Sequence alignment for CL0200

PF02996

Q7XD74_ORYSJ/24-143TDLEVNLLQDSLT---KIRSAATRLENASAALHDLSL.......RPKGKKMLVPLTASLYVPGTL.DDS---EK.....V
PFDA_AERPE/18-137IRDQIAELQGVLA---QLELRLRSVQAAKETVEKAAG.......QDGETLFPGDPELNTILKARL.LEP---GK.....A
Q966M4_CAEEL/9-128CNAAKARLEVETE---CRRIIADNYEKVLERAKEYSK........KLEAPILAKICEVGYFCGAHVVRT---NQ.....V
PFD3_DROME/49-168YRFMACNLEARRR---KLKSQIPDLERSLEMVNVLRK.......EDEERETQFLLSDQVFIKTLV.PPT---KT.....V
PFD3_YEAST/48-179YKFMQESKLATIK---QLKTRIPDLENTLKICQSLRNHSDEGDESDEPILLHYQLNDTLYTKAQV.DIP---EDRADLKV
PFD5_CAEEL/25-144CEQELNFFQESFN---ALKGLLTRNEKSISALDDVKI.......ATAGHTALIPLSESLYIRAEL.SDP---SK.....H
PFDA_SULAC/24-143LRQYIDTLQKNLA---EVLESLEAVRASKSAVDEIGK.......ENQEYLLFGDRKGNIVFKVNS.VDK---NK.....V
Q8T965_DROME/58-178YSELAAKLETDLT---AVLTRLEAAKNNLELVRRFID......NPDKEVHSLVQIAQGVFRWVSI.PPV---QK.....V
PFDA_THEVO/12-130IESLISSVDAQID---AINKMVLEVQTTIQILSSDEL........RQSKERLISVGSGIFANGNL.DLD---SD.....L
Q9ZW98_ARATH/26-144MEEKIGEKRVEMN---RLQQYVDENDNLINLVKKLPD........QLHHNVMVPFGKMAFFPGRL.IHT---NE.....C
PFDA1_METJA/18-133YNQQLQMIQSEIT---SIRALKSEIMNSIKTIENIKA..........DEETLIPVGPGVFLKAKI..VD---DK.....A
PFDA_METAC/18-140LQRQAEALRQEMG---MIQTSISSCDQTIVTINELKAA....SEAGKPAETMVPVGFGSYVYAEV.KNP---DR.....I
Q8VZL7_ARATH/20-140LKQKLVHATASRD---KIFEEQKTLSDLRKNLETLEK......NGVNSLKTRVNLGSEVYMQAEV.PDT---RH.....I
PFD3_CAEEL/47-169YKYVESSMLAQKV---RMSEKIPEFENSLSIIDTLIAK....RAADESFETTFLLSDDVYTKATV.QKP---EK.....V
BUD27_YEAST/8-126VESTLKNLQDKRN---FLSEQREHYIDIRSRLVRFINDNDDGEEEGEGQGMVF.........GDIIIST---SK.....I
PFD3_SCHPO/39-159YKFMETSVVRRVA---SLDDKIPDIRKTLQSVQFLKE......RQGDSFTVTYELNDTLNAKAEV.EAK---DN.....V
PFD3_ARATH/53-175YKVVEMKLLAQQR---DLQAKIPDIEKCLEVVATLEAK....KGTGEALLADFEVSEGIYSRACI.EDT---DS.....V
PFDA_SULSO/20-139LKRYIDSLQRTQL---ELLESINSIDSAKQAIETMKS.......GNKEMLVFIDRKGYLLAKVGG.IIG---DK.....V
PFD3_MOUSE/59-181YKFMELNLAQKKR---RLKGQIPEIKQTLEILKYMQKK....KESTNSMETRFLLADNLYCKASV.PPT---DK.....V
PFDA_AQUAE/26-145YMANIEALRAEIS---VINQSITDLRTAEATLRSLKE.......LGKGKEVLIPVGATAQIKAKS.EGV---DE.....V
PFD5_SCHPO/25-146LDSELEYLSTSYG---QLGRAQLKFRECLANVNDAVR......AENDGKEVLVPLTSSLYVPGKLNLGN---SK.....L
Q20070_CAEEL/23-143IHPKIATEEKEFK---KLQKQCEEYAKLKFTCQRLLN......EAPKTTEGKTELGQRVFMNIEV.RDT---KH.....V
PFDA_HALSA/21-137IEEEVEELEADVA---SLRQEQTEIEEAKEALDVLET..........GATVQVPLGGDAYVRAEV.KDM---DE.....V
Q9VJP9_DROME/35-155LKEDLRELEKCIG---QYNEEIMEYVQLKNTLQTFDT......HLPDGYKTQVNIGSNVFMQARV.RKM---DS.....I
PFDA_PYRFU/17-137VQAQAQLLAQNLE---LLSLAQAEVQTVKETLENLMK......IEDENPEILVPIGAGSFLKGKI.VDK---NN.....A
Q9W148_DROME/8-126LLQALQTNASETE---RWEAFKRDNESTIRNLDKFAK........NLSVEVMVPIGRKALMPGEL.IHT---NE.....L
PFDA_THEAC/12-130IESLISSVDSQID---TLNKAMIEVQSTIDLLSNGDL........ASSPEKLISIGSGLFAKGNI.TID---ED.....L
PFDA_ARCFU/17-136LQEEAEALQRRLM---ELEILENEYRKTLETLEFFES.......IDTSVEALMNLGGGVFAYVDV.KNS---KK.....M
PFDA_SULTO/24-142LKKYIDYLQKTYA---ELQDNIMSIDSSLQALKELQN........SQELLMVGDKRGNVIFKVQG.IDK---AK.....V
PFDA_PYRAE/16-132IGELLSSLQAQHA---TVAELLEELTTALDGVRLLKG.........EGGERLVHIGAGLFVKG.V.FEA---KE.....V
PFDA_METTH/17-135YQSQVELIQQQME---AVRATISELEILEKTLSDIQG........KDGSETLVPVGAGSFIKAEL.KDT---SE.....V
PFD5_YEAST/23-143FDQELQHFTQSLQ---ALTMAKGKFTECIDDIKTVSQ......AGNEGQKLLVPASASLYIPGKI.VDN---KK.....F
PFDA_METKA/24-143LQGQMEAINAQID---LIESSISELNRVEETLKGVKE.......LEGDEEVLVPVGAQSFVRACV.TDT---ER.....V
PFDA_PYRHO/18-138LQAQAQILAQNLE---LLNLAKAEVQTVRETLENLKK......IEEEKPEILVPIGAGSFLKGVI.VDK---NN.....A
PFD5_ARATH/25-144ADLEVNLLQDSLN---NIRTATVRLDAAAAALNDLSL.......RPQGKKMLVPLTASLYVPGTL.DEA---DK.....V
PFDA2_METJA/15-134YIAQIEGLRAEIG---RLDATIATLRQSLATLKSLKT.......LGEGKTVLVPVGSIAQVEMKV.EKM---DK.....V
PFD5_DROME/31-150FEQEITNVQDSLS---TLHGCQAKYAGSKEALGTFQP.......NWENRQILVPLTSSMYVPGRV.KDL---NR.....F

PF01920

Q75AC1_ASHGO/8-113-NVLQLKYNEYKQ---TLEELQTKIIELGNDKEEHEV-------VLTTLNGV--------------DKA...RK-----C
Q754N3_ASHGO/19-124-QQRINEFSKLVM---RKDALEAELRSQRQEKEYVDD-------AALEIELV--------------DED...AA-----L
Q7Q0Q5_ANOGA/10-115-TEMQVNKIESTK---KIRLLDMKMDSLKLSKQRIEV-------TNRHISNL--------------APE...TR-----V
Q7Q629_ANOGA/24-129-EEIAAEFQQLRN---QQRNLVNNLNTIEMDLKEHKT-------VIDTLKTV--------------ESS...RK-----C
Q7QIM0_ANOGA/26-131-QMKINKFANYNA---KVEDLKEELRIKQNELKNLEE-------AGDEIELL--------------DDD...VQ-----I
PFD4_SCHPO/11-119-QRNLNEFSVLHS---RKAIQELDIKNLKTQIEDIVD-------AKNECELL--------------DEDDGDDI-----P
PFDB_HALSA/10-115-QEKLEQLQDLQE---KAQNVATQKQQAEQQLSEAET-------ALDALGDI--------------EES...TT-----M
PFDB_PYRAE/9-114-QDLVNRFNQAQA---QLQNVLLRKQQYEAELKEVEK-------AISEIERL--------------PQD...AK-----I
Q9VMH8_DROME/13-118-TEMQINKLETTK---KIHMIDMKCDMVKTGKQKYQL-------TEKGTSSL--------------ADD...TR-----V
Q9AR47_MAIZE/16-120-QQNINRFGRLNN---RLHELQDEIKLAKETNENLDD-------AGNELILS--------------DED....V-----V
PFD6_CAEEL/8-113-EEEVNKLRTLEK---DREKYFTSRQEMEMRLTESKN-------VKAELDLM--------------ESD...SK-----V
PFDB_AERPE/10-115-EAKYTKYLKLRE---TLSVVMREKATVEAGLAEVES-------VLKELEGL--------------PED...AE-----L
Q9P3P3_NEUCS/13-118-REIEAQSIAAQQ---QIGLVRTQQASKQREMRLAQL-------TRNELATL--------------PET...TA-----V
Q8X061_NEUCS/25-131-QDKINRFSRLHQ---RELALEEELKNKNKEKEELDD-------LETELELV--------------EDE..DEL-----V
Q6XHQ2_DROYA/13-118-QTEVESYQNLQK---SCVKMVKQRALLESQLNENKC-------VLDELNLL--------------GPD...NK-----V
PFDB_SULSO/10-115-QAQLAKFQQLKD---QLDRLLLEKSTIENELREINK-------VLEELSVL--------------NAD...AT-----I
Q7SF61_NEUCR/12-117-QDLQLQYTTYKN---TLQQIAQKIGDVEQEAEEHKL-------VLETLDPL--------------PAD...RK-----C
PFDB_METJA/8-112-QAQLMQLQQLQQ---QLQMILMQKQSVETELKECKK-------ALEELEKS--------------SSD....E-----V
PFDB_ARCFU/9-114-QNLVAQLQQLQQ---QLQAVITQRAQVEALLRDTEQ-------ALEELQKV--------------DDE...TP-----V
PFD2_DROME/13-118-EAIVAQFQQLRN---EQRNLVNSLNTLEMDLREHKT-------VIETLEAA--------------DPE...RK-----C
A8BVJ1_GIAIC/22-128-QQMINTFARLHM---VYVELAEQRKVLKKRLDDIES-------ASVALLEL--------------DDT..EVK-----P
PFD4_YEAST/19-124-QQKINEFSKLIM---RKDAIAQELSLQREEKEYLDD-------VSLEIELI--------------DED...EP-----V
Q8I3A4_PLAF7/20-125-QKKIGKFTNLHY---KEPLYEHKIKMMKENIMNIDS-------SIDEVSLA--------------FDS...ND-----I
Q8GYJ1_ARATH/14-119-ENKANDLGKIQK---DIGKNHQLRKKYTIQLGENEL-------VLKELDLL--------------EED...AN-----V
PFD1_HUMAN/14-119-TELQAKVIDTQQ---KVKLADIQIEQLNRTKKHAHL-------TDTEIMTL--------------VDE...TN-----M
Q8LDK1_ARATH/19-123-QQNINIFSRLNN---RVHDLDDDIKSAKEKCENLED-------AGNELILA--------------DEE....M-----V
PFD6_SCHPO/2-107-EELAKKYQNLQT---ELSTYVESLKKLETQLQENTT-------VLNELEKV--------------APD...SN-----I
Q7SX94_DANRE/10-115-QAELEKYQQLQK---DVSKSMSARQKLEAQLTENNI-------VKEELALL--------------DSQ...NT-----V
Q7RAS5_PLAYO/64-169-QKKIGKFTNLHY---KQSLYQQKIKLMKEKISNIDS-------AIDEVSLV--------------FDP...ND-----V
PFDB_METTH/8-113-QHQLAQFQQLQQ---QAQAISVQKQTVEMQINETQK-------ALEELSRA--------------ADD...AE-----V
Q94AF7_ARATH/11-116-MEIQASMIELTG---KLKQVQNQMRNKEGDRKRAFL-------TLEELRPL--------------PEE...TN-----T
PFD2_CAEEL/18-123-RKVVEKFKALRD---QQQDIAAEVTRIEEERREFGR-------VLEVIKDL--------------EPD...QK-----C
Q8ILS7_PLAF7/18-118-SKLT..YEQIEK---DRVQLVSKIEELYQDVVEHKL-------VLEALENV--------------PSD...RR-----C
PFD4_HUMAN/20-126-QQKINKFARNTS---RITELKEEIEVKKKQLQNLED-------ACDDIMLA--------------DDD..CLM-----I
PFD4_CAEEL/12-119-QALLNKFARSYQ---TQTQLKADVKEAKTLIDNINE-------ASDEILLL--------------DDED.SAS-----I
Q6L0A9_PICTO/11-117-QNQIKQAQDIEA---QIESIASQRYQLDVLIRELDK-------TIKELKSI--------------SEG...TP-----V
Q6UNN7_9HYPO/29-134-QDKINKFSRLHQ---RELALEEQLKGKSKEKEELDD-------LSTELELA--------------DED...EK-----I
PFD6_HUMAN/10-115-QGEVEKYQQLQK---DLSKSMSGRQKLEAQLTENNI-------VKEELALL--------------DGS...NV-----V
PFD1_SCHPO/6-111-SQIQEKAVDSQQ---QLRTIMVQIAAKERALKISEL-------AKKELEDV--------------GED...KA-----V
PFDB_METKA/6-111-EQQVAQLQQLQQ---QLSSIVAQKQQLELQLREIER-------ALKELDEI--------------EED...TK-----V
PFDB_METMA/10-115-QNQIAQLQQVQQ---QVQALSMQKSQIEAMQKESKM-------ALEELERL--------------ADD...AV-----I
PFD1_CAEEL/11-116-RDLQFKTNETRM---RIVQGEQNKKVNYQKMRISES-------TKKNLVDL--------------DEN...LK-----Y
PFDB_PYRHO/9-114-QAMLGQLDTYQQ---QLQLVIQQKQKVQADLNEAKK-------ALEEIETL--------------PDD...AQ-----I
Q7S0H5_NEUCR/10-115-QALSDEYQNLNK---ELQETVLARQKLEAQKQENVS-------VQNEFEKL--------------KDD...EQ-----I
PFD2_SCHPO/9-114-QILQTQYNSYKS---RLQQIAQKIVDLETDADEHKL-------VMDTLNSM--------------DNN...RR-----C
PFDB_THEVO/11-117-QNQLKQAQELEE---NIEKIATQRYQLDLSLKEIEK-------TLQELNKI--------------DDK...TP-----V
PFD2_ARATH/17-122-QAVLNMYEGKRS---ELSQIYSNITDLEMQVSEHSL-------VINAIQPL--------------DQS...RK-----C
PFD2_MOUSE/24-129-EQVIAGFNRLRQ---EQRGLASKAAELEMELNEHSL-------VIDTLKEV--------------DET...RK-----C
PFDB_METMP/8-112-QNQLMQFQQLQQ---QLQMIMYQKQQFETQLKEMEK-------AIEEMEKS--------------DSE....E-----V
Q757Z9_ASHGO/9-112-QEIAAGLRNSKG---QLELVTAQLAQLQRQKKLAHV-------TAKELGSY--------------PVD....Q-----V
Q6K3S8_ORYSJ/22-128-ESQANALSKIQK---DISKNHQVRKQYTIQVGENEL-------VLKELELV--------------NDE...AN-----V
Q90634_CHICK/80-171-NVLQAQLQRLQE---DIENLREEKES......EISS-------TRNELVSA--------------QNE.....-----.
Q8MRY9_DROME/26-131-QQRINRFAKHNA---RMDDFKAELETKRNELKSLEE-------ALEEIELF--------------DED...ED-----I
Q7Q034_ANOGA/13-118-EAELKNFKDTQR---EFSKLVQTQQQLDGQYFENKS-------ILEELQML--------------KPT...NT-----V
PFDB_SULTO/10-115-QTQLVKLQQLQD---QLNRLLTEKNVIDSELREVNK-------ILQELSQL--------------PAG...TT-----V
PFD6_YEAST/2-107-SELGAKYQQLQN---ELEEFIVARQKLETQLQENKI-------VNEEFDQL--------------EED...TP-----V

PF13758

Q5BCR1_EMENI/26-122-QQSLYHWRTWEA...EYEGLKEGIADL.........-----....GNDATT--------------NDF---LR-----V
Q4WPD9_ASPFU/26-122-QESLYHWRTWEA...EYDGLKEEISNL.........-----....DDDATT--------------SDF---LR-----I
C5MGW7_CANTT/35-116-RRKRGILEDQIK...QFEEVERNLAESPA.......-----....SS....--------------N..---..-----.
A6RBR6_AJECN/26-122-RKSLYNWRMWDA...EYDELKNDISAL.........-----....EENSKN--------------EDF---LR-----I
C1G7H7_PARBD/26-122-RKCLYSWRLSYA...EYDELKHDVTAM.........-----....EENCAN--------------EDF---IR-----I
Q2UH06_ASPOR/26-122-QESLYHWRTWEA...EYDGLKDEISEL.........-----....DDDATM--------------DDF---LR-----I
A2QIK2_ASPNC/26-122-QDSLYHWRTWEA...EYDGLKDELNEL.........-----....DDDATM--------------DDY---LR-----V
A1CHK4_ASPCL/26-122-QESLYHWRTWEA...EYEGLKEEINDL.........-----....DDDATT--------------DDF---LR-----V
C5P3G0_COCP7/19-122-EHQISDLQQSLY...KWRVWDAEFDGLKEEL.....-----.SALDDNSSK--------------EDI---LC-----T
C5FSD5_ARTOC/26-125-RTSIYHWRLWNA...EYDGLKEELSSLPE.......-----......NSTR--------------EDI---LE-----L
D4AVX1_ARTBC/26-125-QTSIYHWKIWNA...EYDGLKEEILSLPE.......-----......NSSR--------------EQI---LE-----V
Q0CLW4_ASPTN/19-122-EGNIRKLQESLY...HWRTWEAEYDGLIEEV.....-----.RALDDDATT--------------DEL---LG-----A
B6QL87_PENMQ/26-122-RKSLYDWRLREA...EYDGLKDEIKNL.........-----....QHDCTS--------------AEI---LQ-----V
Q7SG31_NEUCR/26-121-HASLTHWQQTYF...EYAALKEEVDGLPK.......-----.....DPSPH--------------TEL---AR-----I
Q0U4Q6_PHANO/13-122-ERRRAQLQESVE...KLQKALAHWTTWEAEYQMLSE-----EIERVDDASP--------------DQI---RE-----I
A7EGX0_SCLS1/27-121-RKSLQHWQTWDA...EYDGLKEEILSA.........-----....DHTPNR--------------DKL---IS-----I
B6H7V9_PENCW/26-121-QKSLYHWRTWEA...EYDGLREEISNL.........-----....EDDAST--------------EEF---LA-----V
B2W9T8_PYRTR/20-122-QENVDKLRKALS...HWTTWEAEYEALKEEI.....-----..EAADNASP--------------SQI---RE-----I
C7YIH1_NECH7/12-119-ERHRQLLEENVS...KLQTALQHWRTWDAEYEALKE-----EVDAVCKTTE--------------TEL---AT-----I
Q2HFW2_CHAGB/26-121-RASLTHWQQWYL...DYSALKEEVEQLPS.......-----....D.TPPH--------------EQL---RR-----I
C9SQH1_VERA1/16-117-EENVDKLRKGLQ...HWRRWDAEYETLKDEI.....-----.ESAPKPVTQ--------------KDL---AR-----I
B2AYI7_PODAN/25-124-TQLRASLSHWQQWYLEYSSLKEEISLLPS.......-----....TTPTPV--------------ESL---RR-----I
C4JGA6_UNCRE/26-122-QRSVYNWRLWDA...EYDGLREELDALGD.......-----......SSTK--------------DDI---LR-----T

PF02996

Q7XD74_ORYSJ/24-143LVDVGTGYFIEKTMTEGKEY---CE---RKINLLKSNFDELVEMATKKKNIADEMGRLLQA--KLRQ
PFDA_AERPE/18-137IVHLGLNVYAKLDTAKATEI---LA---KKEDALKRSLETLKQELDKLSRTHDQYLQLLQA--LTAG
Q966M4_CAEEL/9-128TMEMGANYYGECSIHTAEKI---LD---RRVSEMRRQREEGLDSIRMLDDKIKFAQDNFSS--VSID
PFD3_DROME/49-168YLWLGASVMLEYPLDEAEAL---LN---QNITSAVGNLKSVEHDQDFLRDQITTTEVNMAR--VYNW
PFD3_YEAST/48-179GLWLGADVMLEYPIDEAIEL---LK---KKLADSEQSLTVSTEDVEFLRENITTMEVNCAR--LYNW
PFD5_CAEEL/25-144LVEIGTGYFVELDREKAKAI---FD---RKKEHITKQVETVEGILKEKRRTRAYISDAFQT--KVQS
PFDA_SULAC/24-143LIHLGLNYYAEVDPQAAKKI---LD---DREQQLAEVSKNIQGELSKSIDAYNQIAEILSQ--VQGK
Q8T965_DROME/58-178TLQVGASLQMEFELSEAEEF---IK---KDITSLVKQQLQHEHDIDYLQDQVNTIEMNLAV--LYKH
PFDA_THEVO/12-130IVPIGSGVYIAEKRSETIER---LK---ANIENLKESIQKLMDQRRTLVDQYNTVYTTEAT--RNIK
Q9ZW98_ARATH/26-144LVLLGENYYTDRSSKQTVDF---LK---RRDKTLQSQIHSLKAEIEDLQTEASFFTTTASE--VADG
PFDA1_METJA/18-133LIGVKSDIYVEKSFNEVIED---LK---KSVEDLDKAEKEGMKKAEELAKAITALRKELQT--EIQK
PFDA_METAC/18-140IVNLGAEFSAEETAEEAIET---LN---RRKEQLTKILEQMNASLTRLTQGMQTLEAEAAK--LQPG
Q8VZL7_ARATH/20-140FMDVGLGFYVEFTRQEALDY---IA---QREERTQKQLEEYTGVITQIKGRIKLAHYQIQQ--ILNL
PFD3_CAEEL/47-169SIWLGANVMVEYDLENARKL---LD---KNRGSVQKVVDELTNELSYIKDQITTTEVNMSH--IVNF
BUD27_YEAST/8-126YLSLGYEYYVEKTKEEAITF---VD---DKLKLMEDAIEQFNLKIEEAKKTLDNLNHMEDG--NGIE
PFD3_SCHPO/39-159YLWLGANVMLEYTVEEAEAL---LT---QKLNSAEETLKACKEDLEFLRAQVTTMEVNTAR--VYNY
PFD3_ARATH/53-175CLWLGANVMLEYSCEEASAL---LK---NNLENAKASLEVLVADLQFLRDQVTVTQVTIAR--VYNW
PFDA_SULSO/20-139TVHLGLSYYAEVDLDSAIKI---LD---KRKDEISKAAQDLNNELQKAASTYNQIVDILNQ--IQQA
PFD3_MOUSE/59-181CLWLGANVMLEYDIDEAQAL---LE---KNLSTATKNLDSLEEDLDFLRDQFTTTEVNMAR--VYNW
PFDA_AQUAE/26-145IMSIGTGISAVMSYDEAVDR---IR---KEIAALEALRRALEEAIADLYNKIEELLEEVRK--VGQE
PFD5_SCHPO/25-146LVDIGTGYYVEKSAGEATEY---YK---RKCEYLASSIENLNNAIDAKSVQIRAVQNIMQQ--KATA
Q20070_CAEEL/23-143VVKLCDDVYVEMKLQDAIKT---CD---RKMDSLKNMMEKLQKSTNKLKTDLTMLLATMDM--PYVE
PFDA_HALSA/21-137VVSLGGGYAAEQDSDAAASV---LD---EKKATIDGRIDDVQAEIADLSEEAEQLEQQAQQ--AQQQ
Q9VJP9_DROME/35-155LVDVGKNVFLDMSIPDAERF---CD---TRVKILTKQSDVLRDESVKKRAQIKMALIAISE--RTKL
PFDA_PYRFU/17-137IISVGSGYAVEKTLEDAIKY---LD---ERIKEYDEAIRKTQEALNELQKRAAELAKKAQE--IQQK
Q9W148_DROME/8-126LVGHYEGYFSACSSHKAKEI---CQ---YRLKLAEEQLKKLAVENDLWQKKLHTPFAEGAV--PSGD
PFDA_THEAC/12-130IVPIGSGIYVAETKERSVER---LK---KNLEDIKASIQKLLDQRKTLVDQYNTVYATEAT--RNVK
PFDA_ARCFU/17-136LVDIGSGVVVEREVGEAIEF---VK---NRIKKIEENQEKMTSMLQQVLSQAQRIQQELAA--RQQK
PFDA_SULTO/24-142LVHLGLEYYAEVDPDFATKV---LN---DKKSELSNVLSNVEKELAKSLEAYKEIADILNQ--AQQQ
PFDA_PYRAE/16-132LAPLGAGYHAFLDLNNAERI---LQ---ERIEEYSKLKTSLEENIEKLAERAAQIRQALER--LGIR
PFDA_METTH/17-135IMSVGAGVAIKKNFEDAMES---IK---SQKNELESTLQKMGENLRKITDIMMKLSPQAEE--LLKK
PFD5_YEAST/23-143MVDIGTGYYVEKSAEAAIAF---YQ---KKVDKLNKESVQIQDIIKEKTQYSLSIEAQIRQ--AAIR
PFDA_METKA/24-143IVGIGAGVAVERTIDEALES---ID---DQRQELEKARAEAQQKLQELAQELQEKQRKAQE--LAQQ
PFDA_PYRHO/18-138IVSVGSGYAVERSIDEAISF---LE---KRLKEYDEAIKKTQGALAELEKRIGEVARKAQE--VQQK
PFD5_ARATH/25-144LVDIGTGYFIEKTMDDGKDY---CQ---RKINLLKSNFDQLFEVAAKKKSVADEAGMVLQA--KVKQ
PFDA2_METJA/15-134VVSVGQNISAELEYEEALKY---IE---DEIKKLLTFRLVLEQAIAELYAKIEDLIAEAQQ--TSEE
PFD5_DROME/31-150VIDIGTGYYIEKDLEGSKDY---FK---RRVEYVQEQIEKIEKIHLQKTRFYNSVMSVLEM--KQAA

PF01920

Q75AC1_ASHGO/8-113YRMVGGALVET.DVQTTIPI---LQ---TKKENLSSTISALKGELVKVAEEFEKWKKDNKI.QVLKQ
Q754N3_ASHGO/19-124QYKIGDVFVLM.RQEEVAAQ---LE---RDQAAADARIRQLEEEEEHVDARMRALKQVLYA.KFGDS
Q7Q0Q5_ANOGA/10-115YASVGRMYVLN.DVPTLTEQ---LK---TTHASYEEIITQCEKNKDFLIKNLKEQEESLRE.LVQQK
Q7Q629_ANOGA/24-129FRLIGGVLVEQ.TVEVVLPQ---LE---LNKAQLEKLIEEGKEQITKKGLEINQFKDEHNI.KVRGQ
Q7QIM0_ANOGA/26-131PFLMGDVFLSH.DQAKTLEL---LA---EAKERKKKEINGIQQISRDLQQKMSDLKGYLYG.RFGSN
PFD4_SCHPO/11-119ALKVGDAFFQV.SLPVLLDQ---LE---QSEESLEKQVDVLRSSMEKDETRIQELKSMLYS.KFHDQ
PFDB_HALSA/10-115YREVGELLVET.EYDNAHDD---LD---EKVSDLEVRVETLQKQEDRVQEQFESLQEELQD.MLGGA
PFDB_PYRAE/9-114FKNVGNFLVPQ.SRDVALQE---LR---DRKELLELHVKTLTRQESMLREQLDKLREEINK.ELAKL
Q9VMH8_DROME/13-118YQSVGRMFLLT.DVQNMRED---LK---ARQEKCDKAIELLEKKKEFLQKSLKSQEDGLRE.LVQQR
Q9AR47_MAIZE/16-120RFQIGEVFAHM.PRDDVETR---LE---QMKEDAAKKLERLEEEKESILAQMAELKKILYG.KFKDA
PFD6_CAEEL/8-113YKLIGAVLVRQ.DLEEARST---VE---KRLEFIDSETKRVEASISDISKKCTEQRDKVMN.MQKSF
PFDB_AERPE/10-115YRLTGFVLVKK.SKNEVVED---LN---KRKEDLELKLKVLKSQEEHLKKELERIESELRR.LLQGG
Q9P3P3_NEUCS/13-118YEGVGKMFVSV.PVPALKDR---LS---TEMKEMETEVENLGKRLHYLETTAKNSQEHIEK.MLKGG
Q8X061_NEUCS/25-131QYKIGDSFFHI.PLEQAKEM---LG---IAAAKLIKEIEALDDKLETIRKEMTGLKVELYA.RFGKT
Q6XHQ2_DROYA/13-118YKLFGPVLVKQ.ELEESRQN---VG---KRIEYISKELKSSTDTLESMEKDMQKHQETMAK.YQQQW
PFDB_SULSO/10-115YKIVGNLLVKS.DKTSVEKE---LN---DRKELLELRSRTYQKQESILRKQLEDLQAKIND.MLSKY
Q7SF61_NEUCR/12-117FRMINGVLVER.TVEDVIPA---LK---TNAEGLKKVLNDLVKQYQNKQEELDKWKKKNNV.QVVQS
PFDB_METJA/8-112YKLVGGLFVKR.KKEDVKKE---LE---EKVETLELRVKTLEKQEEKLQSRLKELQEKIQK.MIPTA
PFDB_ARCFU/9-114YKAVGNILVKE.KKEDVIKE---LT---EKKETYEIRIKTLQRQEEKLRERFAETQQKLQN.LLSPQ
PFD2_DROME/13-118FRQIGGVLCER.TVKEVLPQ---LV---ENKDFIAKTIQMVTNDLSKKGSELNKFKEEHNI.KIRGE
A8BVJ1_GIAIC/22-128MLAIGAAFFPN.DSMDIDNS---LE---ALKATVSQEYEVVSNRCSKIEAKLNQLRDVLQQ.KFKGS
PFD4_YEAST/19-124QYKVGDLFIFM.KQSKVTAQ---LE---KDAERLDNKIETLEDKQRDIDSRLDALKAILYA.KFGDN
Q8I3A4_PLAF7/20-125MLNIGDCFFKF.DLDYIEEH---LE---DRKSEELANLNEMELEYKTKLNEKQKLKTELYA.KFGNR
Q8GYJ1_ARATH/14-119YKLIGPVLVKQ.DLAEANAN---VR---KRIEYISAELKRLDVILQDMEEKQNNKRETIMK.LQQRL
PFD1_HUMAN/14-119YEGVGRMFILQ.SKEAIHSQ---LL---EKQKIAEEKIKELEQKKSYLERSVKEAEDNIRE.MLMAR
Q8LDK1_ARATH/19-123RFQIGEVFAHV.PRDDVETK---IE---EMKEATCKSLEKLEQEKESIVTQMAALKKVLYA.KFKDS
PFD6_SCHPO/2-107YKQIGPTLVKQ.SHEEAKTN---VK---TRLDFINKEIARLENQTKISQEEFSKVKGAIIQ.AQAAA
Q7SX94_DANRE/10-115YKLIGPVLVKQ.DLDEAKAT---VG---KRLEYINGEIQRYETLLKEMERKSEQHREVLSS.LQQEY
Q7RAS5_PLAYO/64-169MLGIGDCFFSF.DTEYVEES---LE---KSKNEEKVNLNKLECEYKNITDEKQKLKTELYA.KFGNR
PFDB_METTH/8-113YKSSGNILIRV.AKDELTEE---LQ---EKLETLQLREKTIERQEERVMKKLQEMQVNIQE.AMKGA
Q94AF7_ARATH/11-116YKSIGRTFVLE.PKTVLEGE---QE---QKLKDSEAAVASLQTSKEYLEKQVAEVENNLRE.LLQQE
PFD2_CAEEL/18-123FRLISDTLVEY.TVKDVIPD---LQ---NNIANLTIVSKQLNDQLVEKGKELNTHKTTHNI.RLLTE
Q8ILS7_PLAF7/18-118YRMVGEVLVER.TVGEIKPA---LM---DHKNKVEQVIAECQKQLDQKNNEISNFIKSAK....AGN
PFD4_HUMAN/20-126PYQIGDVFISH.SQEETQEM---LE---EAKKNLQEEIDALESRVESIQRVLADLKVQLYA.KFGSN
PFD4_CAEEL/12-119PCRIGSCFVHF.NGDSLNEH---LE---GKKTTAEKVLSEKTSELDAISADMEQIKKVLYA.KFGDQ
Q6L0A9_PICTO/11-117YKSVGPVMYLVEDKNKLIND---LE---EQKELSQMRSKTLENQQKSLEQKYREVQESLQK.KYQEA
Q6UNN7_9HYPO/29-134QYKIGDAFFHI.PLEQAQEM---LE---TATTRIEDETSELEEKMSTVREEMQQLKVELYA.RFGRQ
PFD6_HUMAN/10-115FKLLGPVLVKQ.ELGEARAT---VG---KRLDYITAEIKRYESQLRDLERQSEQQRETLAQ.LQQEF
PFD1_SCHPO/6-111YTSLGKMFMKS.DLASVRTH---LD---AEMASLREDIEALQKKQTYHETTASNAEQHLQK.IKESI
PFDB_METKA/6-111YKTVGGLLIEA.DRDEVKEE---LE---DRKETLELRVKTLEKQEKRLQQQIENLQKRLQK.ALQQA
PFDB_METMA/10-115YRSVGELVIKT.TKEESVSK---LK---DREETLSLRLQSISRQEERLTARFKQLQEQIQQ.ALGPR
PFD1_CAEEL/11-116YRSVGRMFLLT.DKPAEISR---HE---AEAKQSKEKIEAIEKQKDYLEKGLVEAETNLRE.LIQSR
PFDB_PYRHO/9-114YKTVGTLIVKT.TKEKAVQE---LK---EKIETLEVRLNALNRQEQKINEKVKELTQKIQA.ALRPP
Q7S0H5_NEUCR/10-115FKLVGPVLLKQ.DKMDAENT---VK---GRLEFISKEITRLEGVIKETQGKIEKKRTEIIQ.VQTSA
PFD2_SCHPO/9-114FRMIHGVLVER.TVGTVVPI---LK---TTQEGIQTAMNGLLDQYKQLEAEFQKFQKDNKI.QVVRQ
PFDB_THEVO/11-117YRSIGSILYKVDDKKKLIDE---LE---EQLELTKIRINTLDKQQKSLEEKYKELQAAIRE.RYNQD
PFD2_ARATH/17-122FRMIGGVLVER.TIKEVLPA---VQ---RNKDGLEEVVRKLYETLEKKKKDLTEFEAKYKI.RITKQ
PFD2_MOUSE/24-129YRMVGGVLVER.TVKEVLPA---LE---GNKEQIQKIIETLSQQLQAKGKELNEFREKHNI.RLMGE
PFDB_METMP/8-112FKMAGGILVKR.NKAEVKEE---LS---EKIETLQLRVTTFEKQEEKMQKRYTELQESLQK.VMGQG
Q757Z9_ASHGO/9-112WRSCGKMFLLD.SKTDYTQQ---LD---ADAKTIEEQIKALEVKRHYLETTVENSIEALKK..AVQR
Q6K3S8_ORYSJ/22-128YKLIGPVLVKQ.DLAEAKAN---VK---KRIEYISAELKRMDRALKDLEEKQNSKKESISHDRLMSV
Q90634_CHICK/80-171......ILSLQQVAEKAASE---RD---TDISALQEELQTVRAELERWRKDASDYEKEIVS.LQASF
Q8MRY9_DROME/26-131PFLVGEVFLSH.KLEKTQDM---LK---ETKEQVLKEIAVVEAKAKVIKAEMDELKAHLYQ.RFGSN
Q7Q034_ANOGA/13-118YKLYGPVLVKQ.DLEESKQN---VG---KRIEYITKELKRCGENITQLEAKQDKYRANLQK.LQMQY
PFDB_SULTO/10-115YKIVGNLLVKT.DKETVQKE---LD---DRKEILELRSRTYQKQENLLRTQLEDLQKKVNE.LLAKY
PFD6_YEAST/2-107YKLTGNVLLPV.EQSEARTN---VD---KRLEFIETEITRCEKNIRDKQEELEKMRSELIK.LNNTA

PF13758

Q5BCR1_EMENI/26-122SRKFGGTFVNEDEFRVIIGE...KQ...GLRRTRQQVIDLISRRIDYVKTNVASMEKRLRAAEPQME
Q4WPD9_ASPFU/26-122GRNFGGTLVNEDEVRVILGE...KQ...GVTRSRQQVIDLISRRIDYVKENVATMEKRLRKAESQLY
C5MGW7_CANTT/35-116.....GT...LNKIQFKLDN...GN...TIEKTREEALEFINKRIGEIKEAVTQFNTKINEGEMTKE
A6RBR6_AJECN/26-122GREFGGSLVNEHEIEVLLGV...KQ...RVTRTKQQVVDAISRRMDYVQQNIGVLEKRISAAERKLD
C1G7H7_PARBD/26-122GREFGGSLVNENEIKILLGV...KQ...GITRTKQQVVDAISRRMDYVQQNIKVLEKRILVSEKKLD
Q2UH06_ASPOR/26-122GREFGGSLVTEDEVKVILGE...RQ...GVTRTKQQVIDLVSRRVDYVQQNVTIMEKRLRSVENQLH
A2QIK2_ASPNC/26-122GRDFGGSLVNEAEVKVILGE...KQ...GVTRTKQQAVDLVTRRIDYVKQNASTIEKRLRAAEDQLY
A1CHK4_ASPCL/26-122GRDFGGSLVSEDEIKVILGE...KQ...GVHRSKQQAVDLISRRIDYVKENVATMEKRLRTAENQMY
C5P3G0_COCP7/19-122AKDYGGLLVTENEIKNLLGE...SQ...GVNRNRRQVIEVIERRVDYVRDNIRTLEKRIEVAEKKLL
C5FSD5_ARTOC/26-125GRKFEGSQITEKEVRALLGEVSPGP...TISRSPQQIIRAIDRRIDYVLENIKVLEKRTAALEDELS
D4AVX1_ARTBC/26-125GRNFEGSQVTEKEVRALLGE...GSSGPVVSRSPQQVARAIDRRIDYVLENIKTLERRATSLEDKLN
Q0CLW4_ASPTN/19-122GLELDGSLVNEDEVKTIVGV...KE...GTTRTKQQVVDLVTRRIDYVKQNVATMEKRLRTEENKLQ
B6QL87_PENMQ/26-122GLEYEGTVVDEKEVRDIIGE...KQ...NIMRSRDQVVSQITRRLDYVKQNVASLEKRLSAAEAELD
Q7SG31_NEUCR/26-121RRDYGGTIITKKEINEIFGE...ND...L..KEADQISSVLGRRLDYVEKNVDTLTKLVETEENKLA
Q0U4Q6_PHANO/13-122AKDLASTLLDAKEVEELLGK...DA...NKKRTANQVVDMISRRIDYVQQNSATIEKQLDAAEKRLA
A7EGX0_SCLS1/27-121ARNYEADLVKGKEIEEILGT...GT...Q..RTAEQVVNLLDRRLDYVQQNINTIKKQIETAEEKLA
B6H7V9_PENCW/26-121ALEFGGTLVDQKEMQVILGS....Q...GVTRSRGQVVDLLGRRIDYVQQNVATMEKRLSKAQNQLD
B2W9T8_PYRTR/20-122ARDLELTLLNEKEVEELISK...NS...PSERTANQVVDMISRRIDYVRTSSATIEKNLDVAEKKLA
C7YIH1_NECH7/12-119QDGFEGELVNRREIDEIFGQ...KN...R..KSKEQILNVLDRRIDYVTKNIESLEKQIEAAENKLA
Q2HFW2_CHAGB/26-121RRDFDSPRLTKKEINEIMGK...HD...L..KAPEQIVHVLSRRLDYVEQNINTLSKSLETEENRLA
C9SQH1_VERA1/16-117RAEFKSDVIDRKELDEIFGN...VG...I..KPADQVVNVISRRIDYVTKNLETLEKQLEIAEEKHA
B2AYI7_PODAN/25-124RRDFSGKVLTQKEINEIMGK...TD...F..REVDQMLSLLTHRIDYVEGNINTVGKMLEQEENRLA
C4JGA6_UNCRE/26-122TNEFGGSLVTEDEIRNLLGE...PQ...GITRSRKQVMEILGRRVDYVRDNIKTLEKRIRVAEDKLL

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window