Sequence alignment for CL0187

PF04225

Q8DE67_VIBVU/103-187SWKEYLVRDGD--TLSQVFRNN---------------------QLS----MSDLNALV----------RIEGDDKPLSQI
Q5E836_VIBF1/132-216KWHDYQIQEGD--TLYQVFRKN---------------------NLP----LTELNKVV----------KIEGADKPLSNI
Q87SY6_VIBPA/115-199DWKEYHVKNGD--TLAQVFRNN---------------------QLS----MADLSALV----------KIEGSDKPLSHI
Q9KP12_VIBCH/106-190AWQEYVVRQGD--TLSQVFRNN---------------------ELP----LTDINALV----------KVEGSDKPLSQI
Q6LM63_PHOPR/156-240EWAKHQVQKGE--TLSNIFREK---------------------SLP----LSDLYAVA----------AIEGEGKPLSQI
Q8Z161_SALTI/126-211QWRSYRVEPGK--TLAQLFRDH---------------------GLP----PTDVYAMA----------QVEGAGKPLSNL
Q66F97_YERPS/161-246NWQSYQVQTGK--TLAQLFRDN---------------------NLP----VNDVFAMA----------QVEGSDKPLSNL
Q9Z6D5_HAEDC/332-409VSKTLTVPKAT--SLMQLFREY---------------------GLN----ISDVNAMS----------KVN...NVVSKL
Q9CPE6_PASMU/307-388NSKTLTIPQGV--SLMQVFRNH---------------------NLN----IADVNAMT----------KASGAGNALSNF
OAPA_HAEIN/350-431SAKTLTVPKGV--SLMQLFRDN---------------------QLN----ISDVNAMS----------KATGAGNVLSSF
Q6D140_ERWCT/151-236PWRQYEIASGQ--TLAQLFRDN---------------------NLP----VSDVFAMA----------QVEGRDKPLSNL
Q65V97_MANSM/392-473ASKTLVIPQGT--SLMQVFRDN---------------------NLN----ISDVNAMT----------KANGAGGALSNF

PF01476

O51570_BORBU/97-139----YTAKEGD..TIESISKLV.....................GLS----QEEIIAWN..........DLRSKD.....L
O51570_BORBU/198-240----HYVKRGE..TLGRIAYIY.....................GVT----AKDLVALN..........GNRAIN.....L
O16237_CAEEL/335-378----ITVKPGD..TCFSIWTSQ.....................KMT----QQQFMDIN.........PELDCDK.....L
O16237_CAEEL/548-591----TEVKEGD..TCFKIWSAH.....................KIT----EQQFMEMN.........RGLDCNR.....L
O51570_BORBU/26-68----YKVVKGD..TLFSIAIKY.....................KVK----VSDLKRIN..........KLNVDN.....I
O51570_BORBU/147-189----YMVRKGD..SLSKLSQDF.....................DIS----SKDILKFN..........FLNDDK.....L
O16237_CAEEL/402-445----VKINPGD..TCFNIWTSQ.....................RMT----QQQFMDLN.........KRLDCDK.....L
O51570_BORBU/268-310----HSVAVGE..TLYSIARHY.....................GVL----IEDLKNWN..........NLSSNN.....I
O16237_CAEEL/208-251----LKIKEGD..TCYNIWTSQ.....................KIS----EQEFMELN.........KGLDCDK.....L
O16237_CAEEL/467-510----VQINPGD..TCFKIWSAQ.....................KLT----EQQFMELN.........KGLDCDR.....L
O16237_CAEEL/760-803----IEVIKGD..TCWFLENAF.....................KTN----QTEMERAN.........EGVKCDN.....L
O16237_CAEEL/711-751----ATITPGN..TCFNISVAY.....................GIN----...LTDLQ.........KTYDCKA.....L
O16237_CAEEL/271-314----YRFKKGD..TCYKIWTSH.....................KMS----EKQFRALN.........RGIDCDR.....L
LYTF_BACSU/176-218----YKVQLGD..SLWKIANKV.....................NMS----IAELKVLN..........NLKSDT.....I
LYTF_BACSU/309-351----YTVKSGD..SLWVIAQKF.....................NVT----AQQIREKN..........NLKTDV.....L
LYTF_BACSU/242-284----YTVKSGD..SLWKIANNY.....................NLT----VQQIRNIN..........NLKSDV.....L
EAE_ECO27/65-113----YTLKTGE..TVADLSKSQ.....................DIN----LSTIWSLN.........KHLYSSESEMMKA
XKDP_BACSU/161-218----YTVKKGD..TLWDIAGRFY..................GNSTQ----WRKIWNANKTAMIKRSKRNIRQPGH...WI
LYTF_BACSU/29-71----IKVKSGD..SLWKLAQTY.....................NTS----VAALTSAN..........HLSTTV.....L
LYTF_BACSU/94-136----YTVKSGD..SLWLIANEF.....................KMT----VQELKKLN..........GLSSDL.....I
YDHD_BACSU/4-46----HIVGPGD..SLFSIGRRY.....................GAS----VDQIRGVN..........GLDETN.....I
Q9W4G8_DROME/26-69----HSITAED..TMTRLALKY.....................DTS----IGRICRAN..........RMHSQD....VL
YDHD_BACSU/50-93----YTVQPRD..TLTAIAAKA.....................FVP----LERLRAAN.........PGISPNA.....L
YGAU_ECOLI/99-147----YTVKSGD..TLSAISKQVYG.................NANLY----.NKIFEAN........KPMLKSPD....KI
LYTN_STAA8/177-220----YTVKKGD..TLSAIALKY.....................KTT----VSNIQNTN..........NIANPN....LI
Q9ZXD7_BPPH1/170-213----YTVKKGD..TLSEIAVKT.....................GVS----MAKLQAYN..........GIKNAN....KI
CIH1_COLLN/110-153----HKVKSGE..SLTTIAEKY.....................DTG----ICNIAKLN..........NLADPN....FV
LYM2_ARATH/174-217----HVVKLGS..SLGEIAAQF.....................GTD----NTTLAQLN..........GIIGDS....QL
O65213_VOLCA/106-149----YTIQPGD..TFWAIAQRR.....................GTT----VDVIQSLN.........PGVNPAR.....L
Q9R0C2_RAT/126-169----YTVKSGD..TLYGIAAKL.....................GTN----VQTLLSLN..........GLQLSS....TI
Q9WYP0_THEMA/26-69----YKVQKND..TLYSISLNF.....................GIS----PSLLLDWN.........PGLDPHS.....L
CWLS_BACSU/227-269----YKVKAGD..SLWKIANRL.....................GVT----VQSIRDKN..........NLSSDV.....L
Q9ZXH8_9VIRU/389-432----YKVASGD..TLSAIASKY.....................GTS----VSKLVSLN..........GLKNAN....YI
LYTE_BACSU/151-193----YKVKSGD..SLSKIASKY.....................GTT----VSKLKSLN..........GLKSDV.....I
P60_LISIV/198-240----YTVKSGD..TIWALSSKY.....................GTS----VQNIMSWN..........NLSSSS.....I
LYS_BPB03/219-263----YKIKRGE..TLTGIAKKN.....................KTT----VSQLMKLN.........PNIKNAN....NI
YOCH_BACSU/80-122----YTIKAGD..TLSKIAQKF.....................GTT----VNNLKVWN..........NLSSDM.....I
Q9RW21_DEIRA/19-61----YTVKKGD..TLYSLARGS.....................GLT----VDALMRLN..........GLSTPE.....L
Q9RVW1_DEIRA/29-71----VVVRPGQ..TLYRIALQN.....................GLS----VAELQRLN..........GLHSTT.....I
NLPD_PSEAE/69-112----YIVRRGD..TLYSIAFRF.....................GWD----WKALAARN..........GIAPPY....TI
XLYB_BACSU/179-222----YHVKKGD..TLSGIAASH.....................GAS----VKTLQSIN..........HITDPN....HI
ALYS_ENTFA/363-405----YTVKSGD..TLNKIAAQY.....................GVS----VANLRSWN..........GISGDL.....I
O22808_ARATH/197-239----YLVAMGD..SISGIAEMF.....................NST----SAAITEGN..........ELTSDN.....I
Q9S4T2_LEGPN/45-88----HTVRSGE..TLYAIAFRY.....................DTD----YRRLAINN..........HLRPPY....SL
Q9WWV6_PSEPU/44-87----YIVKPGD..TLFSIAFRY.....................GWD----YKELAARN..........GIPAPY....TI
ACMA_LACLM/321-363----VKVKSGD..TLWALSVKY.....................KTS----IAQLKSWN..........HLSSDT.....I
Q53759_STAAU/361-404----HVVKPGD..TVNDIAKAN.....................GTT----ADKIAVDN..........KLADKN....MI
YAAH_BACSU/49-92----YDVKRGD..TLTSIARQF.....................NTT----AAELARVN..........RIQLNT....VL
Q9Z7C6_CHLPN/159-201----YIVREGD..SLSKIAKKY.....................KLS----VTELKKIN..........KLDSDA.....I
LYM1_ARATH/178-220----YVVKEID..TLVGIARRY.....................STT----ITDLMNVN..........AMGAPD.....V
CWLS_BACSU/159-201----YTVKLGD..SLWKIANSL.....................NMT----VAELKTLN..........GLTSDT.....L
O30793_PREIN/266-309----HTVRSNE..SLYDISQQY.....................GVR----LKNIMKAN.........RKIVKRG.....I
YAAH_BACSU/1-43----.MVKQGD..TLSAIASQY.....................RTT----TNDITETN..........EIPNPD....SL
Q9X7W8_STRCO/73-121----YTVKSGD..YLSKIADEQD...................VDGG----WKKLYADN.........REAVGSDP..SLI
Y888_DEIRA/206-252----YTVKPGD..SLSKIAEHYY..................GDQME----YKKIAHYN..........NISNPD....LI
O83190_TREPA/87-130----YEVREGD..VVGRIAQRY.....................DIS----QDAIISLN..........KLRSTR....AL
Q01498_9ASCO/439-487----YIVQEDD..TCVSIASKY....................PGLT----EQDIIDYNS......KNGDFYGCF....NL
O66890_AQUAE/95-137----YRVKRGD..SLIKIAKKF.....................GVS----VKEIKRVN..........KLKGNR.....I
Q03491_LISGR/31-73----VVVASGD..TLWGIASKT.....................GTT----VDQLKQLN..........KLDSDR.....I
AMIB_HAEIN/294-336----HIVKKGE..SLGSLSNKY.....................HVK----VSDIIKLN..........QLKRKT.....L
O84764_CHLTR/138-180----VIVKKGD..FLERIARSN.....................HTT----VSALMQLN..........DLSSTQ.....L
YOCH_BACSU/28-70----ITVQKGD..TLWGISQKN.....................GVN----LKDLKEWN..........KLTSDK.....I
P60_LISGR/177-219----YKVKSGD..TIWALSVKY.....................GVP----VQKLIEWN..........NLSSSS.....I
O83458_TREPA/113-156----YTVRRGD..TLFSIARML.....................NCS----LAALLAAN..........GISAAH....TI
LYTE_BACSU/88-130----YKVKSGD..SLWKISKKY.....................GMT----INELKKLN..........GLKSDL.....L
O86308_MICLU/174-221----IVVKSGD..SLWTLANEYEV.................EGGWT----..ALYEAN.........KGAVSDAA...VI
Q9RS36_DEIRA/200-243----HRVEIGD..TFYSVARRY.....................GIN----PIALQEYN.........PRLAGQT.....L
LYS_BPB03/165-209----HVVKKGD..TLSEIAKKI.....................KTS----TKTLLELN.........PTIKNPN....KI
CWLS_BACSU/29-71----IKVKSGD..SLWKLSRQY.....................DTT----ISALKSEN..........KLKSTV.....L
Q9RVW1_DEIRA/165-207----YRVQPGD..TLPKIGVKV.....................GLR----VEQLRRIN..........GLTGDA.....L
O83836_TREPA/311-355----YTVRKGD..TISAIALRA....................GLKH----MGTLLSVN..........GISNAR....RL
O83283_TREPA/97-148----YVVKNED..TLSQIAKKFYGS...............RIRGYY----FPIIMACS..........EGVVTHP..DRI
NLPD_SHIFL/123-166----YTVKKGD..TLFYIAWIT.....................GND----FRDLAQRN..........NIQAPY....AL
Q9RVW1_DEIRA/375-418----VRVGLRD..NARTLAQTY.....................GVT----PEQLRELN..........GFGSTG....YI
Q49846_MYCLE/114-162----VRVEAGE..SLQDVAARVAPD..............APVRQVS----.ERIRELN..........VLDSSM.....L
MLTD_ECOLI/343-385----YTVRSGD..TLSSIASRL.....................GVS----TKDLQQWN..........KLRGSK.....L
YNHG_ECOLI/42-85----YTVQEGD.KNLQAIARRF.....................DTA----AMLILEAN..........NTIAPV.....P
P60_LISWE/30-72----VVVEAGD..TLWGIAQSK.....................GTT----VDALKKAN..........NLTSDK.....I
YCFS_ECOLI/46-91----FHVVENDGGSLEAIAKKY.....................NVG----FLALLQAN.........PGVDPYV.....P
Q9Z704_CHLPN/124-166----VVVKKGD..FLERIARAN.....................HTT----VAKLMQIN..........DLTTTQ.....L
MUR2_ENTHR/257-299----YTVKSGD..SVWGISHSF.....................GIT----MAQLIEWN..........NIKNNF.....I
O83704_TREPA/66-109----YRVKKAD..TIIRIAARC.....................GIP----YDAVASLN..........RIETLH....TP
O08251_RHIML/166-209----IMVRQGD..TVTVLARRF.....................GVP----EKEILKAN..........GLKSAS....QV
Q9RS36_DEIRA/99-143----FRVRKGE..DLKKLAQRL.....................GVS----EGDIRRDN.........PQIDRRG....SL
Q9RVW1_DEIRA/300-342----YVVVPGD..TLAKIGVKV.....................GLR----VEQLQRLN..........GLSGTT.....I
Q9ZXH8_9VIRU/335-378----YTVRSGD..TLGAIAAKY.....................GTT----YQKLASLN..........GIGSPY....II
LYM1_ARATH/112-158----YKTRPSD..NLGSIADSVY..................GGLVS----AEQIQEAN..........SVNDPS....LL
YNEA_BACSU/40-90----IEVQQGD..TLWSIADQVAD.................TKKIN----KNDFIEWVA......DKNQLQTSD.....I
YEBA_SHIFL/98-142----YVVSTGD..TLSSILNQY.....................GID----MGDITQLAA......ADKELRN.......L
AMIB_HAEIN/387-430----HKVTKNQ..TLYAISREY.....................NIP----VNILLSLN.........PHLKNGK.....V
O83631_TREPA/607-650----HTIRSGD..TLYALARRY.....................GLG----VDTLKAHN..........RAHSAT....HL
O51277_BORBU/183-226----HKIKPGE..TLSHVAARY.....................QIT----SETLISFN..........EIKDVR....NI
P74517_SYNY3/87-130----HQVKEGE..SLWQISQAF.....................QVD----AKAIALAN..........SISTDT....EL
MUR2_ENTHR/338-380----YTVKSGD..SVWKIANDH.....................GIS----MNQLIEWN..........NIKNNF.....V
P73559_SYNY3/4-47----HVVKAGE..TIDSIAAQY.....................QLV----PATLISVN.........NQLSSGQ.....V
LPPB_HAEIN/147-190----YKVNKGD..TMFLIAYLA.....................GID----VKELAALN..........NLSEPY....NL
Q9Z704_CHLPN/188-233----YIVQEGD..SPWTIALRN.....................HIR----LDDLLKMN..........DLDEYKA..RRL
ENP1_LYSSH/53-96----YTITQGD..SLWQIAQNK.....................NLP----LNAILLVN.........PEIQPSR.....L
YKUD_BACSU/4-46----YQVKQGD..TLNSIAADF.....................RIS----TAALLQAN.........PSLQAG......L
P60_LISWE/316-358----YTVKSGD..SLSKIANTF.....................GTS----VSKIKALN..........NLTSDN.....L
ALYS_ENTFA/695-737----HTVKSGD..SLWGLSMQY.....................GIS----IQKIKQLN..........GLSGDT.....I
Q9RVW1_DEIRA/229-271----YTVRRGD..TLTSIGKFV.....................GLR----VEQLQRLN..........GLKDNT.....I
YGER_ECOLI/42-85----YTVKRGD..TLYRISRTT.....................GTS----VKELARLN..........GISPPY....TI
Y1288_MYCTU/107-153----YTVVAGD..TLSALAARFY..................GDASL----YPLIAAVN..........GIADPG....VI
O66890_AQUAE/174-216----YRVRRGD..TLIKIAKRF.....................RTS----VKEIKRIN..........RLKGNL.....I
Q38614_BPTU2/332-375----YVVKQGD..TLSGIASNW.....................GTN----WQELARQN..........SLSNPN....MI
Q9R0C2_RAT/56-99----YTVKSGD..TLSAIAAAN.....................GVS----LANLLSWN..........NLSLQA....II
Q56345_TREPA/262-308----YTVKRGD..TLWDLARSYY..................KTPWR----YMRIAEFN..........RLKNPD....HI
Q9WZ38_THEMA/285-331----VRVERGD..TLAKISNAFN..................LGPDG----VEKIMKLN..........GIDDPR....KL
Q03491_LISGR/300-343----YKVQNGD..SLGKIASLF.....................KVS----VADLTNWN..........NKNATS....TI
Q9X212_THEMA/212-255----HVVKRGE..TLWSIANQY.....................GVR----VGDIVLIN..........RLEDPD....RI
Q9VNA1_DROME/329-371----YTVGNRD..TLTSVAARF.....................DTT----PSELTHLN..........RLNSSF.....I
O83190_TREPA/137-181----YTVKNGD..TFSSIAAAH.....................QIS----LERLVLLN..........TPSSSKE...SP
LYS_BPPH2/163-207----YKVKSGD..NLTKIAKKH.....................NTT----VATLLKLN.........PSIKDPN....MI
ACMA_LACLM/245-287----YTVKSGD..TLWGISQRY.....................GIS----VAQIQSAN..........NLKSTI.....I
Q54524_STRPY/49-92----YTVKYGD..TLSTIAEAM.....................GID----VHVLGDIN..........HIANID....LI
LYS_BPPZA/214-258----HKVKSGD..TLSKIAVDN.....................KTT----VSRLMSLN.........PEITNPN....HI
O03950_9CAUD/399-442----YTVVSGD..SWWKIAQRN.....................GLS----MYTLASQN..........GKSIYS....TI
Q9RS36_DEIRA/46-90----YRVKPGE..TLYRIALNA.....................GLS----EETVQQAN.........PVLRGGH....AL
Q9RUQ7_DEIRA/87-130----HTAQRGD..TIYGLSRMY.....................GVS----VDALLAAN..........TLPRDT....KL
LPPB_HAESO/120-163----YKVRKGD..TMFLIAYIS.....................GMD----IKELATLN..........NMSEPY....HL
CWLS_BACSU/90-132----YTVAYGD..SLWMIAKNH.....................KMS----VSELKSLN..........SLSSDL.....I
ACMA_LACLM/395-437----HKVVKGD..TLWGLSQKS.....................GSP----IASIKAWN..........HLSSDT.....I
YKVP_BACSU/345-387----HHVTPGE..TLSIIASKY.....................NVS----LQQLMELN..........HFKSDQ.....I
Y593_CHLPN/316-358----YVVQDGD..SLWLIAKRF.....................GIP----MDKIIQKN..........GLNHHR.....L
ENP1_LYSSH/3-46----ILIRPGD..SLWYFSDLF.....................KIP----LQLLLDSN.........RNINPQL.....L
MLTD_ECOLI/402-443----YRVRKGD..SLSSIAKRH.....................GVN----IKDVMRWN............SDTA....NL
O64825_ARATH/121-166----YTIQPND..SYFAIANDTL..................QGLST----CQALAKQN..........NVSSQS.....L
O51302_BORBU/327-375----YVIKIGN..TLWGISKKLYNDP.............YLWPKIW----...FANRQ..........KIQNPD....LI
O07218_MYCTU/115-163----VRVETGE..SLYDVAVRVAPN..............APTRQVA----.DRIRELN..........GLQTPA.....L
Q9WYP0_THEMA/76-118----YTVKKGD..TLDAIAKRF.....................FTT----ATFIKEAN..........QLKSYT.....I
O83631_TREPA/734-777----HVVQQGD..TLWSLAKRY.....................GVS----VENLAEEN..........NLAVDA....TL
Q9RUQ7_DEIRA/41-83----LTVQRGD..TAYSIARRN.....................GLT----VDLLLAYN..........NLASPD.....I
LYTE_BACSU/28-70----IKVKKGD..TLWDLSRKY.....................DTT----ISKIKSEN..........HLRSDI.....I
SP6D_BACSU/525-568----CIVQQED..TIERLCERY.....................EIT----SQQLIRMN..........SLALDD....EL
Y1288_MYCTU/56-102----YTVVAGD..TLSALALRFY..................GDAEL----NWLIAAAS..........GIADPD....VV
O64825_ARATH/188-232----YTVVFED..TIAIISDRF.....................GVE----TSKTLKAN..........EMSFENS...EV
YPBE_BACSU/191-236----HTVQKKE..TLYRISMKYY..................KSRTG----EEKIRAYN..........HLNGND.....V
O84606_CHLTR/155-197----HIVKQGE..TLSKIASKY.....................NIP----VVELKKLN..........KLNSDT.....I
O83458_TREPA/67-110----HVIAKGE..TLFSLSRRY.....................GVP----LSALAQAN..........NLANVH....QL
O86394_NEIME/202-253----HTVRKGE..TVKQIAAAIRPKH.............LTLEQVA----.DALLKAN.........PNVSAHG....RL
O66890_AQUAE/26-70----YKVKKGD..SLWKIAKEY.....................KTS----IGKLLELN.........PKLKNRK....YL
Q9RTL1_DEIRA/23-65----YTVKAGD..TLSRIAGAY.....................GTD----ASTLMRMN..........GLRSTT.....I
MUR2_ENTHR/489-531----YTVKAGE..SVWGVANKN.....................GIS----MNQLIEWN..........NIKNNF.....I
CIH1_COLLN/185-228----YSVVSGD..TLTSIAQAL.....................QIT----LQSLKDAN.........PGVVPEH.....L
LYM2_ARATH/110-156----YTIKKDD..ILSFVATEIF..................GGLVT----YEKISEVN..........KIPDPN....KI
O02055_CAEEL/50-93----YQVQTDD..TLERIALKH.....................NCS----VSSLVRAN..........KLWSPS....AL
O84764_CHLTR/200-245----YVVKEGD..SPWAIALSN.....................GIR----LDELLKLN..........GLDEQKA..RRL
Q94298_CAEEL/187-227----ATVTPGS..SCYTISASY.....................GLN----...LAELQ.........TTYNCDA.....L
Q9ZJ37_HELPJ/321-363----HVVLPKE..TLSSIAKRY.....................QVS----ISSIQLAN..........NLKDSN.....I
O51277_BORBU/233-275----YIVKKND..SISSIASAY.....................NVP----KVDILDSN..........NLDNEV.....L
XLYA_BACSU/161-204----YVVKQGD..TLTSIARAF.....................GVT----VAQLQEWN..........NIEDPN....LI
Q94298_CAEEL/23-87----HTIKSGD..TCWKIASEASISVQELEGLNSKKSCANLAVGLS----EQEFTEMN.........EELDCNR.....L
Q94298_CAEEL/118-161----IHVKEGD..TCYTIWTSQ.....................HLT----EKQFMDMN.........EELNCGM.....L
O83836_TREPA/362-404----HTVQKGQ..SLSAIASLF.....................RLP----LNTLLDAN..........DLVSRA.....L
P74517_SYNY3/378-421----YQVKPGD..TLSQIARSH.....................DIQ----PEKIQQAN..........GLSNPD....EI

PF05489

Q94MD3_BPP2/1-60-MKTFAL.QGD--TLDAICVRYY--------------------GRT.EGVVETVLAAN---------PGLAELG---AVL
Q8ZKJ6_SALTY/5-61-EHVTT..DGE--RWDNLAWRYY--------------------GDA.LAY.ERIIAAN---------PHVAIM.---PVL
Q8XY29_RALSO/1-60-MRVRAI.QGD--TIDAICRRVY--------------------GRT.ASVTEAVLAAN---------PGIADLG---PIL
Q94MJ9_BPP2/1-60-MKTFAL.QGD--TLDAICVRYY--------------------GRT.EGVVETVLAAN---------PGLSELG---AVL
O80307_BP186/1-60-MKVRSM.QGD--TLDTICARYY--------------------GRT.EGVVETVLQAN---------PGLSELG---VIL
Q94MJ0_BPP2/1-60-MKTFAL.QGD--TLDAICVRYY--------------------GRT.EGVVEAVLAAN---------PGLAELG---AVL
Q94MH6_BPP2/1-60-MKTFAL.QGD--TLDAICVRYY--------------------GRT.EGVVETVLAAN---------PGLAELG---AVL
Q94ME2_BPP2/1-60-MKTFAL.QGD--TLDAICVRYY--------------------GRT.EGVVETVLAAN---------PGLAELG---AVL
Q94MC8_BPP2/1-60-MKTFAL.QGD--TLDAICVRYY--------------------GRT.EGVVEAVLAAN---------PGLAELG---AVL
VPX_BPP2/1-60-MKTFAL.QGD--TLDAICVRYY--------------------GRT.EGVVETVLAAN---------PGLAELG---AVL
Q8Z1F2_SALTI/1-60-MKVRAH.QYD--TVDALCWRHY--------------------GRT.QGVTEQVLQAN---------PGLAEYG---PFL
Q94MI5_BPP2/1-60-MKTFAL.QGD--TLDAICVRYY--------------------GRT.EGVVETVLAAN---------PGLAELG---AVL
Q48280_HAESO/3-64-RMVYAK.QND--TLDSIVYRYF--------------------GKT.LGLVEHVLELN---------PTLANL.---PIL
Q94MF1_BPP2/1-57-MKTFAL.QGD--TLDAICVRYY--------------------GRT.EGVVKAVLAAN---------PGLAELX---AVL
Q94MB5_BPP2/1-60-MKTFAL.QGD--TLDAICVRYY--------------------GRT.EGVVEAVLAAN---------PGLAELG---AVL
Q94MG6_BPP2/1-60-MKTFAL.QGD--TLDAICVRYY--------------------GRT.EGVVETVLVAN---------PGLAELG---AVL
Q94MD7_BPP2/1-60-MKTFAL.QGD--TLDAICVRYY--------------------GRT.EGVVETVLAAN---------SGLAELG---AVL
Q8ZMT5_SALTY/1-60-MKVRAH.QYD--TVDALCWRHY--------------------GRT.QGVTEQVLHAN---------PGLAEYG---PFL
Q9S568_PSEAI/3-62-TTCRTA.DGD--MLDSLCYHVY--------------------GHL.LGCVEATLDAN---------PGLADEQ---QPF
Q9P9S2_XYLFA/3-64-LHIYRTRHGD--TVDWLAWKYY--------------------ARTDTAIISAIYEAN---------HGLAAWG---PVL
Q8NKY5_XANAC/1-60-MRVHAM.QGD--TVDLLCWRHL--------------------GST.AGLVERTYLLN---------PGLAELG---AVL
Q94ME7_BPP2/1-60-MKTFAL.QGD--TLDAICVRYY--------------------XRT.EGVVGAVLAAN---------PGLAELG---AVL
Q94MJ4_BPP2/1-60-MKTFAL.QGD--TLDAICVRYY--------------------GRT.EGVVETVLAAN---------PGLAELG---VVL
Q8UI40_AGRT5/2-62-ATIYTTRQGE--TVDLACLAFY--------------------GRT.AKVVEAVIDAN---------PGLAALG---PVL
Q94MC4_BPP2/1-60-MKTFAL.QGD--TLDAICVRYY--------------------GRT.EGVVETVLAAN---------PGLAELG---AVL
Q8Z6T5_SALTI/5-61-EHITR..DGE--RWDSLAWQYY--------------------GDP.LGY.PRIIAAN---------PHVAIT.---PVL
Q94MH1_BPP2/1-60-MKTFAL.QGD--TLDAICVRYY--------------------GRT.EGVVETVLAAN---------PGLAELG---AVL
Q94MK4_BPP2/1-60-MKTFAL.QGD--TLDAICVRYY--------------------GRT.EGVVETVLAAN---------PGLAELG---AVL
Q8Z353_SALTI/1-60-MKVRAH.QYD--TVDALCWRHY--------------------GRT.QGVTEQVLKAN---------PGLAEYG---PFL
Q9ZXL9_9CAUD/2-61-ATVIAN.QSD--TVEALCWRHY--------------------GRT.AGVTEAVLEAN---------HGLADHG---PTL
Q94MI1_BPP2/1-60-MKTFAL.QGD--TLDAICVRYY--------------------GRT.EGVVETVLAAN---------PGLAELG---AVL
Q94MF6_BPP2/1-60-MKTFAL.QGD--TLDAICVRYY--------------------GRT.EGVVEAVLAAN---------PGLAELG---AVL

PF04225

Q8DE67_VIBVU/103-187KQGQLVRFKLNDTGQLDILQLEKGTT.SVMFFRLSDGGFGRSK
Q5E836_VIBF1/132-216KKGQLFRFKLNRQGDLDIVQIERDGQ.AIMYFRMSDGNFGRSK
Q87SY6_VIBPA/115-199KQGQLIRFKLSENGQLDMLQLEKSDH.SVMFFRLSDGSFGRNK
Q9KP12_VIBCH/106-190QAGQLIRFKLAENGQLDILQLERNNQ.SVMFFRLSDGGFGRSK
Q6LM63_PHOPR/156-240KSGQWLRYKQTPDGKLDALQIENSAG.SIMYFRRSDGSFARGK
Q8Z161_SALTI/126-211KNGQMIKIRQNASGVVTGLTIDGDNGQQVLFTRQPDGSFIRAQ
Q66F97_YERPS/161-246KAGQEVKIMLDAQGAVTALAIETPENTEVLFSRQNDGSYRREH
Q9Z6D5_HAEDC/332-409KVGERVTIRVDKDNRVTEMSIGSGGK....FTRQSDGTYKY.K
Q9CPE6_PASMU/307-388KAGDKVQISVNSQGRVNELRLENGAK....FIRQADGSYIYKK
OAPA_HAEIN/350-431KSGDKVTVSVNNQGRVNEMRLSNGAR....FVRQSDGSYQYKK
Q6D140_ERWCT/151-236RSGQEVKLQLNAQGMVAELEIETTANQTIRFTRGADGAFTRTR
Q65V97_MANSM/392-473KPGDKVQVSLNAQGRVKTMRLANGAT....FTRQADGTYQYSK

PF01476

O51570_BORBU/97-139KVGMKLVLT----------------------------------
O51570_BORBU/198-240KAGSLLNVL----------------------------------
O16237_CAEEL/335-378EIGKEVCVT----------------------------------
O16237_CAEEL/548-591EVGKEVCIV----------------------------------
O51570_BORBU/26-68KAGQILIIP----------------------------------
O51570_BORBU/147-189KIGQQLFLK----------------------------------
O16237_CAEEL/402-445EVGKEVCVA----------------------------------
O51570_BORBU/268-310MHDQKLKIF----------------------------------
O16237_CAEEL/208-251EIGKEVCVT----------------------------------
O16237_CAEEL/467-510EVGKEVCIA----------------------------------
O16237_CAEEL/760-803PIGRMMCVW----------------------------------
O16237_CAEEL/711-751EVGDTICVS----------------------------------
O16237_CAEEL/271-314VPGKELCVG----------------------------------
LYTF_BACSU/176-218YVNQVLKTK----------------------------------
LYTF_BACSU/309-351QVGQKLVIS----------------------------------
LYTF_BACSU/242-284YVGQVLKLT----------------------------------
EAE_ECO27/65-113APGQQIILP----------------------------------
XKDP_BACSU/161-218FPGQKLKIP----------------------------------
LYTF_BACSU/29-71SIGQTLTIP----------------------------------
LYTF_BACSU/94-136RAGQKLKVS----------------------------------
YDHD_BACSU/4-46VPGQALLIP----------------------------------
Q9W4G8_DROME/26-69QARRHVWVP----------------------------------
YDHD_BACSU/50-93QAGAKITIP----------------------------------
YGAU_ECOLI/99-147YPGQVLRIP----------------------------------
LYTN_STAA8/177-220FIGQKLKVP----------------------------------
Q9ZXD7_BPPH1/170-213TVGQVLKLT----------------------------------
CIH1_COLLN/110-153DLNQDLQIP----------------------------------
LYM2_ARATH/174-217LADKPLDVP----------------------------------
O65213_VOLCA/106-149QVGQVINVP----------------------------------
Q9R0C2_RAT/126-169YVGQVLKTT----------------------------------
Q9WYP0_THEMA/26-69RVGQEIVIP----------------------------------
CWLS_BACSU/227-269QIGQVLTIS----------------------------------
Q9ZXH8_9VIRU/389-432YVGQTLRIK----------------------------------
LYTE_BACSU/151-193YVNQVLKVK----------------------------------
P60_LISIV/198-240YVGQVLAVK----------------------------------
LYS_BPB03/219-263YAGQTIRLK----------------------------------
YOCH_BACSU/80-122YAGSTLSVK----------------------------------
Q9RW21_DEIRA/19-61RVGQVIKLP----------------------------------
Q9RVW1_DEIRA/29-71EVGQVLRVT----------------------------------
NLPD_PSEAE/69-112QVGQAIQFG----------------------------------
XLYB_BACSU/179-222KIGQVIKLP----------------------------------
ALYS_ENTFA/363-405FVGQKLIVK----------------------------------
O22808_ARATH/197-239FFFTPVLVP----------------------------------
Q9S4T2_LEGPN/45-88RVGQVLSLK----------------------------------
Q9WWV6_PSEPU/44-87RPGQPIRFS----------------------------------
ACMA_LACLM/321-363YIGQNLIVS----------------------------------
Q53759_STAAU/361-404KPGQELVVD----------------------------------
YAAH_BACSU/49-92QIGFRLYIP----------------------------------
Q9Z7C6_CHLPN/159-201YAGQRLCLQ----------------------------------
LYM1_ARATH/178-220SSGDILAVP----------------------------------
CWLS_BACSU/159-201YPKQVLKIK----------------------------------
O30793_PREIN/266-309KAGDRVVLP----------------------------------
YAAH_BACSU/1-43VVGQTIVIP----------------------------------
Q9X7W8_STRCO/73-121HPGLKLSID----------------------------------
Y888_DEIRA/206-252QPGQKLRIP----------------------------------
O83190_TREPA/87-130QVGQLLKIP----------------------------------
Q01498_9ASCO/439-487WEGDKICIS----------------------------------
O66890_AQUAE/95-137YVGQKLKIP----------------------------------
Q03491_LISGR/31-73VPGQKLTIK----------------------------------
AMIB_HAEIN/294-336WLNESIKIP----------------------------------
O84764_CHLTR/138-180QIGQVLRVP----------------------------------
YOCH_BACSU/28-70IAGEKLTIS----------------------------------
P60_LISGR/177-219YVGQTIAVK----------------------------------
O83458_TREPA/113-156HPGDVLVIP----------------------------------
LYTE_BACSU/88-130RVGQVLKLK----------------------------------
O86308_MICLU/174-221YVGQELVLP----------------------------------
Q9RS36_DEIRA/200-243NVGAVLSLV----------------------------------
LYS_BPB03/165-209YVGQRINVG----------------------------------
CWLS_BACSU/29-71YVGQSLKVP----------------------------------
Q9RVW1_DEIRA/165-207QIGQVLRLT----------------------------------
O83836_TREPA/311-355SVGDQITIP----------------------------------
O83283_TREPA/97-148RPGMKLVIP----------------------------------
NLPD_SHIFL/123-166NVGQTLQVG----------------------------------
Q9RVW1_DEIRA/375-418LPGMRVLVP----------------------------------
Q49846_MYCLE/114-162VAGQTLIAP----------------------------------
MLTD_ECOLI/343-385KPGQSLTIG----------------------------------
YNHG_ECOLI/42-85KPGTTITIP----------------------------------
P60_LISWE/30-72VPGQKLQVT----------------------------------
YCFS_ECOLI/46-91RAGSVLTIP----------------------------------
Q9Z704_CHLPN/124-166KIGQVIKVP----------------------------------
MUR2_ENTHR/257-299YPGQKLTIK----------------------------------
O83704_TREPA/66-109LEGRTLLLP----------------------------------
O08251_RHIML/166-209EPGQRLVIP----------------------------------
Q9RS36_DEIRA/99-143NAGQVLRLP----------------------------------
Q9RVW1_DEIRA/300-342EVGQVLKLR----------------------------------
Q9ZXH8_9VIRU/335-378IPGEKLKVS----------------------------------
LYM1_ARATH/112-158DVGTSLVIP----------------------------------
YNEA_BACSU/40-90QPGDELVIP----------------------------------
YEBA_SHIFL/98-142KIGQQLSWT----------------------------------
AMIB_HAEIN/387-430ITGQKIKLR----------------------------------
O83631_TREPA/607-650KIGQKLIIP----------------------------------
O51277_BORBU/183-226KPNSVIKVP----------------------------------
P74517_SYNY3/87-130QAGQVLNIP----------------------------------
MUR2_ENTHR/338-380YPGQQLVVS----------------------------------
P73559_SYNY3/4-47TPGQTILIP----------------------------------
LPPB_HAEIN/147-190SLGQVLKIS----------------------------------
Q9Z704_CHLPN/188-233KPGDQLRIR----------------------------------
ENP1_LYSSH/53-96HIGQTIQVP----------------------------------
YKUD_BACSU/4-46TAGQSIVIP----------------------------------
P60_LISWE/316-358QVGTVLKVK----------------------------------
ALYS_ENTFA/695-737YIGQTLKVG----------------------------------
Q9RVW1_DEIRA/229-271AVGQVLRLT----------------------------------
YGER_ECOLI/42-85EVGQKLKLG----------------------------------
Y1288_MYCTU/107-153DVGQVLVIF----------------------------------
O66890_AQUAE/174-216RVGQKLKIP----------------------------------
Q38614_BPTU2/332-375YAGQVISFT----------------------------------
Q9R0C2_RAT/56-99YPGQKLTIQ----------------------------------
Q56345_TREPA/262-308VAGTSIEIP----------------------------------
Q9WZ38_THEMA/285-331IAGRIIKVP----------------------------------
Q03491_LISGR/300-343YAGQELSVK----------------------------------
Q9X212_THEMA/212-255VAGQVLKIG----------------------------------
Q9VNA1_DROME/329-371YPGQQLLVP----------------------------------
O83190_TREPA/137-181PSVRTLVSP----------------------------------
LYS_BPPH2/163-207RVGQTINVT----------------------------------
ACMA_LACLM/245-287YIGQKLVLT----------------------------------
Q54524_STRPY/49-92FPDTILTAN----------------------------------
LYS_BPPZA/214-258KVGQTIRLS----------------------------------
O03950_9CAUD/399-442YPGNKLIIK----------------------------------
Q9RS36_DEIRA/46-90YAGQMLTIP----------------------------------
Q9RUQ7_DEIRA/87-130EVGQVLQLP----------------------------------
LPPB_HAESO/120-163SIGQVLKIA----------------------------------
CWLS_BACSU/90-132RPGQKLKIK----------------------------------
ACMA_LACLM/395-437LIGQYLRIK----------------------------------
YKVP_BACSU/345-387YAGQIIKIR----------------------------------
Y593_CHLPN/316-358FPGKVLKLP----------------------------------
ENP1_LYSSH/3-46QVGQRIQIP----------------------------------
MLTD_ECOLI/402-443QPGDKLTLF----------------------------------
O64825_ARATH/121-166FPGMRIVVP----------------------------------
O51302_BORBU/327-375HSNWKIIIP----------------------------------
O07218_MYCTU/115-163AVGQTLIAP----------------------------------
Q9WYP0_THEMA/76-118YAGQKLFIP----------------------------------
O83631_TREPA/734-777SLGMILKTP----------------------------------
Q9RUQ7_DEIRA/41-83EVGQVLRLR----------------------------------
LYTE_BACSU/28-70YVGQTLSIN----------------------------------
SP6D_BACSU/525-568KAGQILYIP----------------------------------
Y1288_MYCTU/56-102NVGQRLIMP----------------------------------
O64825_ARATH/188-232FPFTTILIP----------------------------------
YPBE_BACSU/191-236YTGQVLDIP----------------------------------
O84606_CHLTR/155-197FTDQRIRLP----------------------------------
O83458_TREPA/67-110VPGQRIVVP----------------------------------
O86394_NEIME/202-253RAGSVLHIP----------------------------------
O66890_AQUAE/26-70RPGEKICLK----------------------------------
Q9RTL1_DEIRA/23-65QVGQRLQIG----------------------------------
MUR2_ENTHR/489-531YPGQKLIVK----------------------------------
CIH1_COLLN/185-228NVGQKLNVP----------------------------------
LYM2_ARATH/110-156EIGQKFWIP----------------------------------
O02055_CAEEL/50-93FMKQFIRIP----------------------------------
O84764_CHLTR/200-245RPGDRLRIR----------------------------------
Q94298_CAEEL/187-227QVDDTICVS----------------------------------
Q9ZJ37_HELPJ/321-363FIHQRLIIP----------------------------------
O51277_BORBU/233-275FLGQKLFIP----------------------------------
XLYA_BACSU/161-204RVGQVLIVS----------------------------------
Q94298_CAEEL/23-87AVGNEICVS----------------------------------
Q94298_CAEEL/118-161EIGNEVCVD----------------------------------
O83836_TREPA/362-404TVGQRLFIP----------------------------------
P74517_SYNY3/378-421KAEQILVIP----------------------------------

PF05489

Q94MD3_BPP2/1-60PHGTAVELP...DVQTAPVA-----------------------
Q8ZKJ6_SALTY/5-61PSGVRLIIP...VISVTQTT-----------------------
Q8XY29_RALSO/1-60PHGTELVLP...DISPQRQA-----------------------
Q94MJ9_BPP2/1-60PHGTAVELP...DVQTAPVA-----------------------
O80307_BP186/1-60PNGTEIDLP...DVASSPVT-----------------------
Q94MJ0_BPP2/1-60PHGTAVELP...DVQTAPVA-----------------------
Q94MH6_BPP2/1-60PHGTAVELP...DVQTAPVA-----------------------
Q94ME2_BPP2/1-60PHGTAVELP...DVQTAPVA-----------------------
Q94MC8_BPP2/1-60PHGTAVELP...DVQTAPVA-----------------------
VPX_BPP2/1-60PHGTAVELP...DVQTAPVA-----------------------
Q8Z1F2_SALTI/1-60PHGLQVELP...DITASTTA-----------------------
Q94MI5_BPP2/1-60XHGTAVELP...DVQTAPVA-----------------------
Q48280_HAESO/3-64AIGTVVILPNSEDIQTTTNK-----------------------
Q94MF1_BPP2/1-57XHGTAVELP...DVQTA...-----------------------
Q94MB5_BPP2/1-60PHGTAVELP...DVQTAPVA-----------------------
Q94MG6_BPP2/1-60PHGTAVELP...DVQTAPVA-----------------------
Q94MD7_BPP2/1-60PHGTAVELP...DVQTAPVA-----------------------
Q8ZMT5_SALTY/1-60PHGLQVELP...DITASTTA-----------------------
Q9S568_PSEAI/3-62RAGLLISFP...DMPVVNVE-----------------------
Q9P9S2_XYLFA/3-64PEAIAITLP...DPAATPHT-----------------------
Q8NKY5_XANAC/1-60PHGTPVELP...EVTTTTAA-----------------------
Q94ME7_BPP2/1-60PHGTAXELP...DVQTAPVA-----------------------
Q94MJ4_BPP2/1-60PHGTAVELP...DVQTAPVA-----------------------
Q8UI40_AGRT5/2-62PLGTKITMP...DIPSTSTA-----------------------
Q94MC4_BPP2/1-60PHGTAVELP...DVQTAPVA-----------------------
Q8Z6T5_SALTI/5-61PSGLLLLIP...VIEAEDAR-----------------------
Q94MH1_BPP2/1-60PHGTAVELP...DVQTAPVA-----------------------
Q94MK4_BPP2/1-60PHGTAVELP...DVQTAPVA-----------------------
Q8Z353_SALTI/1-60PHGLQVELP...DIPTTTTV-----------------------
Q9ZXL9_9CAUD/2-61PPGLKVTMP...DIPTAAPE-----------------------
Q94MI1_BPP2/1-60PHGTAVELP...DVQTAPVA-----------------------
Q94MF6_BPP2/1-60PHGTAVELP...DVQTAPVX-----------------------

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window