
Q2P050_XANOM/208-274------------------------SCHQ..........YG-----LAV......D..SA........P..LRDGK.....
A5MZT7_CLOK5/187-255------------------------SPHA..........FG-----IAI......D..LARD....RRDYWKWVSK.....
B1YFG8_EXIS2/71-136------------------------SNHN..........FG-----VAV......D..LF........V.YADGGK.....
Q0RZ25_RHOSR/75-142------------------------SNHL..........SG-----TAV......D..LNAT....RLPWKVR........
C4SJV6_YERFR/38-106------------------------SRHL..........TG-----HAV......D..IV........P.L.PDGK.....
A6SU28_JANMA/93-182------------------------SLHA..........YG-----VAI......D..INPV....QNPFLQFEAD.....
C6RGB5_9PROT/616-681------------------------SSHS..........YG-----IAI......D..INTD....KSDYWRW........
B2S3I3_TREPS/209-287------------------------SNHS..........WG-----IAL......D..LMPKNWQRHTMYWNWEAA.....
C4ZCU4_EUBR3/194-278------------------------SKHG..........MG-----MAV......D..INTL....YNPYVKTV.D.....
Q7NS81_CHRVO/52-121------------------------SRHL..........TG-----HAI......D..LA........P.W.MDGA.....
D4J1D4_BUTFI/117-201------------------------SKHG..........YG-----LAM......D..INTL....YNPYVKTV.N.....
A9DC71_9RHIZ/63-156------------------------SLHA..........YG-----IAL......D..INWK....TNPYIDHAGQ.....
B9KTY8_RHOSK/205-268------------------------SNHS..........WG-----TAI......D..LT.........LEGVLDP.....
Q1B8J0_MYCSS/185-266------------------------SYHA..........YG-----RAI......D..LNPL....LNPYI....G.....
A3ID77_9BACI/3-33------------------------................-----...................................
A1SG61_NOCSJ/370-446------------------------SPHS..........YG-----RSL......D..VNTW....ENPYRSARGT.....
A7HN00_FERNB/195-263------------------------SMHA..........FG-----LAV......D..LAPK....RESYWLNASY.....
B5EIM6_GEOBB/377-491------------------------STHS..........YG-----AAI......D..INPR....QNPYLQVNPE.....
A9WKC4_CHLAA/591-661------------------------SNHA..........YG-----TAF......D..INAQ....WNGFYKPAAL.....
Q4ES87_LISMN/56-121------------------------SYHL..........VG-----QAL......D..FA..........MTKGKT.....
C8T4A1_KLEPR/54-122------------------------SRHL..........TG-----DAI......D..VV........A.Y.IDGK.....
B2FJL7_STRMK/100-166------------------------SCHN..........HG-----WAA......D..MV........I..YKRGR.....
C9S248_GEOSY/68-133------------------------SYHN..........FG-----LAF......D..IC........VCNVFKGT.....
A6TN75_ALKMQ/198-278------------------------SKHG..........YG-----LAI......D..INPI....QNPYIKGD.......
D4E385_SEROD/163-231------------------------SRHL..........TG-----HAV......D..VV........A.M.PAGV.....
A3X9V1_9RHOB/202-265------------------------STHS..........YG-----LAV......D..LN.........IDGQLDN.....
D1AMG7_SEBTE/126-206------------------------SKHA..........YG-----FAV......D..INPV....QNPYIKNN.......
E8WNQ9_GEOS8/380-487------------------------SRHS..........YG-----VAI......D..VNPL....QNPYLMLEGS.....
D2AZ54_STRRD/158-239------------------------SQHA..........YG-----RAV......D..INPR....ENPYL....S.....
B1YI53_EXIS2/118-187------------------------SMHN..........YG-----LAI......D..F.........V.QMIDGD.....
C0D0F9_9CLOT/238-322------------------------SNHA..........YG-----FAI......D..INPQ....QNPYVSYR.D.....
C4K5R3_HAMD5/92-182------------------------SKHA..........YG-----VAI......D..INPL....QNPYISYPEE.....
Q0A7S9_ALHEH/202-267------------------------STHA..........WG-----VAI......D..WDPD....QNKLRWGRDR.....
B2K031_YERPB/45-107------------------------SLHT..........QR-----LAV......D..FN..........LFINGV.....
D2PPJ5_KRIFD/298-379------------------------SPHS..........YG-----HAI......D..INTV....ENPYLAA........
B4SDT7_PELPB/113-173------------------------SNHN..........FG-----IAF......D..IG...........VFEGN.....
Q2B7L2_9BACI/116-186------------------------SYHN..........FG-----LAI......D..FA........L.LSLNGA.....
D1ALL6_SEBTE/63-140------------------------SNHQAKSDA.....YG-----YAV......D..LY........P..YINGS.....
B0MC55_9FIRM/144-230------------------------SKHA..........YG-----RAI......D..INPR....VNPFVKRN.......
A7ZD12_CAMC1/602-665------------------------SAHS..........YG-----IAI......D..INVK....KSHYWQWSKG.....
Q3STE6_NITWN/103-162------------------------SNHS..........WA-----CAV......D..LSPR....SNGFNM.........
A5ECX3_BRASB/184-253------------------------SMHG..........YA-----AAI......D..LNLD....YSDYWLWNAR.....
A9KN76_CLOPH/502-575------------------------SIHS..........FG-----AAI......D..INPG....DYDNDYFLGK.....
A7FDS7_YERP3/58-127------------------------SRHL..........TG-----HAV......D..LA........P.M.VNNR.....
D1B2W5_SULD5/592-657------------------------SAHS..........YG-----IAI......D..LETR....YSRYWQW........
C8X9H1_NAKMY/210-289------------------------SEHS..........YG-----TAI......D..VNPV....QNPYLR.........
A0NQA8_9RHOB/173-238------------------------SMHS..........WG-----IAI......D..FDPE....RNRLSWKRPQ.....
B9NP89_9RHOB/203-268------------------------STHA..........YG-----AAL......D..LNPA....KNQLRWGADR.....
B0NZY2_9CLOT/146-232------------------------SNHS..........YG-----MAI......D..INPR....INPWVKGN.......
B1JRT0_YERPY/56-124------------------------SRHI..........TG-----HAI......D..VF........A.Y.PAAS.....
Q5WK03_BACSK/108-178------------------------SYHN..........FG-----LAI......D..FA........L.LDEGGE.....
C9XQ42_CLODC/189-268------------------------SNHG..........KG-----RAI......D..INPL....QNPQVSGN.......
B3Q3Z4_RHIE6/222-285------------------------SSHA..........WG-----AAV......D..LT.........LKKNLDN.....
C4XNT5_DESMR/200-269------------------------SVHA..........FA-----AAV......D..VSPK....GNPYWRNLPR.....
A5UTX9_ROSS1/590-659------------------------SNHA..........FG-----TAF......D..INYDPATNLNGLNAVPAL.....
D3EJK7_GEOS4/101-171------------------------SLHN..........YG-----LAI......D..FA........L.RLKDGS.....
D4BTB0_PRORE/43-105------------------------SLHK..........HR-----LAV......D..FN..........LFKDGK.....
D3ADD3_9CLOT/85-148------------------------SYHQ..........WG-----TAF......D..FF...........RNDGR.....
Q7VJM2_HELHP/173-242------------------------SPHS..........FG-----IAL......D..INTQ....FSKYWLWDKK.....
Q7MR54_WOLSU/185-254------------------------SMHS..........FG-----IAL......D..LDPK....ASRYWLWDRE.....
A9DET4_9CAUD/64-132------------------------SRHL..........TG-----HAV......D..IS........P.L.VDGK.....
C0CNE7_9FIRM/225-310------------------------SNHA..........YG-----CAI......D..LNPM....ENPYVVYDGD.....
C6LBK9_9FIRM/257-343------------------------SNHA..........YG-----MAI......D..LNPM....VNPYVKNG.......
B9JYE5_AGRVS/104-165------------------------SMHA..........YG-----CAV......D..LDPS....HNGLGD.........
D9QLQ3_BRESC/53-121------------------------SRHL..........TG-----HAV......D..LA........A.L.VDGR.....
B0VVC4_ACIBS/347-415------------------------SYHQ..........YG-----LAI......D..VV..SVRNGKITYLSDGK.....
C4K6W4_HAMD5/53-119------------------------SRHL..........TG-----HAV......D..LG........A.C.LDGS.....
B2UP36_AKKM8/129-194------------------------SMHA..........WG-----IAV......D..IDPD....RNGLNIPAPK.....
C4L144_EXISA/57-123------------------------SYHL..........VG-----QAI......D..FV........P.ANPEGK.....
Q97KB0_CLOAB/198-263------------------------SYHN..........WG-----LAF......D..CA........P..VENGQ.....
Q856Y8_9CAUD/70-151------------------------SNHK..........GA-----TAF......D..YNWS....DHPLGYAAPD.....
Q5J5L5_9CAUD/70-137------------------------SNHL..........SG-----TAM......D..LNWN....THPFQIP........
D0LWT6_HALO1/218-298------------------------SFHS..........YG-----IAL......D..LNPR......ENFGWVPR.....
A4G1C9_HERAR/140-229------------------------SLHA..........YG-----AAI......D..INPV....QNPFVQFEDA.....
Q0FH91_9RHOB/197-262------------------------SMHA..........YG-----CAI......DFYAAPNALRMNCPQALFCGP.....
D4CCJ4_9CLOT/58-129------------------------SQHQ..........WG-----IAF......D..FF........LKMDINGN.....
D0LQS8_HALO1/317-391------------------------ARVVEFWSYSKAWIEG-----RAVR.....D.........................
B6V2R4_BPSP1/74-136------------------------SNHN..........FG-----LAV......D..YF........L.YDDNGK.....
Q7WHP8_BORBR/53-127------------------------SLHIPQPDG.....WA-----HAV......D..LA........P.L.VEGT.....
A9KQC6_CLOPH/237-321------------------------SKHA..........YG-----LAI......D..INPK....YNPYVRTI.N.....
C6WMZ1_ACTMD/132-213------------------------SNHS..........YG-----RAI......D..LNPV....QNPYV....S.....
A3K5D3_9RHOB/148-231------------------------SQHA..........LG-----KAI......D..INPV....HNPYVQGR.......
A4FKJ2_SACEN/154-235------------------------SQHA..........LG-----RAV......D..VNPL....INPYV....D.....
Q5YZK4_NOCFA/71-135------------------------SNHL..........SG-----TAI......D..LNAP....KYPWGRR........
Q1DAC7_MYXXD/63-125------------------------SAHN..........YG-----LAFDFVC..D..AS........P..RPGVQ.....
D1BDT0_SANKS/65-131------------------------SNHA..........SG-----TAI......D..LNAP....RHPLGAV........
C7N3P8_SLAHD/215-297------------------------SYHA..........QG-----LAI......D..INPY....YNPYVKVA.......
A6Q7D6_SULNB/126-212------------------------SRHS..........YG-----KAI......D..LNSI....ENPYI....S.....
B6VNP6_PHOAA/57-126------------------------SRHL..........TG-----HAV......D..LA........P.L.INST.....
Q73V53_MYCPA/145-206------------------------SEHA..........YG-----RAI......D..LNPR....LNPCLYPT.......
D7VN70_9SPHI/69-137------------------------SIHN..........YG-----LAF......D..IV........ILYDKDSN.....
B5LJL3_9CAUD/69-133------------------------SNHL..........SG-----TAL......D..LCAD....ELPWQRR........
A8LRY3_DINSH/108-171------------------------SNHS..........WG-----TAI......D..LT.........LEGKLDR.....
C9MWB5_9FUSO/152-227------------------------SLHS..........TG-----RAI......D..LNPE....ENPQVNSNGK.....
D0LZM8_HALO1/111-191------------------------SQHS..........FG-----NAI......D..INPV....QNPWL....S.....
C9DBZ2_9CAUD/70-142------------------------SNHP..........GG-----TGM......D..LNWN....GADQKTF........
D7VVF1_9FLAO/66-136------------------------SIHN..........YG-----LAV......D..IC........L..MIDGK.....
Q2SDK8_HAHCH/53-121------------------------SRHL..........TG-----HAV......D..LG........A.L.INGA.....
C7RR41_ACCPU/164-241------------------------SSHS..........FG-----IAI......DFRLPHG....LGHYWRWAGC.....
A1SCY8_NOCSJ/370-428------------------------SNHA..........FG-----LAL......D..LNVP....GN.............
B6FXG7_9FIRM/394-474------------------------SKHG..........KG-----VAI......D..INPL....YNPQVK...N.....
B6WQA8_9DELT/218-285------------------------SPHS..........FG-----IAI......D..LSPQ....RAPYWRWAKV.....
A4T1K8_MYCGI/149-230------------------------SLHA..........YG-----RAI......D..VNPK....LNPYV....P.....
Q7NR04_CHRVO/206-271------------------------SKHQ..........YG-----LAA......D..LA........P..VRNGK.....
D4CX41_9FUSO/55-123------------------------SYHL..........KG-----KAV......D..IA........V.W.INGK.....
B8J0M5_DESDA/248-315------------------------SPHA..........YG-----IAV......D..LSPR....LAPYWRWNKL.....
A8EV90_ARCB4/175-243------------------------SVHS..........FG-----IAI......D..INLD....FSNYWQWDEK.....
C6PUE1_9CLOT/429-508------------------------INHP..........AG-----AAI......D..INPD....ENYYIQLDKD.....
D9SMB1_CLOC7/196-264------------------------SPHS..........FG-----IAI......D..LASN....PKDYWQWASL.....
Q73JG3_TREDE/215-293------------------------SNHS..........WG-----SAI......D..LLPANYKTKKIYWFWEAA.....
B8ENP1_METSB/622-688------------------------SNHA..........FG-----TAF......D..INAR....FNPLKARPAL.....
C8Q0B7_9GAMM/78-152------------------------SKHV..........SG-----KAV......D..LV........P.Y....P.....
C0QJJ2_DESAH/140-230------------------------SLHA..........YG-----SAI......D..INPV....QNPFIDISED.....
Q5DZ88_VIBF1/125-214------------------------SLHA..........YG-----AAI......D..INPL....QNPFVEFTSW.....
C9MUL4_9FUSO/1065-1128------------------------SYHN..........YG-----LAI......D..IV........Q.ITNNGK.....
C6D2R3_PAESJ/123-193------------------------SYHN..........YG-----LAV......D..FA........L.VKPDGD.....
D1PX89_9BACT/178-263------------------------SAHA..........RG-----MAV......D..INTL....YNPYYRRSAN.....
C3XMD6_9HELI/163-232------------------------SAHS..........FG-----IAI......D..INVA....KSRYWLWDLK.....
Q70K75_9ACTO/100-167------------------------SNHS..........SG-----TAV......D..LNLE....IHGGQGF........
C3K4K2_PSEFS/131-227------------------------SIHA..........YG-----AAI......D..INPV....QNPYVSFMRDEKGEY
Q2LPY2_SYNAS/102-181------------------------SRHA..........SG-----LAV......D..FNPF....QNPVVYENGA.....
A8GLN1_SERP5/79-147------------------------SRHL..........TG-----HAV......D..VV........A.Y.VGGK.....
C0AQZ5_9ENTR/54-123------------------------SRHL..........TG-----HAV......D..IV........P.L.VNGA.....
D1RF68_LEGLO/59-140------------------------SQHS..........YG-----RAI......D..INPL....INPYIKGK.......
C6BUG1_DESAD/184-249------------------------STHS..........WG-----IAV......D..YDPD....RNRRTWGRDK.....
Q2LQQ3_SYNAS/55-131------------------------SKHI..........DG-----KAFDIAILRD..FK........P..CWDVK.....
C7PFT3_CHIPD/191-256------------------------SNHS..........FG-----SAF......D..INVA....WNPLGAVPAL.....
A8ATR6_9CAUD/73-134------------------------SNHN..........FG-----VAV......D..FA........IDLIDDGK.....
C0ZX75_RHOE4/85-149------------------------SNHL..........SG-----TAL......D..FNAV....QYPWGQR........
D0DDG3_9RHOB/197-267------------------------SAHS..........YG-----IAV......D..LNAD....LGGYWRWSGA.....
A6W8P6_KINRD/95-156------------------------SNHS..........WG-----LAV......D..LNAG....ANPMGSPVRS.....
A7HJ25_FERNB/74-137------------------------SPHC..........YG-----LAF......D..FV........P..IINGK.....
B4WAV9_9CAUL/53-121------------------------SRHL..........SG-----HAV......D..VA........A.L.VEGQ.....
D2XRK5_9CAUD/70-137------------------------SNHL..........SG-----TAM......D..LNWN....SHPFKVS........
B5EHY6_GEOBB/165-227------------------------SSHS..........WG-----TAI......D..IN.........IKGALDE.....
B1YH87_EXIS2/72-135------------------------SNHN..........RG-----IAV......D..LF........Q.YSMDGT.....
A7ZFD8_CAMC1/46-110------------------------SNHL..........KR-----CAI......D..LH..........IFKNGV.....
B8KYV5_9GAMM/51-117------------------------SCHN..........FG-----LAL......D..AA........V..FINGE.....
B2VDM6_ERWT9/41-110------------------------SRHL..........TG-----HAI......D..LA........P.W.INHT.....
B9JF39_AGRRK/850-911------------------------SNHA..........FG-----DAI......D..INPQ....QNPMGKNLVT.....
E3I7F8_RHOVT/190-269------------------------SVHS..........FG-----IAF......D..INPE....HGGYWQYGLP.....
A1K513_AZOSB/150-214------------------------SRHQ..........YG-----LAA......D..LA........P..VRDGA.....
B4V6Z2_9ACTO/133-214------------------------SRHA..........WG-----DAV......D..INPV....ENPYV....D.....
D0TJH0_9BACE/157-246------------------------SKHG..........LG-----LAI......D..INAL....YNPYVKRKDD.....
Q0AVH5_SYNWW/269-331------------------------SRHS..........WG-----TAI......D..INAA.....NHFRRVDPE.....
D3VE22_XENNA/59-122------------------------SRHL..........HG-----FAV......D..LY........P............
A8S209_9CLOT/64-127------------------------SYHQ..........WG-----TAF......D..IY...........RNDGA.....
C6VVI7_DYAFD/85-145------------------------STHA..........WG-----IAV......D..LNAN....WNPFRGKVTW.....
C4SXE4_YERIN/30-99------------------------SRHL..........TG-----HAV......D..LA........P.W.INQS.....
A5FFV9_FLAJ1/170-242------------------------SMHS..........YG-----MTI......D..INVK....NSNYWQWDCK.....
B2Q011_PROST/55-124------------------------SRHL..........TG-----HAV......D..CA........P.L.IHRQ.....
Q98H40_RHILO/198-268------------------------SVHS..........FG-----AAF......D..INVG....YSDYWFWSKP.....
D1AEC5_THECD/163-244------------------------SQHA..........YG-----LAI......D..INPC....QNPYVSASG......
D4DZ54_SEROD/54-122------------------------SRHI..........SG-----HAV......D..VF........A.Y.PTPA.....
Q1MS64_LAWIP/228-297------------------------SPHS..........YG-----IAI......D..LHPK....KGIYWRLVKD.....

PF03411

MEPA_SHIFL/35-274------------------------ASHQ----------TG-----LDV------DIFLQ.LPKTRWTSAQLLRPQ-----
Q44614_BRUAO/61-309------------------------ASHQ----------VG-----LDA------DIWLTPMPKKRFTNAERESVS-----
MEPA_HAEIN/42-281------------------------ASHQ----------MG-----LDA------DIWLR.MGEMSDADALNSDGK-----

PF05951

Q9CNZ9_PASMU/32-183----------------------------------------------------------------KLNNGG----------
Q9A852_CAUCR/63-213----------------------------------------------------------------DLSVGG----------
E8VLY5_VIBVM/19-169----------------------------------------------------------------SLEAGG----------
Q8YE08_BRUME/24-176----------------------------------------------------------------RYQIGG----------
Q9KSI7_VIBCH/29-179----------------------------------------------------------------SLQAGG----------
Q989B8_RHILO/15-167----------------------------------------------------------------KMQGGG----------
Q92JX1_RHIME/6-158----------------------------------------------------------------KFQVGG----------
Q98H74_RHILO/14-166----------------------------------------------------------------KMQGGG----------
Q8EF76_SHEON/32-182----------------------------------------------------------------SLKLGG----------
Q7CT90_AGRT5/14-166----------------------------------------------------------------QMQIGG----------

PF08291

Q7Y5M4_BPSP6/6-108--------------------------------------------------------------..HKYPDK----------
Q5LM88_SILPO/18-119--------------------------------------------------------------..AVGFTG----------
Q8PSL7_METMA/55-157--------------------------------------------------------------..EELGCD----------
Q8VPZ8_RUMAL/197-303--------------------------------------------------------------..AWAAEQ----------
CBPM_STRAL/126-241--------------------------------------------------------------..NHGFTE----------
Q5N402_SYNP6/73-183--------------------------------------------------------------..QNWNGG----------
Q8YUC7_NOSS1/127-243--------------------------------------------------------------..ASDCTG----------
Q64TT2_BACFR/11-127--------------------------------------------------------------..KELPFD----------
Q64PK4_BACFR/2-135--------------------------------------------------------------FMNNRSFD----------
Q6UGH3_BPSP6/4-106--------------------------------------------------------------..HKYPDK----------
Q6UGC4_9CAUD/4-106--------------------------------------------------------------..SKYQGK----------
Q64PJ8_BACFR/2-135--------------------------------------------------------------FLADRPFD----------
Q5NX34_AROAE/55-166--------------------------------------------------------------..WARTGG----------
Q9AKY5_LEGPN/7-112--------------------------------------------------------------..NHGIKR----------
Q64TI5_BACFR/2-118--------------------------------------------------------------..QELPFD----------
Q88L27_PSEPK/5-119--------------------------------------------------------------..SAVPFD----------
Q92KB7_RHIME/323-423--------------------------------------------------------------..NVPGRG----------
Q8CJR3_STRCO/116-230--------------------------------------------------------------..THGFSE----------
Q7MNT8_VIBVY/105-217--------------------------------------------------------------..SLINNG----------

PF01085

HH_DROME/85-244--------------------------------------------------------------AVEAGFDW----------
DHHA_XENLA/23-184--------------------------------------------------------------AVEAGFDW----------
IHH_DANRE/24-184--------------------------------------------------------------AVEAGFDW----------
O17499_BRAFL/28-188--------------------------------------------------------------AVEAGFDW----------

PF02557

YODJ_BACSU/120-250------------------------------------------------------....NEAFGSTADGKW..........
Q65US8_MANSM/26-185------------------------------------------------------PWEYEQDGYFFELSRF..........
O83250_TREPA/106-230------------------------------------------------------....TPAFARSDAGRW..........
Q63C99_BACCZ/98-228------------------------------------------------------....ETIFGETKEGQW..........
Q8Y645_LISMO/113-243------------------------------------------------------....TEAFGTTPEGKW..........
VANY_ENTFC/105-222------------------------------------------------------....LTKMERAPEGKW..........
Q7WZ84_9ACTO/63-172------------------------------------------------------...........EGARW..........
Q5NHB6_FRATT/26-155------------------------------------------------------....TEDFEKTYAFEW..........
Q7V800_PROMM/59-190------------------------------------------------------....SESFEATRAFRW..........
Q7VCA8_PROMA/98-229------------------------------------------------------....EVSFEETPAFSW..........
Q55957_SYNY3/161-291------------------------------------------------------....KINFENTSAYQW..........
Q632I9_BACCZ/97-214------------------------------------------------------....QKKMEKAPEGKW..........
Q7U788_SYNPX/101-232------------------------------------------------------....SQSFEQTRAFRW..........
Q9JN36_ENTGA/31-162------------------------------------------------------....CPHFRDSAAADL..........
Q7NI07_GLOVI/108-238------------------------------------------------------....RPRFEQTVAFRW..........
Q9LA11_PAEPP/102-219------------------------------------------------------....QMKMDKAPEGKW..........
Q799B4_9PSEU/77-185------------------------------------------------------...........ASASW..........
Q55454_SYNY3/106-237------------------------------------------------------....SASFAQTKAFNW..........
AEPE_BPA50/18-205------------------------------------------------------RWKKVVAAMKAEGFKWGGDWKSFKDY
Q97E20_CLOAB/88-217------------------------------------------------------....DDGFMNTNSYKW..........
Q73Q11_TREDE/110-234------------------------------------------------------....DDSYADTAEGKW..........
Q9KHM1_ENTFL/124-254------------------------------------------------------........ATYDVYLW..........
VANY_ENTFA/114-247------------------------------------------------------....GIHSTGNEVYRW..........
Q5YUU3_NOCFA/122-230------------------------------------------------------...........AGAQW..........
Q8ESQ8_OCEIH/43-171------------------------------------------------------....HYDGNNNGESDW..........
Q8RQJ7_BACCE/14-156------------------------------------------------------....NAKFETTDAFKW..........
Q7N3J3_PHOLL/21-178------------------------------------------------------PWEYENGGYFAPLTHW..........
Q5QTZ2_IDILO/20-179------------------------------------------------------GEYIDQSGPCHELWQW..........
Q9KHL8_ENTFL/43-173------------------------------------------------------....RPDFPYDGICDE..........
Q8E2A2_STRA5/89-225------------------------------------------------------....SLNESDPRVVSQ..........
Q8K621_STRP3/87-223------------------------------------------------------....TLNASDPSVAKA..........
Q633S7_BACCZ/108-238------------------------------------------------------....EPIFGETAEGKW..........
Q7V1U4_PROMP/94-224------------------------------------------------------....EVQFENTDAFRW..........
Q8EEB5_SHEON/50-206------------------------------------------------------.AEYRDGGPCAQLHQW..........
Q9KBW4_BACHD/101-218------------------------------------------------------....QTSMYEAAEAEW..........
Q8W6J4_9CAUD/231-375------------------------------------------------------....NFSGAPKEVREW..........
Q8CU74_STAES/77-207------------------------------------------------------....YASFGKTEEGRW..........
Q67QI3_SYMTH/121-251------------------------------------------------------....DDCFAGTPEAEW..........
Q87MI5_VIBPA/23-179------------------------------------------------------.PWEYLEGHQLAFYCW..........
O51529_BORBU/101-225------------------------------------------------------....DDNLLNTKEGKW..........
Q5KZM0_GEOKA/119-249------------------------------------------------------....TQSFGATKEGQW..........
Q63B61_BACCZ/95-225------------------------------------------------------....ELTFANTKEGKW..........
Q8PBI7_XANCP/80-208------------------------------------------------------....EESFESTAAVAW..........
Q5WJW5_BACSK/100-228------------------------------------------------------....IEAFGLTAEGQW..........
Q8DWH5_STRMU/90-226------------------------------------------------------....SLNQSDANVVAK..........
Q5MZB2_SYNP6/93-224------------------------------------------------------....ETTFEQTAAFRW..........
Q6D7N5_ERWCT/20-177------------------------------------------------------PWEYEEGGYFAALNGW..........
Q5M1U2_STRT1/104-240------------------------------------------------------....SLDEADPATVAK..........
Q9CM23_PASMU/28-187------------------------------------------------------PWEYEQGGYFFELSDW..........
Q7VNB4_HAEDU/28-186------------------------------------------------------PWEYQSNGYFAPLIKW..........
Q8EZA8_LEPIN/48-196------------------------------------------------------....EKGGKGEKFYNW..........
Q93A45_ENTFL/33-163------------------------------------------------------....RPSFTDSPIVDK..........
Q8YQW0_NOSS1/118-249------------------------------------------------------....QAIFENTRAFKW..........
Q9PEZ7_XYLFA/74-202------------------------------------------------------....EENFEGSSAFAW..........
Q8DQQ1_STRR6/87-213------------------------------------------------------....GDLVTEEKAAQW..........
Q7NMR7_GLOVI/149-279------------------------------------------------------....ETTFENTPAFRW..........
Q8XKL5_CLOPE/109-238------------------------------------------------------....EESFEDTKEGQW..........
Q9CGZ2_LACLA/85-226------------------------------------------------------.....DSLNESQYAKQ..........
Q97KB0_CLOAB/144-267------------------------------------------------------....QVSWNDITSFNE..........
Q5QL26_GEOKA/14-137------------------------------------------------------....CNVFKGTLIPSW..........
Q8DKC7_THEEB/90-221------------------------------------------------------....KETFEDTPAFRW..........
Q8EST6_OCEIH/190-320------------------------------------------------------....VTEFGETKEGKW..........
Q6LTW9_PHOPR/50-207------------------------------------------------------PWEYQTNGHQAEFNQW..........

PF01427

VANX_ENTFA/1-202----------------------------------------------------------GSNFDFMDERSH----------
DDPX_SYNY3/31-240----------------------------------------------------------GGEIDELSARSL----------
DDPX_ECOLI/3-187----------------------------------------------------------GAGFDEMHERSH----------
VANX_ENTFC/1-202----------------------------------------------------------GSRFDFMDERSH----------
O53850_MYCTU/62-256----------------------------------------------------------GTDFDDFSSRAT----------

PF13539

A8ASL5_BPA50/72-136..................................DV.I................W.E.......STTSRW----------
B1QZK9_CLOBU/207-275...........................................................EQGESRIREYP----------
Q3J4T3_RHOS4/201-266................................................................ASFAAP----------
A1ATB8_PELPD/203-268................................................................AAFSRP----------
Q6F913_ACIAD/194-260...............................VVISERD................P.........WAMRGY----------
D1PEW6_9BACT/147-232.G.............................KEVVEPATARPYL.DRSK..N......HA.Y...MIKKG----------
A9WTX9_RENSM/144-210...........................................................GTFRAAQVKAI----------
A3TM69_9MICO/118-184...........................................................GTFSSAQVSRI----------
A4SFK8_PROVI/119-180...............................................................VTGRDDY----------
D4MUA4_9FIRM/428-503....................................................LAGSFWKPKKNRYSIPLN----------
Q6LSS8_PHOPR/126-215.N.............................TAIFKPQAGIK.YANRMK..Y......RF.GKTERGGMA----------
C4L6K0_EXISA/116-185.....................................D................Y.DLNTDRNRNDIPDW----------
B5PLN0_SALET/45-107..............................................................YQTRTEDY----------
B2GW16_BURPE/142-232.G.............................EARVLPASAAKTSMNRLD..E......RP.GKPARPGMA----------
Q1QI98_NITHX/92-153....................................................................MP----------
C4SEH9_YERMO/33-102...............................IP.....................WED...WGAFHQVAKA----------
D5U8W6_BRAM5/259-337...............................NNKAWYAVPYE......................KRWHPP----------
A6LVB0_CLOB8/192-260...........................................................KAGKERLSDYP----------
CWLK_BACSU/94-164...................................I.I................W.DMEYDGNQNGKSDW----------
C2N1K8_BACCE/54-120...............................ED.....................W.N...GYNKEPWASA----------
B7RRA8_9RHOB/214-277............................................................LGDGRTQLGL----------
D4I121_ERWAC/54-123...............................IP.....................WQD...WDAFVLIAKA----------
B1IKM8_CLOBK/171-239...........................................................SQGQERIASYP----------
B5U3R2_9CAUD/70-134...........................................................GTWPNR..AAV----------
C9MEJ1_HAEIF/54-128...............................VN.....................WND...REPFKNVASA----------
A9G830_SORC5/143-223...............................VDP....................WPT.......SPLCQE----------
B3VGP8_9CAUD/82-143............................................................RMSADKIAKV----------
C1I574_9CLOT/169-237...........................................................TKGSKRIEGYP----------
C7NA70_LEPBD/121-197...................................................VLVGKKWEPYQNPYSITPE----------
E6VS38_DESAO/135-213...............................RGDLALPPGATY...............DP.AVAGTLTAD----------
B7VJV8_VIBSL/123-214.G.............................RITVKPSQSATRYVNRTR..F......RARDEIERRGMA----------
C9MVB8_9FUSO/246-328...............................VYRKFT.................SEEGYDEKKLKLIANH----------
D1CHT9_THET1/273-355.A.............................SGVVLPPAGQRYL.DRTQ..D......LP.G...MIKPG----------
Q5DN15_9CAUD/21-99...............................VR.....................W.D...WPLYHKIAKA----------
B3VFY1_9CAUD/64-131....................................................NAGFTPE......QIAII----------
A0RNH9_CAMFF/569-634...................................SKDGK........................YHNNIP----------
A3UWI6_VIBSP/67-136...............................VT.....................W.G...FSYYEQVSWA----------
Q8ESQ8_OCEIH/97-167...................................V.L................W.DIHYDGNNNGESDW----------
A7XF57_9CAUD/52-120...............................DT.....................W.N...MKYYRMIADA----------
C6LLE4_9FIRM/274-349..................................................AITAGKYWKPGTDPYSIPKD----------
C4Z3D8_EUBE2/109-193.G.............................RRNVEPANAEKYT.DRSI..E......FP.H...KIDHD----------
B2U374_SHIB3/219-287...............................VS.....................W.E...WPLYEKIAAA----------
E6VQR6_DESAO/135-213...............................LNGVSQPAGAVYEPGKPG................VFTSD----------
Q2SJV2_HAHCH/187-252................................................................KESENA----------
B5UY55_BACCE/196-257.....................................P................W.........NNIKKF----------
B7GIP5_ANOFW/70-132....................................................VNW.........NVDDKW----------
B4AH26_BACPU/73-136..................................KA.L................W.........TVNEKW----------
B3VGG0_9CAUD/70-142....................................................RYGITEARAYPGDKARRL----------
Q1ZSD0_PHOAS/130-219.G.............................QAKYSPVEGTK.YANREI..Y......RY.GKPDRKGMA----------
C8XIK2_NAKMY/139-205...........................................................GSFTSSQVSAI----------
D9SKR7_CLOC7/252-312................................................................YTDASY----------
C7R275_JONDD/65-131...........................................................GTFKPVQVTAI----------
C3WMV9_9FUSO/63-140..................................................YKGTWKD...FHYYQDIYNT----------
A8ATB8_9CAUD/56-121...............................VD.....................W.G...GYKTAKAKKV----------
C6ANB6_AGGAN/178-255...............................KANAPCAYPQKF.....................IQDPKL----------
A6FEU3_9GAMM/129-218.G.............................SASFKPVDGAK.YANRMQ..F......RY.GKEQRQGFA----------
A7ILH7_XANP2/449-509......................................................................----------
Q854X2_9CAUD/66-133....................................................YTGYTQA......EIAAV----------
C9QJ38_VIBOR/123-214.G.............................TITVKPTQSATQYINRTQ..F......RARSELSRTGMA----------
Q7D1F2_AGRT5/53-126...............................VV.....................W.D...WPLYAKLAKA----------
Q2P050_XANOM/208-274...............................LQWDMGD................P.........WTRRAY----------
A5MZT7_CLOK5/187-255...........................................................EEGDSRLKEYP----------
B1YFG8_EXIS2/71-136..........................................................RAEFPAPPDPRL----------
Q0RZ25_RHOSR/75-142.........................................................ASVNMPADKIAAV----------
C4SJV6_YERFR/38-106...............................IS.....................W.E...WRYFYPMADA----------
A6SU28_JANMA/93-182.G.............................KAAYSPPIGSK.YANRLA..V......RP.GKATRQGMA----------
C6RGB5_9PROT/616-681...................................SKDGR........................YSNQIP----------
B2S3I3_TREPS/209-287...............................HNEDWMHIPIK......................KRWAPP----------
C4ZCU4_EUBR3/194-278.G.............................ELSIEPANGADYV.DRSK..D......FS.H...KIDHD----------
Q7NS81_CHRVO/52-121...............................IP.....................WEN...WPAFEEVGLA----------
D4J1D4_BUTFI/117-201.G.............................KLSIEPANAADYV.DRSQ..D......FP.Y...KIDEN----------
A9DC71_9RHIZ/63-156...................................RKPRFSDNVTQSGRAQDVRLGRADTDMTRGMVDAA----------
B9KTY8_RHOSK/205-268............................................................FADGGTQAGL----------
Q1B8J0_MYCSS/185-266.G.............................SGAVEPANAGPYV.DRTR..T......DP.G...ILHAG----------
A3ID77_9BACI/3-33.....................................................................L----------
A1SG61_NOCSJ/370-446.........................VPNRWWQGHSHPRVA.........................WRSRS----------
A7HN00_FERNB/195-263...........................................................EQGLKLLRLYP----------
B5EIM6_GEOBB/377-491.AYPVPSGDAASGSSGDTALAAADFCRNNGSLCSILPAASASFL.DRGD..L......RP.G...MLQAD----------
A9WKC4_CHLAA/591-661...............................................................VGDRGSV----------
Q4ES87_LISMN/56-121...............................VD.....................W.G...AYRSDKGKKF----------
C8T4A1_KLEPR/54-122...............................VS.....................W.D...WLLYEIISRA----------
B2FJL7_STRMK/100-166...............................PSWDLKD................E.........QVRQGY----------
C9S248_GEOSY/68-133..................................LIPS................W.........SLDRRW----------
A6TN75_ALKMQ/198-278.................................TIVPLQGGDYV.NRLD..V......RK.G...MITKG----------
D4E385_SEROD/163-231...............................VS.....................W.Q...WDYYAQIAVA----------
A3X9V1_9RHOB/202-265............................................................FTDGKTQLGL----------
D1AMG7_SEBTE/126-206.................................VIEPKNSIDYL.DRKS..I......RK.G...MIVKG----------
E8WNQ9_GEOS8/380-487.A.......REKGAAVTEAAAASDFCLANPGICQVLPASSASYL.DRQN..Q......RP.G...MLQPG----------
D2AZ54_STRRD/158-239.A.............................DGSVAHKNARKFA.RRPL..D......EP.G...VINPG----------
B1YI53_EXIS2/118-187...................................I.S................Y.DLEYDGNQSGKSDW----------
C0D0F9_9CLOT/238-322.G.............................KARWSHENANDYI.DRST..G......LP.H...VITHE----------
C4K5R3_HAMD5/92-182.G.............................SANILPPSSSKFFVNRNN..N......RP.NKKQRVGMA----------
Q0A7S9_ALHEH/202-267................................................................ARLARP----------
B2K031_YERPB/45-107..............................................................YQTKTEAY----------
D2PPJ5_KRIFD/298-379...............................NNVWYPSNGLSYR.NRSW..V......RP.G...MLFTN----------
B4SDT7_PELPB/113-173.............................................................KYLGDSPKY----------
Q2B7L2_9BACI/116-186...................................V.I................W.DMNYDGNGNSRADW----------
D1ALL6_SEBTE/63-140...............................VR.....................VEYERYKKETNAIAEH----------
B0MC55_9FIRM/144-230.................................SITPENGKIYA.QRDV..KKCKGKYKY.N...MIHRN----------
A7ZD12_CAMC1/602-665................................................................YENLIP----------
Q3STE6_NITWN/103-162.................................................................KATLS----------
A5ECX3_BRASB/184-253...............................S...SVSIP........................YKNRFP----------
A9KN76_CLOPH/502-575...............................G........NDLR.................NRSNPYCIP----------
A7FDS7_YERP3/58-127...............................IP.....................WDD...WHAFAHVAKA----------
D1B2W5_SULD5/592-657...................................DKTYA........................FQNEFP----------
C8X9H1_NAKMY/210-289...............................GSLVLPAAGRAFV.DRPD.........AP.G...VIHAG----------
A0NQA8_9RHOB/173-238................................................................ARLSLD----------
B9NP89_9RHOB/203-268................................................................AQFAHP----------
B0NZY2_9CLOT/146-232.................................KVSPANGKVYK.QRKT..SKCKGKYKR.Y...MIHKN----------
B1JRT0_YERPY/56-124...............................GS.....................W.E...WKYYEQIATA----------
Q5WK03_BACSK/108-178...................................P.L................W.DIAYDGNENGEPDW----------
C9XQ42_CLODC/189-268.................................DVTPKISTVYA.DRSS.........TKFG...MIKKG----------
B3Q3Z4_RHIE6/222-285............................................................MGDNSTQFGL----------
C4XNT5_DESMR/200-269...............................G...TNMLA........................TRQAFP----------
A5UTX9_ROSS1/590-659...............................................................VGQPGSV----------
D3EJK7_GEOS4/101-171...................................V.I................W.DMEYDGNGNGKADW----------
D4BTB0_PRORE/43-105..............................................................YLTATSDY----------
D3ADD3_9CLOT/85-148............................................................GAYYDNDGFF----------
Q7VJM2_HELHP/173-242...............................E...RNEYQ........................YENQIP----------
Q7MR54_WOLSU/185-254...............................K...KGQVR........................YENTIP----------
A9DET4_9CAUD/64-132...............................VS.....................W.D...WKYYYPMADA----------
C0CNE7_9FIRM/225-310.T.............................PVEWAHSNADPYI.DRNS..G......AE.H...VITHD----------
C6LBK9_9FIRM/257-343.................................RVSPANGKLYK.ERNV..SKCRGKYKK.N...MIHKN----------
B9JYE5_AGRVS/104-165................................................................PTPDMD----------
D9QLQ3_BRESC/53-121...............................IR.....................W.D...WPLYPRIAAH----------
B0VVC4_ACIBS/347-415................................................................QSIADS----------
C4K6W4_HAMD5/53-119...............................VR.....................W.D...WPLYYPIADA----------
B2UP36_AKKM8/129-194................................................................AVLSGP----------
C4L144_EXISA/57-123...............................VS.....................W.N...WYDRDDIQKA----------
Q97KB0_CLOAB/198-263....................................VS................W.........NDITSF----------
Q856Y8_9CAUD/70-151...................................................PRAGWNGSVLIKGDQTPAV----------
Q5J5L5_9CAUD/70-137....................................................DAGFDSA......KLARV----------
D0LWT6_HALO1/218-298...............................GIEKAIAPFSEQW.................CEKYPRGLG----------
A4G1C9_HERAR/140-229.G.............................KASYLPAAGST.YANRLA..V......RP.GKAARKGMA----------
Q0FH91_9RHOB/197-262..........................................................DYRDFLDIMEAH----------
D4CCJ4_9CLOT/58-129.......................................................GAVTDDAFNDSTGMF----------
D0LQS8_HALO1/317-391......................................................RLEKQDKTLVGMIPIH----------
B6V2R4_BPSP1/74-136...................................A.H................W.........NVNSDW----------
Q7WHP8_BORBR/53-127...............................IP.....................WED...WASFKRLAEV----------
A9KQC6_CLOPH/237-321.G.............................ETIIVPENGAEYE.DRTL..E......NE.Y...YIMKD----------
C6WMZ1_ACTMD/132-213.A.............................SGAVHPPSGAPYV.DRTV..R......AP.G...LIVAG----------
A3K5D3_9RHOB/148-231.................................HTSPDAGVDYD.EASE..RRAD...VP.G...VILSG----------
A4FKJ2_SACEN/154-235.D.............................TGAFQPANAAPYL.DRAR..R......DP.G...VLHDG----------
Q5YZK4_NOCFA/71-135............................................................VMARDLIDRV----------
Q1DAC7_MYXXD/63-125...............................PD.....................WRE.......SA...Y----------
D1BDT0_SANKS/65-131...........................................................GTFTPAQVAVI----------
C7N3P8_SLAHD/215-297...............................QGSIAPASAAQYA.DRSR............DFDYKINRG----------
A6Q7D6_SULNB/126-212.H.............................SGRIAHKESLQYR.KRVHKKS......TP.ADRAVLLRN----------
B6VNP6_PHOAA/57-126...............................IP.....................WDN...WQAFIELATT----------
Q73V53_MYCPA/145-206......................................................................----------
D7VN70_9SPHI/69-137...............................GSFETAS................W.........ALDINF----------
B5LJL3_9CAUD/69-133............................................................TMPQNQVEIT----------
A8LRY3_DINSH/108-171............................................................RGDGRTQEGL----------
C9MWB5_9FUSO/152-227...................................................AIVGKSWEPNSNPYSIKPD----------
D0LZM8_HALO1/111-191.G..............................GRVLPEAGRAYI.ERAG..Q......HP.G...MIVRP----------
C9DBZ2_9CAUD/70-142....................................................RYGITKERAYPGDKARKL----------
D7VVF1_9FLAO/66-136...................................TAS................W.DTVKDWDNDKVADW----------
Q2SDK8_HAHCH/53-121...............................IT.....................W.E...TRYYQILADA----------
C7RR41_ACCPU/164-241...............................LSEKSCAYPERV.....................LQDRAL----------
A1SCY8_NOCSJ/370-428.............................................QRGT................VGQID----------
B6FXG7_9FIRM/394-474.G.............................K..VYPSISKPYA.DRSK..N......VK.G...MIKKG----------
B6WQA8_9DELT/218-285...............................E...RHPL..........................QQSYD----------
A4T1K8_MYCGI/149-230.R.............................SGVHEPANAGPWV.DRSR..S......EP.G...MLHDG----------
Q7NR04_CHRVO/206-271...............................VVISERD................P.........WAMQAY----------
D4CX41_9FUSO/55-123...............................VT.....................W.D...FKYYKEVADC----------
B8J0M5_DESDA/248-315...............................R...PHPM..........................QHGYP----------
A8EV90_ARCB4/175-243...................................DGKIE........................YKNKIP----------
C6PUE1_9CLOT/429-508...............................................GKVQSQVGNYYKPNEDPYSITPE----------
D9SMB1_CLOC7/196-264...........................................................EQGNQRIKEYP----------
Q73JG3_TREDE/215-293...............................RNDYWMKIMPY......................RRWIPP----------
B8ENP1_METSB/622-688...............................................................KGQPGSV----------
C8Q0B7_9GAMM/78-152...............................VD.....................WND...LKKFDAIAKA----------
C0QJJ2_DESAH/140-230.G.............................TALISPVKSAHYSVNRLN..H......RP.GKPRRQGMA----------
Q5DZ88_VIBF1/125-214.G.............................TATFKPLKGHE.YSNRML..Q......RL.GKEDRKGFA----------
C9MUL4_9FUSO/1065-1128...................................SDS................Y.K.......LLENPN----------
C6D2R3_PAESJ/123-193...................................V.I................W.DMEYDGNGNGKSDW----------
D1PX89_9BACT/178-263.G.............................RVTVQPSNALKYC.DRSA..S......FP.Y...KIERG----------
C3XMD6_9HELI/163-232...............................Q...KTFKD........................FTPKIP----------
Q70K75_9ACTO/100-167..........................................................SGTFTPEQTAKI----------
C3K4K2_PSEFS/131-227TG.............................MAKIEPKSATPVGLNRLN..V......RA.DEPVYPGRT----------
Q2LPY2_SYNAS/102-181...............................IL...............................PPGALY----------
A8GLN1_SERP5/79-147...............................VS.....................W.D...WGPYEQIAKA----------
C0AQZ5_9ENTR/54-123...............................IP.....................WQD...WSAFESVSKA----------
D1RF68_LEGLO/59-140.................................TIIPPQGALYA.ERTQ..P......AP.G...KITKE----------
C6BUG1_DESAD/184-249................................................................AVFAQP----------
Q2LQQ3_SYNAS/55-131...............................VD.....................VNE.......NEIPDY----------
C7PFT3_CHIPD/191-256...............................................................VGQKGSV----------
A8ATR6_9CAUD/73-134..................................ID.S................W.QPS...........----------
C0ZX75_RHOE4/85-149............................................................TMPTSRKQKI----------
D0DDG3_9RHOB/197-267...............................TE..GQVGA........................YDNRIP----------
A6W8P6_KINRD/95-156.................................................................DFPRD----------
A7HJ25_FERNB/74-137...............................VV.....................WNN.......DKI..W----------
B4WAV9_9CAUL/53-121...............................VR.....................W.D...WPLYGRIASA----------
D2XRK5_9CAUD/70-137....................................................YAGFDET......KIATM----------
B5EHY6_GEOBB/165-227............................................................RGDGRVQYGL----------
B1YH87_EXIS2/72-135..................................EA.I................F.........NTDENF----------
A7ZFD8_CAMC1/46-110..............................................................WLQSKQDL----------
B8KYV5_9GAMM/51-117...............................PSWNLDD................A.........HVMAGY----------
B2VDM6_ERWT9/41-110...............................IP.....................WED...WNAFALLAKA----------
B9JF39_AGRRK/850-911.D.................................LPSNVGELA..........................----------
E3I7F8_RHOVT/190-269...............................RAMDEAAVREKGI.................ALVYRNKVP----------
A1K513_AZOSB/150-214...............................ASF.ETD................G.........LGMEAY----------
B4V6Z2_9ACTO/133-214.V.............................RGVVHPPTGREFL.RRDR..S......RP.G...MVEDG----------
D0TJH0_9BACE/157-246.G.............................TWHIEPATAEPYAFDRESRTD......IP.Y...KIDHD----------
Q0AVH5_SYNWW/269-331................................................................QEANDP----------
D3VE22_XENNA/59-122...............................GS.....................W.E...WTEFYKLEKA----------
A8S209_9CLOT/64-127............................................................GAYNDSALFF----------
C6VVI7_DYAFD/85-145............................................................S........P----------
C4SXE4_YERIN/30-99...............................IP.....................WDN...WSAFKVVADA----------
A5FFV9_FLAJ1/170-242...............................CKNEEVTLS........................YRNQIP----------
B2Q011_PROST/55-124...............................IP.....................WND...WSKFELVARA----------
Q98H40_RHILO/198-268...............................DA..KGRIP........................FKNRIP----------
D1AEC5_THECD/163-244.................................HVAHKDCVKFK.DRSR..K......DP.G...VIHKG----------
D4DZ54_SEROD/54-122...............................GS.....................W.D...WKYYQQISEA----------
Q1MS64_LAWIP/228-297...............................R...EKYLQ........................IQKEYP----------

PF03411

MEPA_SHIFL/35-274-------------ALDLVSRDGKHVVSTLWKPEIFSLIKLAAQDKDVTRIFVNPAIKQQLCLDAGTDRDW----------
Q44614_BRUAO/61-309-------------AVSMLKPDSLYVDPKKWTPARTALLKHAASYPEVERIFVHPGIKKQLCDTVTGDRSW----------
MEPA_HAEIN/42-281-------------GLLVVDRKAQRVDERVWNSNHATLIKLAAQDPNVTRIFVNPAIKVKLCQTAGNDRGW----------

PF05951

Q9CNZ9_PASMU/32-183------------------------V----G------------YYP-----------------------RSN.--.FI---
Q9A852_CAUCR/63-213------------------------V----G------------YYP-----------------------TSN.--.FV---
E8VLY5_VIBVM/19-169------------------------V----G------------YYP-----------------------..GS--NFV---
Q8YE08_BRUME/24-176------------------------V----G------------YYP-----------------------RSGS--PFV---
Q9KSI7_VIBCH/29-179------------------------V----G------------YYP-----------------------K..S--QFI---
Q989B8_RHILO/15-167------------------------V----G------------YYP-----------------------TSGS--PFI---
Q92JX1_RHIME/6-158------------------------V----G------------YYP-----------------------TSGS--PFV---
Q98H74_RHILO/14-166------------------------V----G------------YYP-----------------------TSGS--PFV---
Q8EF76_SHEON/32-182------------------------V----G------------YYP-----------------------KSG.--.FV---
Q7CT90_AGRT5/14-166------------------------V----G------------FYP-----------------------TSGS--PFV---

PF08291

Q7Y5M4_BPSP6/6-108------------------------Y....G------------IGR-----------------------YN....SFT---
Q5LM88_SILPO/18-119------------------------F....G------------FYR-----------------------RN....NFI---
Q8PSL7_METMA/55-157------------------------I....G------------IGL-----------------------GR....NSI---
Q8VPZ8_RUMAL/197-303------------------------I....G------------FTG-----------------------IGLMYGGAI---
CBPM_STRAL/126-241------------------------ILGP.G------------YPG-----------------------HN....DHT---
Q5N402_SYNP6/73-183------------------------V..GRG------------IKA-----------------------GR....RFV---
Q8YUC7_NOSS1/127-243------------------------L....G------------RGM-----------------------HR....GFI---
Q64TT2_BACFR/11-127------------------------QL...I------------DEK-----------------------DF....SWV---
Q64PK4_BACFR/2-135------------------------QLISEG------------ENG-----------------------NAVP..RWM---
Q6UGH3_BPSP6/4-106------------------------Y....G------------IGR-----------------------YN....SFT---
Q6UGC4_9CAUD/4-106------------------------Y....G------------IGK-----------------------YN....SFT---
Q64PJ8_BACFR/2-135------------------------QLISEG------------ENE-----------------------AGLP..SWI---
Q5NX34_AROAE/55-166------------------------V....G------------FYR-----------------------SS....KHI---
Q9AKY5_LEGPN/7-112------------------------I....G------------VHQ-----------------------KGNANGRFV---
Q64TI5_BACFR/2-118------------------------QL...I------------DEK-----------------------DF....SWV---
Q88L27_PSEPK/5-119------------------------Q....L------------ILE-----------------------FD....RWV---
Q92KB7_RHIME/323-423------------------------GV...G------------TYC-----------------------HT....NSV---
Q8CJR3_STRCO/116-230------------------------ILGP.G------------YPG-----------------------HN....DHT---
Q7MNT8_VIBVY/105-217------------------------KITQGG------------VGL-----------------------YT....SFV---

PF01085

HH_DROME/85-244------------------------V-----------------SYV-----------------------SR----RHI---
DHHA_XENLA/23-184------------------------V-----------------YYE-----------------------SK----AHI---
IHH_DANRE/24-184------------------------V-----------------YYE-----------------------SK----GHV---
O17499_BRAFL/28-188------------------------V-----------------YYE-----------------------SK----AHI---

PF02557

YODJ_BACSU/120-250....................VQDNAYKY.G-F----------IIR..............Y.PKNKEDITKYEY-EP.--.
Q65US8_MANSM/26-185....................LQQNLPQF.D-F----------VLP..............F.M.QTPKGKEIGR-EP.--.
O83250_TREPA/106-230....................TQRNAHRF.G-W----------SLS..............F.PPGYEQVTGYVW-EP.--.
Q63C99_BACCZ/98-228....................LSENAHKF.G-F----------VIR..............Y.TKEKESLTGYRY-EP.--.
Q8Y645_LISMO/113-243....................LQENAHNY.G-F----------ILR..............Y.MKGREAITKYQY-ES.--.
VANY_ENTFC/105-222....................IEENAWKY.G-F----------ILR..............Y.PEDKTELTGIQY-EP.--.
Q7WZ84_9ACTO/63-172....................LEAHGARY.D-L----------YRI..............Y...........DN-EW.--.
Q5NHB6_FRATT/26-155....................LVKNAHKY.G-F----------KLS..............F.PCNNDY..GFIY-EP.--.
Q7V800_PROMM/59-190....................LQDHAASY.H-F----------VLS..............F.PLDNPQ..GVTY-EP.--.
Q7VCA8_PROMA/98-229....................LQRNAAKY.H-F----------VLS..............F.PKGNTQ..GVSY-EP.--.
Q55957_SYNY3/161-291....................LARNANQY.G-F----------ELS..............F.PPNNSQ..GVSY-EP.--.
Q632I9_BACCZ/97-214....................IEENVWKH.G-F----------VLR..............Y.PKNKSNITGIQY-EP.--.
Q7U788_SYNPX/101-232....................LQDNAARY.H-F----------ILS..............F.PRGNQQ..GVMY-EP.--.
Q9JN36_ENTGA/31-162....................FMQQMMNY.G-F----------ILR..............Y.PEDKQEITGISY-EP.--.
Q7NI07_GLOVI/108-238....................LTANARKF.G-F----------EMS..............F.PKDNPQ..RVSY-EP.--.
Q9LA11_PAEPP/102-219....................IEKNCWEY.G-F----------ILR..............Y.PLDKTDVTGIQY-EP.--.
Q799B4_9PSEU/77-185....................LSEHGADY.G-L----------CRV..............Y...........RN-EP.--.
Q55454_SYNY3/106-237....................LQNNAAKY.S-F----------ELS..............F.PPDNPQ..GIAY-EP.--.
AEPE_BPA50/18-205PHFELCDAVSGEKIPAATQNTNTNSNRYEG-K----------VIDSAPLLPKMDFKSSPF.RMYKVGTEFLVY-DHN--Q
Q97E20_CLOAB/88-217....................LQQNCGKY.G-F----------IIR..............Y.PKDKENITKYNF-EP.--.
Q73Q11_TREDE/110-234....................MFKNAWKY.G-W----------SLS..............Y.PKDMEHITGYKW-ES.--.
Q9KHM1_ENTFL/124-254....................LQENSYKY.T-A----------LSS..............D.TRQKTDITGTAE-EV.--.
VANY_ENTFA/114-247....................LDENSYRF.G-F----------IRR..............Y.PPDKTEITGVSN-EP.--.
Q5YUU3_NOCFA/122-230....................LERNGNRW.G-L----------CRT..............Y...........AN-EW.--.
Q8ESQ8_OCEIH/43-171..............................-.----------.................F..EVAEIAKEIGF-EWG--G
Q8RQJ7_BACCE/14-156....................LDKNAAEY.G-F----------TLR..............Y.PKDKENITGIKY-EP.--.
Q7N3J3_PHOLL/21-178....................LTENMAHF.G-F----------YRP..............F.V.GNCGS..VAD-EP.--.
Q5QTZ2_IDILO/20-179....................LTRHAHES.G-F----------FFP..............Y.A...RYQGGVAQ-EP.--.
Q9KHL8_ENTFL/43-173....................FRRAAPDY.G-F----------TQR..............Y.ARDKEEITGISH-EP.--.
Q8E2A2_STRA5/89-225....................LKKIAPQY.G-F----------VLR..............F.PDGKTAETGVGY-ED.--.
Q8K621_STRP3/87-223....................VQKIAPDY.G-F----------VLR..............F.PEGKKTSTGVDY-ED.--.
Q633S7_BACCZ/108-238....................VAKHAHEF.G-F----------VIR..............Y.LEDKTETTEYSY-EP.--.
Q7V1U4_PROMP/94-224....................LKKNAAKY.H-F----------KLS..............F.TQ.NNK..NVDY-EP.--.
Q8EEB5_SHEON/50-206....................LVANAKDF.G-F----------YFP..............F.QRGQSA...VSA-EP.--.
Q9KBW4_BACHD/101-218....................IKENAWKH.G-F----------ILR..............Y.PQDKVDITGIEY-EP.--.
Q8W6J4_9CAUD/231-375....................VHANASRY.G-L----------SFP.........................MGH-EP.--.
Q8CU74_STAES/77-207....................IAKNAHNY.G-F----------IIR..............Y.PKNKESITGYQY-EP.--.
Q67QI3_SYMTH/121-251....................LAAHAHEF.G-F----------IVR..............Y.PKGKEHITGYMY-EP.--.
Q87MI5_VIBPA/23-179....................LKDHIDEF.G-F----------FFP..............Y.L...QDLGGVAI-EP.--.
O51529_BORBU/101-225....................LYENSLKY.G-F----------SVS..............Y.PKGYETDTGYKA-EP.--.
Q5KZM0_GEOKA/119-249....................VAAHAHEY.G-F----------IIR..............Y.PKGKEAVTGYKY-EP.--.
Q63B61_BACCZ/95-225....................LKENAHRA.G-F----------IIR..............Y.PKGKESITGYAY-EP.--.
Q8PBI7_XANCP/80-208....................LQTHAGRF.G-F----------RLS..............Y.PRDNPH..GIVY-EP.--.
Q5WJW5_BACSK/100-228....................VAEHAHQF.G-F----------IIR..............Y.PAEKEGITGYGY-EP.--.
Q8DWH5_STRMU/90-226....................VAAIAPKY.G-F----------VLR..............F.PEGKKDATGIDY-ED.--.
Q5MZB2_SYNP6/93-224....................LQANAKRF.S-F----------ELS..............F.PRNNLQ..QVSY-EP.--.
Q6D7N5_ERWCT/20-177....................LSAHMHEY.G-F----------YRP..............Y.A...HDLGGVAV-EP.--.
Q5M1U2_STRT1/104-240....................VKKIAPKY.G-F----------VLR..............F.PDGKTSSTGVGY-ED.--.
Q9CM23_PASMU/28-187....................LQQNLAHF.D-F----------ALP..............F.T.QLSQDKEIGY-EP.--.
Q7VNB4_HAEDU/28-186....................LHQHSASF.G-F----------Y................F.PFDGIQNSQVGE-EP.--.
Q8EZA8_LEPIN/48-196....................MFKNAKRF.G-F----------CQP..............YTPKSSRGNKGYKE-EK.--.
Q93A45_ENTFL/33-163....................FLKHMTDF.G-F----------ILR..............Y.QKGKESITNINY-EP.--.
Q8YQW0_NOSS1/118-249....................LEANAARF.G-F----------EMS..............F.PMDNSQ..GVSY-EP.--.
Q9PEZ7_XYLFA/74-202....................LQGHAGRF.G-F----------HLS..............Y.PRNNPH..GIVY-EP.--.
Q8DQQ1_STRR6/87-213....................LLDHAADY.G-F----------VVR..............Y.LKGKEKETGYMA-EE.--.
Q7NMR7_GLOVI/149-279....................LSRNAARF.G-F----------ELS..............Y.PPGNAV..GVGY-EP.--.
Q8XKL5_CLOPE/109-238....................LLENSHKY.G-F----------VLR..............Y.LKGKEDITGYSY-EP.--.
Q9CGZ2_LACLA/85-226....................VAAIAPKY.G-F----------VLR..............F.PEGKKAETGIGY-ED.--.
Q97KB0_CLOAB/144-267....................MGRLGQQV.G-L----------EWG................GNWTSYAITLVD-AP.--.
Q5QL26_GEOKA/14-137.............................S-L----------DRR..............W.FRVGQIGKSLGL-EWG--G
Q8DKC7_THEEB/90-221....................LAKNAARF.S-F----------ELS..............F.PRNNPQ..GVSY-EP.--.
Q8EST6_OCEIH/190-320....................VKENAANY.G-F----------IIR..............F.PEGKEDITKYQF-EP.--.
Q6LTW9_PHOPR/50-207....................LSAHMGEY.G-F----------YLP..............Y.A...EDKGGVAL-EP.--.

PF01427

VANX_ENTFA/1-202--------------HTAKG.IGNAEAQN-R-R..........CLR--------------K-IMESSGFQSYRF-EW----
DDPX_SYNY3/31-240--------------PNYYQTVEPNSDRQ-R-KEFEQYQRRRELLN--------------T-IMESAGFLRHPG-EW----
DDPX_ECOLI/3-187--------------AYHPS.VPPAAQRN-R-L..........LLN--------------A-IMTGGGFVGISS-EW----
VANX_ENTFC/1-202--------------HAANG.ISCNEAQN-R-R..........RLR--------------S-IMENSGFEAYSL-EW----
O53850_MYCTU/62-256--------------AFATQGVSAEAQAN-R-A..........HLR--------------A-AMQAGGLTVYSG-EW----

PF13539

A8ASL5_BPA50/72-136--------------------KK..VV..-A.A----------MKA--------------.........EGF...KWG--G
B1QZK9_CLOBU/207-275--------------------EE..LV..-S.A----------FEK--------------.........NN..F.VWG--G
Q3J4T3_RHOS4/201-266--------------------AY..EPFW-T.I----------VET--------------.........AG..ATSLG--R
A1ATB8_PELPD/203-268--------------------EY..AAWW-R.F----------WEE--------------.........EG..WVSLG--R
Q6F913_ACIAD/194-260--------------------QL..YG..-E.V----------AES--------------.........VGL...TWG--G
D1PEW6_9BACT/147-232--------------------DL..CY..-R.L----------FKA--------------.........KG..F.RWG--G
A9WTX9_RENSM/144-210--------------------HK..II..-A.D----------C..--------------.........NG..VVRWG--G
A3TM69_9MICO/118-184--------------------RS..IL..-T.Y----------C..--------------.........NG..VVRWG--G
A4SFK8_PROVI/119-180--------------------DE..AA..-R.I----------GLT--------------.........PDI...EWG--G
D4MUA4_9FIRM/428-503--------------------CK..LV..-K.I----------LEK--------------.........YGFNRGLWG--S
Q6LSS8_PHOPR/126-215--------------------EE..VI..-E.L----------FAK--------------.........NG..FQYWG--G
C4L6K0_EXISA/116-185--------------------QE..LG..-E.L----------GKA--------------.........LGF...EWG--G
B5PLN0_SALET/45-107--------------------LP..LG..-E.Y----------WES--------------.........LGG...SWG--G
B2GW16_BURPE/142-232--------------------ER..VV..-D.V----------FAD--------------.........NG..LLRWG--G
Q1QI98_NITHX/92-153--------------------QP..VI..-D.A----------FKR--------------.........QG..A.RWG--G
C4SEH9_YERMO/33-102--------------------MK..QA..-A.L----------EME--------------.........LPL...QWG--G
D5U8W6_BRAM5/259-337--------------------KS..VV..-K.T----------FEK--------------.........YG..F.IWG--G
A6LVB0_CLOB8/192-260--------------------KE..LV..-E.A----------FEK--------------.........NN..F.VWG--G
CWLK_BACSU/94-164--------------------LE..VV..-E.I----------AKT--------------.........LGF...EWG--G
C2N1K8_BACCE/54-120--------------------IR..YA..-K.Q----------...--------------.........IGF...EWG--G
B7RRA8_9RHOB/214-277--------------------TI..LA..-D.F----------FRT--------------.........EG..W.YWG--A
D4I121_ERWAC/54-123--------------------MK..KA..-S.A----------QSE--------------.........IPL...VWG--G
B1IKM8_CLOBK/171-239--------------------KE..IV..-E.T----------FEK--------------.........NN..F.IWG--G
B5U3R2_9CAUD/70-134--------------------DK..IV..-D.D----------F..--------------.........RG..IIEFG--G
C9MEJ1_HAEIF/54-128--------------------MF..QA..-A.K----------QLG--------------.........VAI...RWG--G
A9G830_SORC5/143-223--------------------KKRSAY..-ERT----------ALS--------------RCWIKAFERYGF...DWL--G
B3VGP8_9CAUD/82-143--------------------EE..GL..-R.L----------F..--------------.........EG..TVFWG--R
C1I574_9CLOT/169-237--------------------KE..LV..-R.V----------FED--------------.........NG..F.VWG--G
C7NA70_LEPBD/121-197--------------------GD..VV..-R.A----------FTS--------------.........RGW...VWG--A
E6VS38_DESAO/135-213--------------------HP..VV..-L.G----------FRR--------------.........LG..W.KWG--G
B7VJV8_VIBSL/123-214--------------------ED..VV..-E.L----------FAY--------------.........HG..FMIWG--G
C9MVB8_9FUSO/246-328--------------------IL..AV..-A.K----------SKN--------------.........INI...EWG--G
D1CHT9_THET1/273-355--------------------DV..VV..-R.A----------FER--------------.........IG..W.RWG--G
Q5DN15_9CAUD/21-99--------------------VK..QA..-A.R----------ELN--------------.........VPI...EWG--G
B3VFY1_9CAUD/64-131--------------------RE..LL..-A.F----------Y..--------------.........EG..TVFWG--N
A0RNH9_CAMFF/569-634--------------------KD..IV..-E.V----------FEK--------------.........NG..F.IWG--G
A3UWI6_VIBSP/67-136--------------------FK..QA..-A.D----------ELG--------------.........IPI...VWG--G
Q8ESQ8_OCEIH/97-167--------------------FE..VA..-E.I----------AKE--------------.........IGF...EWG--G
A7XF57_9CAUD/52-120--------------------FK..QA..-G.R----------ELG--------------.........VPV...EWG--G
C6LLE4_9FIRM/274-349--------------------GV..VA..-K.I----------FKK--------------.........YGFSQGDWG--D
C4Z3D8_EUBE2/109-193--------------------DL..CY..-K.V----------FAE--------------.........HG..F.EWG--G
B2U374_SHIB3/219-287--------------------FR..QA..-S.R----------ELN--------------.........IPV...EWG--G
E6VQR6_DESAO/135-213--------------------SP..LV..-V.Y----------LRK--------------.........QG..W.SWG--G
Q2SJV2_HAHCH/187-252--------------------KK......-..F----------IAS--------------.........VKAQLIRWG--G
B5UY55_BACCE/196-257--------------------KQ..MG..-Y.I----------GEQ--------------.........LGL...TWG--G
B7GIP5_ANOFW/70-132--------------------KR..VG..-A.I----------GKS--------------.........LGL...EWG--G
B4AH26_BACPU/73-136--------------------RR..VA..-Q.I----------GKS--------------.........LGF...SWG--G
B3VGG0_9CAUD/70-142--------------------RE..LL..-D.F----------Y..--------------.........ED..NVFCG--G
Q1ZSD0_PHOAS/130-219--------------------ET..VV..-D.I----------FAR--------------.........NG..FLYWG--G
C8XIK2_NAKMY/139-205--------------------RN..IL..-S.F----------F..--------------.........GD..VIYWG--G
D9SKR7_CLOC7/252-312--------------------AK..IA..-V.I----------GKQ--------------.........HGF...VWG--G
C7R275_JONDD/65-131--------------------RR..IL..-K.D----------L..--------------.........DG..VVRWG--G
C3WMV9_9FUSO/63-140--------------------AK..NA..-G.L----------LEK--------------.........YSI...EWG--G
A8ATB8_9CAUD/56-121--------------------IA..KA..-K.A----------...--------------.........LGF...SWG--G
C6ANB6_AGGAN/178-255--------------------KQ..IV..-G.I----------FEK--------------.........HG..F.IWG--G
A6FEU3_9GAMM/129-218--------------------ED..VV..-A.T----------FAD--------------.........NG..FLYWG--G
A7ILH7_XANP2/449-509--------------------....IGTG-E.L----------AKK--------------.........WGL...GWG--M
Q854X2_9CAUD/66-133--------------------RE..LL..-A.F----------Y..--------------.........EG..MIFWG--N
C9QJ38_VIBOR/123-214--------------------EE..VV..-D.L----------FAH--------------.........HG..FLIWG--G
Q7D1F2_AGRT5/53-126--------------------MK..QA..-A.K----------ELG--------------.........IPL...EWG--G
Q2P050_XANOM/208-274--------------------FL..YG..-E.L----------AQQ--------------.........AGL...EWG--G
A5MZT7_CLOK5/187-255--------------------KE..IV..-E.I----------FEK--------------.........NN..F.VWG--G
B1YFG8_EXIS2/71-136--------------------KR..IV..-A.A----------MKR--------------.........YQM...QWG--G
Q0RZ25_RHOSR/75-142--------------------RQ..ML..-T.E----------F..--------------.........EG..TVFWG--E
C4SJV6_YERFR/38-106--------------------MK..QA..-A.A----------ELG--------------.........IAV...EWG--G
A6SU28_JANMA/93-182--------------------ED..VV..-E.V----------FAQ--------------.........HG..FLGWG--G
C6RGB5_9PROT/616-681--------------------EE..IV..-R.V----------FEK--------------.........HG..F.IWG--G
B2S3I3_TREPS/209-287--------------------AE..II..-S.L----------FES--------------.........EG..F.IWG--G
C4ZCU4_EUBR3/194-278--------------------DL..CY..-K.L----------FTE--------------.........HG..F.EWG--G
Q7NS81_CHRVO/52-121--------------------MK..KA..-A.S----------ELK--------------.........IPI...VWG--G
D4J1D4_BUTFI/117-201--------------------DL..AY..-Q.L----------FIA--------------.........HG..F.QWG--G
A9DC71_9RHIZ/63-156--------------------LA..IK..-T.V----------AGK--------------.........QV..F.GWG--G
B9KTY8_RHOSK/205-268--------------------LY..LA..-E.Y----------FND--------------.........EG..W.YWG--A
Q1B8J0_MYCSS/185-266--------------------DP..AV..-L.V----------FTD--------------.........RG..W.RWG--G
A3ID77_9BACI/3-33--------------------SR..VG..-A.I----------ARK--------------.........LDI...EWG--G
A1SG61_NOCSJ/370-446--------------------HP..VV..-A.L----------MAR--------------.........HG..F.RWT--Y
A7HN00_FERNB/195-263--------------------KQ..LV..-E.I----------FES--------------.........NG..F.IWG--G
B5EIM6_GEOBB/377-491--------------------DP..LL..-S.A----------FRQ--------------.........RG..F.SWG--G
A9WKC4_CHLAA/591-661--------------------RE..LV..-P.I----------ANA--------------.........LG..F.FWG--G
Q4ES87_LISMN/56-121--------------------VA..KA..-K.S----------...--------------.........LGF...EWG--G
C8T4A1_KLEPR/54-122--------------------FK..QA..-A.A----------EYG--------------.........VTI...EWG--G
B2FJL7_STRMK/100-166--------------------QR..FG..-E.L----------AQQ--------------.........AGL...RWG--G
C9S248_GEOSY/68-133--------------------FR..VG..-Q.I----------GKS--------------.........LGL...EWG--G
A6TN75_ALKMQ/198-278--------------------DA..CY..-H.A----------FMS--------------.........RG..W.TWG--G
D4E385_SEROD/163-231--------------------VR..RA..-A.R----------ELG--------------.........IQV...EWG--G
A3X9V1_9RHOB/202-265--------------------TI..MA..-D.F----------FFA--------------.........EG..W.VWG--A
D1AMG7_SEBTE/126-206--------------------DV..CY..-N.A----------FKK--------------.........RG..W.TWG--G
E8WNQ9_GEOS8/380-487--------------------DP..LL..-T.P----------FRQ--------------.........RG..F.TWG--G
D2AZ54_STRRD/158-239--------------------DR..VV..-R.A----------FER--------------.........VD..W.EWG--G
B1YI53_EXIS2/118-187--------------------RE..VA..-A.V----------GKA--------------.........LGF...EWG--G
C0D0F9_9CLOT/238-322--------------------DL..AF..-K.V----------FSA--------------.........HG..F.SWG--G
C4K5R3_HAMD5/92-182--------------------EN..VI..-D.V----------FAR--------------.........HG..FIIWG--G
Q0A7S9_ALHEH/202-267--------------------EY..DPWW-R.F----------WEE--------------.........EG..WVSLG--R
B2K031_YERPB/45-107--------------------AP..LG..-E.Y----------WEK--------------.........LGG...TWG--G
D2PPJ5_KRIFD/298-379--------------------ST..AT..-R.S----------LVG--------------.........QG..Y.FWG--A
B4SDT7_PELPB/113-173--------------------KA..VG..-V.I----------GTD--------------.........LGL...EWG--G
Q2B7L2_9BACI/116-186--------------------DE..VV..-E.I----------AKG--------------.........LGF...EWG--G
D1ALL6_SEBTE/63-140--------------------IL..ST..-A.K----------RLG--------------.........IKV...ECG--G
B0MC55_9FIRM/144-230--------------------DR..VY..-R.I----------FRK--------------.........HG..F.QWG--G
A7ZD12_CAMC1/602-665--------------------EK..IV..-R.V----------FEK--------------.........HK..F.IWG--G
Q3STE6_NITWN/103-162--------------------RV..VI..-D.V----------FKA--------------.........HG..A.RWG--G
A5ECX3_BRASB/184-253--------------------QQ..IV..-E.I----------FER--------------.........HG..F.IWG--G
A9KN76_CLOPH/502-575--------------------DE..VI..-E.I----------FAS--------------.........YG..W.FWG--G
A7FDS7_YERP3/58-127--------------------MK..QA..-A.K----------VME--------------.........LPL...LWG--G
D1B2W5_SULD5/592-657--------------------KE..II..-D.I----------FEK--------------.........HG..F.IWG--G
C8X9H1_NAKMY/210-289--------------------DA..VV..-T.V----------FAD--------------.........HG..F.SWG--G
A0NQA8_9RHOB/173-238--------------------DA..IPFW-R.A----------WEA--------------.........EE..WVSLG--R
B9NP89_9RHOB/203-268--------------------DY..EPFW-N.I----------VMA--------------.........HG..GTPAG--Y
B0NZY2_9CLOT/146-232--------------------DT..AY..-K.I----------FKK--------------.........YG..F.SWG--G
B1JRT0_YERPY/56-124--------------------FK..LA..-A.K----------DVG--------------.........VSI...EWG--G
Q5WK03_BACSK/108-178--------------------FE..VA..-E.L----------AKE--------------.........LGF...EWG--G
C9XQ42_CLODC/189-268--------------------DD..CY..-N.A----------FVS--------------.........RG..W.SWG--G
B3Q3Z4_RHIE6/222-285--------------------VV..LA..-E.F----------FND--------------.........AG..W.YWG--A
C4XNT5_DESMR/200-269--------------------VA..IV..-T.A----------FEA--------------.........EG..F.IWG--G
A5UTX9_ROSS1/590-659--------------------RE..LA..-A.I----------ARH--------------.........FG..F.YWG--G
D3EJK7_GEOS4/101-171--------------------ME..VV..-E.I----------AKD--------------.........LGF...QWG--G
D4BTB0_PRORE/43-105--------------------KE..LG..-E.Y----------WES--------------.........LGG...SWG--G
D3ADD3_9CLOT/85-148--------------------TK..VG..-K.I----------GVS--------------.........LGL...EWG--G
Q7VJM2_HELHP/173-242--------------------LE..IV..-Q.A----------FEE--------------.........EG..F.IWG--G
Q7MR54_WOLSU/185-254--------------------LE..IV..-E.I----------FER--------------.........EG..F.IWG--G
A9DET4_9CAUD/64-132--------------------MK..QA..-A.K----------ELN--------------.........IPV...EWG--G
C0CNE7_9FIRM/225-310--------------------DV..CY..-Q.I----------FAK--------------.........YG..Y.SWG--G
C6LBK9_9FIRM/257-343--------------------DK..VY..-K.I----------FKK--------------.........YG..F.TWG--G
B9JYE5_AGRVS/104-165--------------------PR..VV..-D.A----------FKA--------------.........EG..W.IWG--G
D9QLQ3_BRESC/53-121--------------------IK..AT..-A.A----------ARG--------------.........VAL...VWG--G
B0VVC4_ACIBS/347-415--------------------KA..IG..-L.I----------GES--------------.........LGL...VWG--G
C4K6W4_HAMD5/53-119--------------------MK..QA..-A.E----------ELG--------------.........IRV...YWG--A
B2UP36_AKKM8/129-194--------------------EY..AAFW-Q.F----------VEA--------------.........EG..AVSLG--R
C4L144_EXISA/57-123--------------------VK..EA..-K.R----------...--------------.........LGF...TWG--G
Q97KB0_CLOAB/198-263--------------------NE..MG..-R.L----------GQQ--------------.........VGL...EWG--G
Q856Y8_9CAUD/70-151--------------------RE..LL..-A.W----------YTF--------------.........EGLQLVWWG--N
Q5J5L5_9CAUD/70-137--------------------RE..LL..-A.F----------Y..--------------.........EG..MVFWG--N
D0LWT6_HALO1/218-298--------------------ET..VV..-R.C----------FKK--------------.........AG..Y.AWG--G
A4G1C9_HERAR/140-229--------------------EE..VV..-D.V----------FAE--------------.........HG..FLIWG--G
Q0FH91_9RHOB/197-262--------------------QWLPAI..-R..----------...--------------...............LWG--G
D4CCJ4_9CLOT/58-129--------------------ER..AA..-S.V----------AEK--------------.........LGL...GWG--G
D0LQS8_HALO1/317-391--------------------ES..LL..-Q.I----------FLD--------------.........AGW...EWG--G
B6V2R4_BPSP1/74-136--------------------KR..VA..-Q.I----------AKD--------------.........LGF...EWG--G
Q7WHP8_BORBR/53-127--------------------MK..ES..-A.A----------RLE--------------.........IPL...EWG--G
A9KQC6_CLOPH/237-321--------------------DV..CQ..-K.A----------FAK--------------.........RG..F.TWG--G
C6WMZ1_ACTMD/132-213--------------------DV..VV..-T.A----------FES--------------.........RG..W.TWG--G
A3K5D3_9RHOB/148-231--------------------DA..VV..-T.A----------FEK--------------.........RS..W.GWG--G
A4FKJ2_SACEN/154-235--------------------DP..AV..-R.A----------FTD--------------.........RG..W.TWG--G
Q5YZK4_NOCFA/71-135--------------------RA..GL..-L.L----------F..--------------.........EG..CVFWG--A
Q1DAC7_MYXXD/63-125--------------------RV..LG..-D.E----------STK--------------.........AGL...VWG--G
D1BDT0_SANKS/65-131--------------------RD..IL..-R.D----------V..--------------.........SP..AVRWG--G
C7N3P8_SLAHD/215-297--------------------DL..CF..-Q.L----------FAE--------------.........AG..F.VWG--G
A6Q7D6_SULNB/126-212--------------------DR..AV..-K.I----------FKK--------------.........YG..W.KWG--G
B6VNP6_PHOAA/57-126--------------------VK..QA..-A.Q----------RLN--------------.........IPI...IWG--G
Q73V53_MYCPA/145-206--------------------........-G.A----------FQP--------------.........QN..ARGLS--G
D7VN70_9SPHI/69-137--------------------MK..VV..-N.F----------FKS--------------.........KGW...TWG--G
B5LJL3_9CAUD/69-133--------------------NR..GI..-A.L----------F..--------------.........EG..TVFWG--R
A8LRY3_DINSH/108-171--------------------LR..IY..-K.I----------FNA--------------.........HG..F.FWG--A
C9MWB5_9FUSO/152-227--------------------GD..VV..-R.A----------FTK--------------.........RGW...VWG--A
D0LZM8_HALO1/111-191--------------------GP..VT..-D.A----------FDA--------------.........VG..W.DWG--G
C9DBZ2_9CAUD/70-142--------------------DE..LL..-A.F----------Y..--------------.........ED..VIYCG--G
D7VVF1_9FLAO/66-136--------------------YE..CV..-K.I----------FAR--------------.........YGW...DWG--G
Q2SDK8_HAHCH/53-121--------------------VK..QA..-A.E----------ELG--------------.........IPI...EWG--G
C7RR41_ACCPU/164-241--------------------RD..IV..-T.I----------FEA--------------.........NG..F.IWG--G
A1SCY8_NOCSJ/370-428--------------------RG..VV..-A.I----------FKH--------------.........WG..F.TWG--G
B6FXG7_9FIRM/394-474--------------------DA..CY..-K.A----------FTS--------------.........RG..W.KWG--G
B6WQA8_9DELT/218-285--------------------SE..IV..-R.A----------FEA--------------.........EG..F.IWG--G
A4T1K8_MYCGI/149-230--------------------DA..AV..-L.A----------FTD--------------.........RG..W.RWG--G
Q7NR04_CHRVO/206-271--------------------NA..LG..-E.E----------AQA--------------.........AGL...TWG--G
D4CX41_9FUSO/55-123--------------------VK..EV..-A.R----------KLG--------------.........YII...TWG--G
B8J0M5_DESDA/248-315--------------------FA..IV..-D.A----------MEQ--------------.........AG..F.IWG--G
A8EV90_ARCB4/175-243--------------------LE..IV..-E.I----------FEK--------------.........YG..F.IWG--G
C6PUE1_9CLOT/429-508--------------------....IV..-K.V----------FQK--------------.........YKW...DWG--G
D9SMB1_CLOC7/196-264--------------------KE..LP..-Q.V----------FEN--------------.........NY..F.IWG--G
Q73JG3_TREDE/215-293--------------------KA..VI..-E.A----------FES--------------.........EG..F.IWG--G
B8ENP1_METSB/622-688--------------------RD..LV..-Q.I----------ANQ--------------.........FG..F.YWG--G
C8Q0B7_9GAMM/78-152--------------------ML..QS..-A.K----------ELG--------------.........VPV...RWG--A
C0QJJ2_DESAH/140-230--------------------ED..VV..-D.L----------FAE--------------.........HG..FFVWG--G
Q5DZ88_VIBF1/125-214--------------------EE..VI..-N.I----------FAQ--------------.........NG..FIYWG--G
C9MUL4_9FUSO/1065-1128--------------------NK..IA..-K.I----------GKE--------------.........IGF...EWG--G
C6D2R3_PAESJ/123-193--------------------ME..VV..-S.A----------AKK--------------.........LGF...AWG--G
D1PX89_9BACT/178-263--------------------DL..LH..-K.L----------FVK--------------.........HG..F.RWG--G
C3XMD6_9HELI/163-232--------------------LE..II..-L.A----------FEQ--------------.........EG..F.IWG--G
Q70K75_9ACTO/100-167--------------------RA..KL..-A.S----------M..--------------.........GG..QIVWG--G
C3K4K2_PSEFS/131-227--------------------ED..VI..-D.L----------FAN--------------.........NG..FLTWG--G
Q2LPY2_SYNAS/102-181--------------------RPEAPG..-A.L----------TES--------------SPVVQAFLRLGW...RWG--G
A8GLN1_SERP5/79-147--------------------FK..LA..-G.S----------QLG--------------.........IKI...EWG--G
C0AQZ5_9ENTR/54-123--------------------MK..QA..-S.S----------QLG--------------.........VSI...NWG--G
D1RF68_LEGLO/59-140--------------------SL..VY..-Q.E----------FIK--------------.........HG..W.DWA--G
C6BUG1_DESAD/184-249--------------------EY..DKWW-E.I----------WTD--------------.........EG..WTSLG--L
Q2LQQ3_SYNAS/55-131--------------------EE..AG..-R.I----------GES--------------.........VGL...RWG--G
C7PFT3_CHIPD/191-256--------------------RE..LV..-Q.I----------ANK--------------.........NG..F.YWG--G
A8ATR6_9CAUD/73-134--------------------AT..IV..-N.M----------MKR--------------.........RGF...KWG--G
C0ZX75_RHOE4/85-149--------------------RE..GL..-N.L----------F..--------------.........EN..NIFWG--A
D0DDG3_9RHOB/197-267--------------------PE..VI..-E.A----------FEA--------------.........YG..F.IWG--G
A6W8P6_KINRD/95-156--------------------ET..YA..-..I----------AAK--------------.........WSL...SWG--R
A7HJ25_FERNB/74-137--------------------EK..CG..-K.I----------AET--------------.........FGL...EWG--G
B4WAV9_9CAUL/53-121--------------------FK..AA..-A.L----------ELK--------------.........TPI...VWG--G
D2XRK5_9CAUD/70-137--------------------RE..LL..-A.F----------Y..--------------.........EG..TVFWG--Q
B5EHY6_GEOBB/165-227--------------------TL..IA..-P.F----------FNR--------------.........YG..W.VWG--A
B1YH87_EXIS2/72-135--------------------QQ..IV..-H.A----------MKR--------------.........QGF...SWG--G
A7ZFD8_CAMC1/46-110--------------------QE..IG..-N.Y----------WES--------------.........LNS.LNRWG--G
B8KYV5_9GAMM/51-117--------------------QR..FG..-E.L----------AEI--------------.........VGL...NWG--G
B2VDM6_ERWT9/41-110--------------------MK..QA..-A.A----------QLS--------------.........TPI...VWG--G
B9JF39_AGRRK/850-911--------------------........-...----------.AK--------------.........NG..L.SWG--G
E3I7F8_RHOVT/190-269--------------------PE..IV..-R.V----------FEK--------------.........HG..F.IWG--G
A1K513_AZOSB/150-214--------------------RL..LG..-E.E----------AEA--------------.........AGL...TWG--G
B4V6Z2_9ACTO/133-214--------------------GA..FV..-T.A----------FRT--------------.........AG..W.YWG--G
D0TJH0_9BACE/157-246--------------------DL..AY..-K.L----------FTE--------------.........AG..F.EWG--G
Q0AVH5_SYNWW/269-331--------------------NL..ILWE-K.A----------FKP--------------.........AG..F.SWG--N
D3VE22_XENNA/59-122--------------------MK..TA..-A.S----------ELG--------------.........IPI...EWG--G
A8S209_9CLOT/64-127--------------------QR..VG..-A.I----------GMS--------------.........LGL...EWG--G
C6VVI7_DYAFD/85-145--------------------EF..LAAW-R..----------..Q--------------.........NG..WICGA--D
C4SXE4_YERIN/30-99--------------------MK..IS..-A.E----------KLN--------------.........ILI...VWG--G
A5FFV9_FLAJ1/170-242--------------------LK..LV..-S.I----------FEK--------------.........YG..F.IWG--G
B2Q011_PROST/55-124--------------------MK..KA..-A.A----------ELN--------------.........VEI...EWG--G
Q98H40_RHILO/198-268--------------------LS..IV..-A.L----------FEK--------------.........QG..F.IWG--G
D1AEC5_THECD/163-244--------------------DA..VV..-K.A----------FAA--------------.........IG..W.GWG--G
D4DZ54_SEROD/54-122--------------------FK..QA..-G.K----------ELN--------------.........IPV...EWG--G
Q1MS64_LAWIP/228-297--------------------SE..LV..-G.I----------FEQ--------------.........RG..F.IWG--G

PF03411

MEPA_SHIFL/35-274--------------------LRKVRPWFQHRA----------HMHVRLRCPADSLECEDQPLPPSGDGCGAELQSWF..E
Q44614_BRUAO/61-309--------------------LGKVRPYWGHFY----------HFHVRLTCQPGSPECKPQPKVAPGDGCDKSLAWWFTDE
MEPA_HAEIN/42-281--------------------LHKIRPWHGHNS----------HFHVRLTCPADASYCENQAPVPAGDGCGDELYSWF..E

PF05951

Q9CNZ9_PASMU/32-183---------------------------HVDTGPVRTW-------------
Q9A852_CAUCR/63-213---------------------------HVDVGPVRKW-------------
E8VLY5_VIBVM/19-169---------------------------HIDTGPVRSW-------------
Q8YE08_BRUME/24-176---------------------------HMDVGNVRHW-------------
Q9KSI7_VIBCH/29-179---------------------------HIDTGPVRQW-------------
Q989B8_RHILO/15-167---------------------------HMDVGNVRHW-------------
Q92JX1_RHIME/6-158---------------------------HMDVGGVRAW-------------
Q98H74_RHILO/14-166---------------------------HMDVGNVRHW-------------
Q8EF76_SHEON/32-182---------------------------HVDCGPVRHW-------------
Q7CT90_AGRT5/14-166---------------------------HMDVGGVRAW-------------

PF08291

Q7Y5M4_BPSP6/6-108---------------------------HID--------------------
Q5LM88_SILPO/18-119---------------------------HVD--------------------
Q8PSL7_METMA/55-157---------------------------HVD--------------------
Q8VPZ8_RUMAL/197-303---------------------------HLD--------------------
CBPM_STRAL/126-241---------------------------HVA--------------------
Q5N402_SYNP6/73-183---------------------------HLD--------------------
Q8YUC7_NOSS1/127-243---------------------------HCD--------------------
Q64TT2_BACFR/11-127---------------------------HVS--------------------
Q64PK4_BACFR/2-135---------------------------HIG--------------------
Q6UGH3_BPSP6/4-106---------------------------HID--------------------
Q6UGC4_9CAUD/4-106---------------------------HID--------------------
Q64PJ8_BACFR/2-135---------------------------HVG--------------------
Q5NX34_AROAE/55-166---------------------------HLD--------------------
Q9AKY5_LEGPN/7-112---------------------------HIG--------------------
Q64TI5_BACFR/2-118---------------------------HVS--------------------
Q88L27_PSEPK/5-119---------------------------HLS--------------------
Q92KB7_RHIME/323-423---------------------------HID--------------------
Q8CJR3_STRCO/116-230---------------------------HVA--------------------
Q7MNT8_VIBVY/105-217---------------------------HYD--------------------

PF01085

HH_DROME/85-244---------------------------YCS--------------------
DHHA_XENLA/23-184---------------------------HVS--------------------
IHH_DANRE/24-184---------------------------HCS--------------------
O17499_BRAFL/28-188---------------------------HCS--------------------

PF02557

YODJ_BACSU/120-250.-W---------------....--...HLRY.VGK---------------
Q65US8_MANSM/26-185.-W---------------....--...HISY.LPL---------------
O83250_TREPA/106-230.-W---------------....--...HFRY.VGV---------------
Q63C99_BACCZ/98-228.-W---------------....--...HVRY.VGN---------------
Q8Y645_LISMO/113-243.-W---------------....--...HYRY.VGK---------------
VANY_ENTFC/105-222.-W---------------....--...HIRY.VGL---------------
Q7WZ84_9ACTO/63-172.-W---------------....--...HFEH.RPE---------------
Q5NHB6_FRATT/26-155.-W---------------....--...HWCY.HNE---------------
Q7V800_PROMM/59-190.-W---------------....--...HWRF.EGS---------------
Q7VCA8_PROMA/98-229.-W---------------....--...HWRF.EGT---------------
Q55957_SYNY3/161-291.-W---------------....--...HWRY.VAS---------------
Q632I9_BACCZ/97-214.-W---------------....--...HIRY.VGV---------------
Q7U788_SYNPX/101-232.-W---------------....--...HWRF.QGT---------------
Q9JN36_ENTGA/31-162.-W---------------....--...HFRY.VGL---------------
Q7NI07_GLOVI/108-238.-W---------------....--...HWRY.VGD---------------
Q9LA11_PAEPP/102-219.-W---------------....--...HIRY.VGL---------------
Q799B4_9PSEU/77-185.-W---------------....--...HFEL.RPE---------------
Q55454_SYNY3/106-237.-W---------------....--...HWRY.VGD---------------
AEPE_BPA50/18-205Y-W---------------....--...YKTY.IDD---------------
Q97E20_CLOAB/88-217.-W---------------....--...HVRY.IGL---------------
Q73Q11_TREDE/110-234.-W---------------....--...HYRY.LGV---------------
Q9KHM1_ENTFL/124-254.-W---------------....--...HYRY.VGV---------------
VANY_ENTFA/114-247.-W---------------....--...HYRY.VGI---------------
Q5YUU3_NOCFA/122-230.-W---------------....--...HFEL.ATI---------------
Q8ESQ8_OCEIH/43-171D-W---------------QHFK--DYPHLQMTFGL---------------
Q8RQJ7_BACCE/14-156.-W---------------....--...HYRY.VGK---------------
Q7N3J3_PHOLL/21-178.-W---------------....--...HISY.QPF---------------
Q5QTZ2_IDILO/20-179.-W---------------....--...HLSF.RAV---------------
Q9KHL8_ENTFL/43-173.-W---------------....--...HFRY.VGY---------------
Q8E2A2_STRA5/89-225.-W---------------....--...HYRY.VGV---------------
Q8K621_STRP3/87-223.-W---------------....--...HYRY.VGK---------------
Q633S7_BACCZ/108-238.-W---------------....--...HLRY.VGN---------------
Q7V1U4_PROMP/94-224.-W---------------....--...HWRY.EGS---------------
Q8EEB5_SHEON/50-206.-W---------------....--...HISY.FPV---------------
Q9KBW4_BACHD/101-218.-W---------------....--...HLRY.VGL---------------
Q8W6J4_9CAUD/231-375.-W---------------....--...HIET.AGA---------------
Q8CU74_STAES/77-207.-W---------------....--...HLRY.LGK---------------
Q67QI3_SYMTH/121-251.-W---------------....--...HVRY.LGR---------------
Q87MI5_VIBPA/23-179.-W---------------....--...HISH.KAI---------------
O51529_BORBU/101-225.-W---------------....--...HYLY.IGP---------------
Q5KZM0_GEOKA/119-249.-W---------------....--...HLRY.VGR---------------
Q63B61_BACCZ/95-225.-W---------------....--...HIRY.VGD---------------
Q8PBI7_XANCP/80-208.-W---------------....--...HWRW.WPA---------------
Q5WJW5_BACSK/100-228.-W---------------....--...HLRY.VGD---------------
Q8DWH5_STRMU/90-226.-W---------------....--...HYRY.VGV---------------
Q5MZB2_SYNP6/93-224.-W---------------....--...HWRF.VGD---------------
Q6D7N5_ERWCT/20-177.-W---------------....--...HISY.YPL---------------
Q5M1U2_STRT1/104-240.-W---------------....--...HFRY.VGK---------------
Q9CM23_PASMU/28-187.-W---------------....--...HISY.LPI---------------
Q7VNB4_HAEDU/28-186.-W---------------....--...HLSY.RPI---------------
Q8EZA8_LEPIN/48-196.-W---------------....--...HWSY.API---------------
Q93A45_ENTFL/33-163.-W---------------....--...HFRY.VGT---------------
Q8YQW0_NOSS1/118-249.-W---------------....--...HWRF.VGD---------------
Q9PEZ7_XYLFA/74-202.-W---------------....--...HWRW.RAR---------------
Q8DQQ1_STRR6/87-213.-W---------------....--...HLRY.VGK---------------
Q7NMR7_GLOVI/149-279.-W---------------....--...HWRW.VGS---------------
Q8XKL5_CLOPE/109-238.-W---------------....--...HYRY.IGD---------------
Q9CGZ2_LACLA/85-226.-W---------------....--...HFRY.VGL---------------
Q97KB0_CLOAB/144-267.-.---------------....--...HFQYTFGL---------------
Q5QL26_GEOKA/14-137D-W---------------KSFK--DYPHFQYTFGL---------------
Q8DKC7_THEEB/90-221.-W---------------....--...HWRF.VGD---------------
Q8EST6_OCEIH/190-320.-W---------------....--...HLRY.VGH---------------
Q6LTW9_PHOPR/50-207.-W---------------....--...HISY.HPI---------------

PF01427

VANX_ENTFA/1-202--W------------------------HYKLIDEP....YPDTYFNFAVS
DDPX_SYNY3/31-240--W------------------------HFSQGDQLWAWQYNQRHPDHQKI
DDPX_ECOLI/3-187--W------------------------HFELPQAASYPLLADQFSCFISP
VANX_ENTFC/1-202--W------------------------HYVLRDEP....YPNSYFDFPVK
O53850_MYCTU/62-256--W------------------------HFDGPGAG....VDRPILEVPVD

PF13539

A8ASL5_BPA50/72-136D.W........KS.....F..K..DYPHFEL-------------------
B1QZK9_CLOBU/207-275K.W.....G.........Y..F..DILHFEY-------------------
Q3J4T3_RHOS4/201-266A....................CNRDWMHFQF-------------------
A1ATB8_PELPD/203-268R....................KNYDWMHVQA-------------------
Q6F913_ACIAD/194-260R.W........KS.....I..Q..DYGHTEY-------------------
D1PEW6_9BACT/147-232D.W.....K.H.......S..K..DYQHFEK-------------------
A9WTX9_RENSM/144-210D.Y.....N.G.......R..K..DEMHFEI-------------------
A3TM69_9MICO/118-184D.Y.....S.G.......R..K..DEMHFEI-------------------
A4SFK8_PROVI/119-180H.W........KS.....F..P..DRPHYQL-------------------
D4MUA4_9FIRM/428-503R....................R..DYMHFSY-------------------
Q6LSS8_PHOPR/126-215F.W.....D.T.......P..I..DYQHFQV-------------------
C4L6K0_EXISA/116-185D.W........NS.....F..P..DYPHLQM-------------------
B5PLN0_SALET/45-107R.F........KS.....R..P..DGNHFSL-------------------
B2GW16_BURPE/142-232Y.W.....D.D.......P..I..DYQHFEV-------------------
Q1QI98_NITHX/92-153D.Y.....R.G.......R..T..DPMHFEF-------------------
C4SEH9_YERMO/33-102D.W........KS.....F..K..DGPHFEL-------------------
D5U8W6_BRAM5/259-337K.W.....H.........N..Y..DTIHFEY-------------------
A6LVB0_CLOB8/192-260K.W.....G.........H..F..DILHFEY-------------------
CWLK_BACSU/94-164D.W........KR.....F..K..DYPHLEM-------------------
C2N1K8_BACCE/54-120D.W........KG.....F..V..DSPHLQY-------------------
B7RRA8_9RHOB/214-277G.F.....S.........R..E..DSMHFEV-------------------
D4I121_ERWAC/54-123D.W........KT.....L..K..DGPHFEL-------------------
B1IKM8_CLOBK/171-239K.W.....N.........H..F..DTLHFEY-------------------
B5U3R2_9CAUD/70-134D.W.....T.S.......P..R..DEMHFEL-------------------
C9MEJ1_HAEIF/54-128D.WNMNESSDDEH.....F..Y..DGPHFEL-------------------
A9G830_SORC5/143-223H..........DD.....L..E..DTMHFEF-------------------
B3VGP8_9CAUD/82-143R.W.......S.......K..P..DEMHYDL-------------------
C1I574_9CLOT/169-237K.W.....E.........H..F..DILHFEY-------------------
C7NA70_LEPBD/121-197N.Y..................TRPDYMHFDF-------------------
E6VS38_DESAO/135-213H.W.....G.SRG.....R..V..DPMHFQK-------------------
B7VJV8_VIBSL/123-214D.W.....N.S.......P..I..DTQHFEV-------------------
C9MVB8_9FUSO/246-328N.W..................KMKDTPHFEL-------------------
D1CHT9_THET1/273-355Y.W.....S.D.......P..K..DYQHFSA-------------------
Q5DN15_9CAUD/21-99D.W........RT.....F..K..DGPHWQL-------------------
B3VFY1_9CAUD/64-131D.W.....N.S.......P..K..DAMHWNL-------------------
A0RNH9_CAMFF/569-634R.W.....E.........H..F..DTMHFEY-------------------
A3UWI6_VIBSP/67-136D.W........VS.....F..K..DGPHIEL-------------------
Q8ESQ8_OCEIH/97-167D.W........QH.....F..K..DYPHLQM-------------------
A7XF57_9CAUD/52-120D.W........VS.....F..K..DGPHLQL-------------------
C6LLE4_9FIRM/274-349S....................K..DYMHFSY-------------------
C4Z3D8_EUBE2/109-193D.W.....E.H.......A..K..DYQHFEM-------------------
B2U374_SHIB3/219-287D.W........KT.....L..K..DGPHFQL-------------------
E6VQR6_DESAO/135-213D.W.....V.APR.....P..Q..DNHHFQK-------------------
Q2SJV2_HAHCH/187-252D....................FQTLLESKDD-------------------
B5UY55_BACCE/196-257R.F........TT.....I..V..DYPHFEY-------------------
B7GIP5_ANOFW/70-132D.W........TS.....F..K..DYPHFQY-------------------
B4AH26_BACPU/73-136D.W........KS.....F..K..DYPHLEM-------------------
B3VGG0_9CAUD/70-142F.W.......D.......I..R..DWMHFQM-------------------
Q1ZSD0_PHOAS/130-219F.W.....N.S.......P..I..DYQHFQL-------------------
C8XIK2_NAKMY/139-205D.Y.....R.G.......T..T..DEMHFEI-------------------
D9SKR7_CLOC7/252-312D.W........TS.....F..K..DKPHFEK-------------------
C7R275_JONDD/65-131D.Y.....T.G.......R..K..DEMHFEI-------------------
C3WMV9_9FUSO/63-140NCW........RT.....F..K..DAPHWQI-------------------
A8ATB8_9CAUD/56-121D.W........SG.....F..V..DCPHMQY-------------------
C6ANB6_AGGAN/178-255K.W.....Y.........H..Y..DSVHFEY-------------------
A6FEU3_9GAMM/129-218F.W.....N.T.......P..I..DYQHFQV-------------------
A7ILH7_XANP2/449-509N.W...............SKTK..DPMHFST-------------------
Q854X2_9CAUD/66-133D.W.....N.S.......P..K..DSMHFQM-------------------
C9QJ38_VIBOR/123-214D.W.....N.T.......P..I..DTQHFEI-------------------
Q7D1F2_AGRT5/53-126D.W........KS.....F..K..DGPHFQL-------------------
Q2P050_XANOM/208-274S.W........RS.....I..K..DYVHLEK-------------------
A5MZT7_CLOK5/187-255K.W.....S.........H..F..DILHFEY-------------------
B1YFG8_EXIS2/71-136D.W........GS.....F..P..DYPHFQL-------------------
Q0RZ25_RHOSR/75-142D.W.......A.......T..K..DPMHTQI-------------------
C4SJV6_YERFR/38-106N.W........TT.....F..K..DGPHFQL-------------------
A6SU28_JANMA/93-182N.W.....D.A.......P..I..DYQHFQV-------------------
C6RGB5_9PROT/616-681R.W.....V.........S..F..DTMHFEY-------------------
B2S3I3_TREPS/209-287H.W.....M.........L..W..DTMHFEY-------------------
C4ZCU4_EUBR3/194-278D.W.....T.H.......S..K..DYQHFEK-------------------
Q7NS81_CHRVO/52-121D.W........KN.....F..R..DGPHFEL-------------------
D4J1D4_BUTFI/117-201A.W.....K.N.......S..K..DYQHFEV-------------------
A9DC71_9RHIZ/63-156D.W.....R.T.......I..K..DAMHFQI-------------------
B9KTY8_RHOSK/205-268A.Y.....N.........R..E..DSMHFEV-------------------
Q1B8J0_MYCSS/185-266D.W.....R.T.......P..K..DYQHFEL-------------------
A3ID77_9BACI/3-33D.W........TG.....N..I..DRPHFEV-------------------
A1SG61_NOCSJ/370-446G.L.....G...............DTQHFDY-------------------
A7HN00_FERNB/195-263K.W.....A.........H..F..DLMHFEY-------------------
B5EIM6_GEOBB/377-491A.W.....R.F.......P.....DYQHLEY-------------------
A9WKC4_CHLAA/591-661H.WNYDGRG.........A..S..DGMHFEW-------------------
Q4ES87_LISMN/56-121D.W........SG.....F..V..DNPHLQF-------------------
C8T4A1_KLEPR/54-122D.W........EK.....L..K..DGVHFQL-------------------
B2FJL7_STRMK/100-166A.W........KS.....F..K..DMPHVEM-------------------
C9S248_GEOSY/68-133D.W........KS.....F..K..DYPHFQY-------------------
A6TN75_ALKMQ/198-278E.W.....N.S.......L..K..DYHHFQK-------------------
D4E385_SEROD/163-231A.W........QS.....L..R..DGPHFQL-------------------
A3X9V1_9RHOB/202-265G.F.....R.........R..E..DSMHFEI-------------------
D1AMG7_SEBTE/126-206E.W.....K.S.......L..K..DYQHFEK-------------------
E8WNQ9_GEOS8/380-487S.W.....R.F.......P.....DYQHIEF-------------------
D2AZ54_STRRD/158-239Y.W.....S.G.......I..K..DYQHFSK-------------------
B1YI53_EXIS2/118-187D.W........KR.....F..V..DYPHFEM-------------------
C0D0F9_9CLOT/238-322D.W.....N.N.......P..K..DYQHFEK-------------------
C4K5R3_HAMD5/92-182D.W.....D.T.......P..I..DYQHFEV-------------------
Q0A7S9_ALHEH/202-267A....................RNFDWMHVQA-------------------
B2K031_YERPB/45-107R.F........KS.....N..P..DGNHFSL-------------------
D2PPJ5_KRIFD/298-379G.W.....S.K.......P.....DYQHFQP-------------------
B4SDT7_PELPB/113-173N.W........KT.....I..V..DEPHFQL-------------------
Q2B7L2_9BACI/116-186D.W........RS.....F..K..DYPHLQY-------------------
D1ALL6_SEBTE/63-140Y.W........KSP....F.....DPPHFEL-------------------
B0MC55_9FIRM/144-230D.W.....I.T.......Y..K..DYQHFEK-------------------
A7ZD12_CAMC1/602-665R.W.....K.........H..F..DTMHFEY-------------------
Q3STE6_NITWN/103-162D.Y...............RGRK..DPMHFEF-------------------
A5ECX3_BRASB/184-253R.W.....Y.........H..Y..DTMHFEY-------------------
A9KN76_CLOPH/502-575D.F.....E.I.......S..A..DTMHFQY-------------------
A7FDS7_YERP3/58-127D.W........KN.....F..R..DGPHFEL-------------------
D1B2W5_SULD5/592-657R.W.....Y.........H..Y..DTMHFEY-------------------
C8X9H1_NAKMY/210-289S.W.....R.E.......P..V..DYQHFSV-------------------
A0NQA8_9RHOB/173-238A....................RNFDWMHVQA-------------------
B9NP89_9RHOB/203-268A....................WGADWMHFQF-------------------
B0NZY2_9CLOT/146-232E.W.....R.S.......S..K..DYQHFEV-------------------
B1JRT0_YERPY/56-124D.W........KT.....L..K..DGPHFQL-------------------
Q5WK03_BACSK/108-178D.W........AN.....F..T..DYPHLQM-------------------
C9XQ42_CLODC/189-268Y.W.....K.N.......P.....DYQHFEK-------------------
B3Q3Z4_RHIE6/222-285G.Y.....S.........R..E..DSMHFEV-------------------
C4XNT5_DESMR/200-269K.W.....S.........E..F..DLMHFEY-------------------
A5UTX9_ROSS1/590-659H.F.....P.........R..L..DGMHFEV-------------------
D3EJK7_GEOS4/101-171D.W........AN.....F..P..DYPHLQI-------------------
D4BTB0_PRORE/43-105R.F........KT.....R..P..DGNHFSL-------------------
D3ADD3_9CLOT/85-148N.W........KS.....P..V..DKPHFQL-------------------
Q7VJM2_HELHP/173-242R.W.....W.........H..Y..DTMHFEY-------------------
Q7MR54_WOLSU/185-254K.W.....G.........H..Y..DTMHFEY-------------------
A9DET4_9CAUD/64-132D.W........KT.....F..K..DGPHFQL-------------------
C0CNE7_9FIRM/225-310D.W.....S.N.......P..K..DFQHFEK-------------------
C6LBK9_9FIRM/257-343D.W.....S.S.......P..K..DYQHFEA-------------------
B9JYE5_AGRVS/104-165D.W.....SPQ.......R..R..DGMHFQA-------------------
D9QLQ3_BRESC/53-121D.W........PR.....L..R..DGPHFEL-------------------
B0VVC4_ACIBS/347-415R.F........KT.....KNGP..DYPHFEL-------------------
C4K6W4_HAMD5/53-119C.W........SC.....I..N..DEDN..L-------------------
B2UP36_AKKM8/129-194S....................RDYDWMHFQF-------------------
C4L144_EXISA/57-123D.W........WN.....F..V..DKPHLQY-------------------
Q97KB0_CLOAB/198-263N.W........TS.....YAITLVDAPHFQY-------------------
Q856Y8_9CAUD/70-151D.W.....N.S.......P..K..DSMHFQM-------------------
Q5J5L5_9CAUD/70-137D.W.....T.S.......P..K..DAMHFQL-------------------
D0LWT6_HALO1/218-298D.W.....P.S.......F..R..DPMHFEL-------------------
A4G1C9_HERAR/140-229D.W.....D.A.......P..I..DYQHFQI-------------------
Q0FH91_9RHOB/197-262........................DAMHFQR-------------------
D4CCJ4_9CLOT/58-129R.W........TS.....I..V..DKPHLYL-------------------
D0LQS8_HALO1/317-391D.W...............NRVK..DYMHFED-------------------
B6V2R4_BPSP1/74-136D.W........KS.....F..Y..DAPHLEM-------------------
Q7WHP8_BORBR/53-127D.W........TT.....L..K..DGPHFQL-------------------
A9KQC6_CLOPH/237-321D.W.....Q.T.......S..K..DYQHFQK-------------------
C6WMZ1_ACTMD/132-213R.W.....Q.T.......P..L..DYQHFEL-------------------
A3K5D3_9RHOB/148-231T.W.....S.S.......A..K..DYQHFSE-------------------
A4FKJ2_SACEN/154-235H.W.....T.T.......P..I..DYQHFEM-------------------
Q5YZK4_NOCFA/71-135D.W.......T.......R..A..DEMHYQI-------------------
Q1DAC7_MYXXD/63-125R.................F..G..DSPHVQW-------------------
D1BDT0_SANKS/65-131D.Y.....S.G.......R..K..DEMHFEI-------------------
C7N3P8_SLAHD/215-297D.W.....T.D.......P..I..DYQHFEY-------------------
A6Q7D6_SULNB/126-212D.W.....S.G.......V..K..DYQHFSK-------------------
B6VNP6_PHOAA/57-126D.W........KS.....L..K..DGPHFEL-------------------
Q73V53_MYCPA/145-206P.RPHRPGPAARR.....R..P..GRARLHR-------------------
D7VN70_9SPHI/69-137D.W........KS.....F..K..DYPHFEK-------------------
B5LJL3_9CAUD/69-133N.W.......S.......R..V..DEMHFQI-------------------
A8LRY3_DINSH/108-171A.F.....P.........T..E..DAMHFEV-------------------
C9MWB5_9FUSO/152-227N.F..................RTRDYMHFGF-------------------
D0LZM8_HALO1/111-191D.W.....S.D.......Y..K..DYHHFAK-------------------
C9DBZ2_9CAUD/70-142Y.W.......S.......I..R..DWMHFQM-------------------
D7VVF1_9FLAO/66-136N.W........KT.....F..K..DLPHFEK-------------------
Q2SDK8_HAHCH/53-121D.F........NG.....F..F..DGPHYQL-------------------
C7RR41_ACCPU/164-241K.W.....F.........H..F..DTIHFEY-------------------
A1SCY8_NOCSJ/370-428D.W.....R.Y.......T.....DPMHFEM-------------------
B6FXG7_9FIRM/394-474N.W.....K.N.......S..K..DYQHFEK-------------------
B6WQA8_9DELT/218-285K.W.....H.........E..Y..DLMHFEY-------------------
A4T1K8_MYCGI/149-230H.W.....R.S.......P..L..DYQHFEI-------------------
Q7NR04_CHRVO/206-271V.W.........S.....F..R..DYGHIER-------------------
D4CX41_9FUSO/55-123D.W........KT.....F..K..DGPHFQI-------------------
B8J0M5_DESDA/248-315K.W.....H.........E..Y..DIMHFEY-------------------
A8EV90_ARCB4/175-243R.W.....Y.........H..F..DTMHFEY-------------------
C6PUE1_9CLOT/429-508N.F.....K.N.......P..K..DYMHFSY-------------------
D9SMB1_CLOC7/196-264K.W.....S.........H..F..DILHYEY-------------------
Q73JG3_TREDE/215-293K.W.....T.........L..W..DNMHFEY-------------------
B8ENP1_METSB/622-688H.F...............R..SRPDGMHFEV-------------------
C8Q0B7_9GAMM/78-152D.WDGDGKPRERG.....E..S..DSPHFEI-------------------
C0QJJ2_DESAH/140-230Y.W.....N.Y.......P..V..DYQHFQV-------------------
Q5DZ88_VIBF1/125-214Y.W.....D.T.......P..I..DFQHFQT-------------------
C9MUL4_9FUSO/1065-1128H.W........KT.....R.....DLPHFEM-------------------
C6D2R3_PAESJ/123-193D.W........TS.....F..K..DYPHLQM-------------------
D1PX89_9BACT/178-263A.W.....R.T.......V..K..DYQHFEK-------------------
C3XMD6_9HELI/163-232R.W.....W.........H..Y..DTMHFEY-------------------
Q70K75_9ACTO/100-167E.W.....S.T.......L..P..DDPHFEV-------------------
C3K4K2_PSEFS/131-227Y.W.....D.T.......R..I..DYHHFQI-------------------
Q2LPY2_SYNAS/102-181L.F........LH.....I..R..DYHHFEK-------------------
A8GLN1_SERP5/79-147D.W........KT.....L..K..DGPHFQL-------------------
C0AQZ5_9ENTR/54-123N.W........VS.....F..R..DGPHYEL-------------------
D1RF68_LEGLO/59-140D.W.....H.D.......L..Q..DYQHFEK-------------------
C6BUG1_DESAD/184-249A....................KNYDWMHIQA-------------------
Q2LQQ3_SYNAS/55-131R.F........RNSKGKPR..P..DYPHFEI-------------------
C7PFT3_CHIPD/191-256H.F.....T.........R..K..DGMHFEV-------------------
A8ATR6_9CAUD/73-134D.W........KS.....F..T..DLPHFEA-------------------
C0ZX75_RHOE4/85-149D.W.......S.......R..A..DEMHYQL-------------------
D0DDG3_9RHOB/197-267K.W.....H.........H..F..DGMHFEY-------------------
A6W8P6_KINRD/95-156E.W..................SRPDPMHFEA-------------------
A7HJ25_FERNB/74-137R.W........KN.....F..P..DKPHIQM-------------------
B4WAV9_9CAUL/53-121D.W........KS.....L..R..DGPHFEL-------------------
D2XRK5_9CAUD/70-137D.W.....N.S.......P..K..DPMHAQC-------------------
B5EHY6_GEOBB/165-227A.F.....R.........K..E..DGMHFEA-------------------
B1YH87_EXIS2/72-135D.W........SG.....F..K..DYPHFEL-------------------
A7ZFD8_CAMC1/46-110N.F........TS.....F..L..DTPHFER-------------------
B8KYV5_9GAMM/51-117R.W........TS.....P..K..DYPHVEL-------------------
B2VDM6_ERWT9/41-110D.W........KT.....L..K..DGPHFEL-------------------
B9JF39_AGRRK/850-911A.W.....N.S.......K..K..DAMHFEV-------------------
E3I7F8_RHOVT/190-269S.W.....Y.........H..F..DGMHFEY-------------------
A1K513_AZOSB/150-214R.W.........D.....I..R..DYGHVEM-------------------
B4V6Z2_9ACTO/133-214R.W.....G.N.......P.....DYQHFSA-------------------
D0TJH0_9BACE/157-246D.W.....T.S.......L..K..DYQHFEI-------------------
Q0AVH5_SYNWW/269-331S.Y.....S...............DSMHYEL-------------------
D3VE22_XENNA/59-122D.W........KS.....F..K..DGPHFQL-------------------
A8S209_9CLOT/64-127N.W........KS.....I..M..DNPHFQL-------------------
C6VVI7_DYAFD/85-145W.S.....E.R.......S..K..DGMHFQW-------------------
C4SXE4_YERIN/30-99D.W........KT.....L..K..DGPHFEL-------------------
A5FFV9_FLAJ1/170-242N.W.....K.........H..Y..DTMHFEY-------------------
B2Q011_PROST/55-124D.W........VN.....F..K..DGPHFQL-------------------
Q98H40_RHILO/198-268R.W.....Y.........H..Y..DTMHFEY-------------------
D1AEC5_THECD/163-244D.W.....T.G.......T..K..DYQHFSS-------------------
D4DZ54_SEROD/54-122D.W........KT.....L..K..DGPHFQL-------------------
Q1MS64_LAWIP/228-297K.W.....Y.........E..Y..DFMHFEY-------------------

PF03411

MEPA_SHIFL/35-274P-PKPG..TTKPEKKTPP....PLPPSCQALLDEHVI-------------
Q44614_BRUAO/61-309P-WKPAKPSGKPAKKPKPVMVSDLPKACAAVLNGPAP-------------
MEPA_HAEIN/42-281P-PKPG..TSVSKPKVTP....PEPFLCQQILNSPNR-------------

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window