Sequence alignment for CL0201

PF14550

B9J6K3_BACCQ/38-159------------------------ISKQVPILK........TE.------------....EEKQLVTGVVYEPD...---
B0P3E9_9CLOT/21-150------------------------SLNRVDITK........KD.------------....EEKQYVFGWAKIAVDEN---
F1D5Z3_9CAUD/31-169------------------------VKSDVEIKK........SHD------------....YKNQISVEIIAEPF...---
D3DZY3_METRM/1-134------------------------MINILEVVT........KS.------------....RDSLLITAPVLIPG...---
Q08QA7_STIAD/304-428------------------------FIATKPLLK........GVE------------P...DDERYVLGVVLEPE...---
B3ZWM2_BACCE/37-157------------------------FEKPVKVIK........SDD------------....EAERLVYGIVYEPD...---
E8VED4_BACST/36-157------------------------FQKEVEVLT........KEA------------....DEQKLVYGIVYEPD...---
C0ED09_9CLOT/23-156------------------------EHKEFAIAK........TV.------------....DDQHLVFGWANIAFKAD---
B4AH51_BACPU/36-157------------------------FQKKIKVIA........KAD------------....DAQRLVYGIVYEPN...---
D7CZA0_GEOSC/3-124------------------------HELTAPVTH........KN.------------....EEKRIVFGPVLVPD...---
C3FD53_BACTU/38-157------------------------FQKKVDIIT........KSE------------....DEQKLVYGVVYEPG...---
E0U1S1_BACPZ/36-158------------------------FEKKVRLFT........KSE------------Q...DEQKLVYGIVYEPD...---
D6RRF8_BPKPP/7-135------------------------PTPKEDVVK........SVD------------....KAERRALFVVLAPD...---
C8PIK5_9PROT/34-156------------------------ELLRVSFSK........DSA------------....GEEGIVYGIVYAPD...---
E3E570_PAEPS/36-162------------------------FEKQVRLIT........KTD------------....DPKQLVYGVVYEPD...---
C2WX90_BACCE/38-159------------------------VLKNVPILK........RE.------------....DEKQLVTGVVYEPN...---
B0VF67_CLOAI/84-211------------------------KINSSKFKS........ETS------------....GTQGRLYVTLMEPN...---
D4M9P0_9BACT/38-162------------------------DAFETPLRK........LVK------------S...DEKRVVYGIVYGPG...---
C2VKX1_BACCE/36-162------------------------FVKEVKIIK........GED------------....EEQKLVYGVVYEPGSAD---
A5GZ28_9CAUD/35-156------------------------FETTVKLLT........KSD------------....DPQKLVYGVVYEPD...---
C2PP47_BACCE/36-162------------------------FEKEVRIIK........GED------------....EEQKLVYGIVYSPGSAD---
C6LG49_9FIRM/22-151------------------------AKQRFRIQK........SD.------------....DGKMQAFGWASVAITEE---
D0LP87_HALO1/215-339------------------------FAKTIPLIK........GAD------------P...SDERYVLGVVLEPE...---
A5ZPY2_9FIRM/75-197------------------------IQIYGRIVK........AD.------------....EDKHYVTGIVYEPM...---
D3T2F8_NATMM/9-129------------------------FTKHVAIKT........ID.------------....EEEQTATGIVLTPY...---
B3RGK2_9CAUD/39-171------------------------LLWRDKIIH........MGN------------KMP.QEEMISYEIIYEPD...---
B4AHK1_BACPU/37-158------------------------FQKEVSVLT........KAE------------....DAHRLVYGVVYEPN...---
C6JB26_9FIRM/31-160------------------------EKKKFQIKK........SD.------------....DEKMQAFGWASVALTEN---
Q9HH51_9CAUD/107-236------------------------EEASEKTYTLQYGNHAVKIN------------....KDKRLVTGPVLVPD...---
B3Z210_BACCE/37-157------------------------FEKEVRVIK........SEN------------....EEKRLVYGIVYEPG...---
C4ZCA6_EUBR3/24-153------------------------IKGRFKIAK........SD.------------....DDKHLAFGWANVAIRAD---
A0RNP3_CAMFF/36-158------------------------YFRSVKIAK........ND.------------....TEKGIVYGIVYSPD...---
Q92CB9_LISIN/36-157------------------------IQKQVELFV........NKE------------....DSKQLVYGLVYEPD...---
A0ZYR5_9CAUD/12-145------------------------FRKEVEFVT........KDD------------EDDEDDEQVAAGIVMVPD...---
D4N438_9CAUD/23-155------------------------QAPAVEVTK........SLD------------....NEKRMALFVVLEPQ..E---

PF04586

VP4_BPHK7/11-167------------------------DETEIKF..--------...------------TGD-GKQGIFEGYASVFN------
Q8LTC1_9CAUD/10-182------------------------APMQIRDGD--------...------------DDH-P..AVIEGYALKFD------
Q8XLC1_CLOPE/14-176------------------------SDLITRTLE--------...------------DTE-E..KVISGYINKFN------
Q73HU3_WOLPM/8-161------------------------SPLSIK...--------SIG------------ENG-V....FSGYASVFN------
Q6NFQ8_CORDI/19-166------------------------PMTASAADT--------KDN------------E..-.....VSGLVVPFN------
Q9AZM3_9CAUD/12-176------------------------TELETRSPT--------...------------.NT-GFIGQIAGYAIKFN------
Q928F8_LISIN/13-177------------------------RRAELNTNE--------..T------------DES-E..KVIEGYFAVFN------
Q8HAD3_9CAUD/21-178------------------------VPLSLKSVS--------DSG------------E..-.....FEGYGSVFG------
Q9RNH0_RHOCA/16-167------------------------QPVQLQDGA--------R..------------...-.....IEGYASLFG------
Q6QGD7_BPT5/23-174------------------------KSIDSESKE--------GVV------------K..-.....IRGFANTIS------
Q8SBP9_9CAUD/15-184------------------------SNIEVRATG--------...------------DEN-T..KTITGYASKYN------
Q8SBH9_BPSF5/9-172------------------------YSGEVRAER--------HDD------------NPA-H....IIGYGSVFD------
Q830G5_ENTFA/12-173------------------------TNLKTRSEE--------...------------DSQ-T..QIVTGYAAVFN------
Q81Z10_BACAN/15-178------------------------QKIEIREDD--------...------------.NG-N..RTLIGYAVKWE------
Q6JIM8_9CAUD/15-172------------------------FDLDVKSVD--------DAG------------Q..-.....FSGYGSVFG------
Q81XX9_BACAN/12-175------------------------SALEIRELE--------...------------.NG-L..RTISGYAVKWE------
Q9AZY6_9CAUD/13-176------------------------RSLDLNAND--------...------------EAA-E..KIISGYFIVFN------
Q8DXJ7_STRA5/5-163------------------------KTFVVKSVE--------DES------------ADF-H....FEAYASTYD------
Q9ZXF7_BPPH1/11-184------------------------TPIELRSEG--------...------------EGQ-S..EYIEGYALKFE------
O80044_9CAUD/9-174------------------------NIIEVRSND--------...------------NNE-M...VIEGYALKFD------
Q813K0_BACCR/5-168------------------------EEVKRMKIE--------VRG------------NQV-I....LDGYVNVVD------
Q88MK5_PSEPK/15-174------------------------FDYDVKAVG--------DDG------------L..-.....FSGYGSVFG------
Q7DBD8_ECO57/8-161------------------------SLLTVK...--------...------------SFS-EDERVITGIASTPS------
Q83LG5_SHIFL/7-171------------------------KSMEIRSSE--------ITT------------SGA-G...TLTGYVVRWD------
A9CJN9_AGRT5/15-165------------------------ASLELRGIT--------SDG------------T..-.....FSGYASVFG------
Q8G796_BIFLO/11-163------------------------KGIELR...--------...------------EDQ-GDGTRIEGIAVPFG------
Q6N8L6_RHOPA/13-166------------------------SPAPLPARL--------SLA------------EDG-S....IDGYASLFG------
Q859C2_9CAUD/12-177------------------------GTLEERASD--------...------------DGR-I...SMRGYAYRFN------
Q8XYS5_RALSO/12-178------------------------QLCELRSSE--------...------------AGA-ESVPTIYGYAAVFN------
P71948_MYCTU/7-165------------------------RTAELRPGE--------...------------...-..GRTVYGVIVPYG------
O21873_9CAUD/8-151------------------------AEIKVT...--------...------------ENE-DGSKSFQGIGSEVG------
Q6NK35_CORDI/146-313------------------------KSYDVSIDE--------TQT------------EGT-.....ITAYASVFG------
Q9L8M7_HAEIF/3-170------------------------KEFEIRSSE--------ITA------------DSE-N..KKLVGYVVKWN------
Q6R4V3_9CAUD/35-179------------------------RTVELAASS--------EYP------------VPR-WFGREILDH.....------
Q8G1W3_BRUSU/11-164------------------------KRAALAVEE--------VEI------------DGS-.....FSGYASVFG------
Q854Q0_9CAUD/24-197------------------------DRMEVREDS--------...------------DEN-T..LVLEGYASTFE------

PF00716

PPR_VZVD/28-373ELNITPEIVRSALPPTS........KIPINIDHRKDCVVGEVIA------------IIEDIRGPFFLGIVRCPQLHAVLF
PPR_SCMVC/22-347ELFLPSGVVDRWLRDCRG.......PLPLNVNHDESATVGYVAG------------LQNVRAGLFCLGRVTSPKFLDIVQ
PPR_HHV11/37-365ELALDPDTVRAALPPDN........PLPINVDHRAGCEVGRVLA------------VVDDPRGPFFVGLIACVQLERVLE
PPR_EBVB9/24-327CLHLDPLTVKSQLPLKK........PLPLTVEHLPDAPVGSVFG------------LYQSRAGLFSAASITSGDFLSLLD
PPR_EHV1B/31-382ELTLTRETVAAALPPAS........RLPINIDHRNGCVVGEVLS------------IVDDARGPFFLGIINCPQLGAVLA
PPR_EHV2/58-381ALYLNPADVGAHLPLPG........PIPLNVEHLQEAHVGWTLG------------LHLTRYGLFCVAVITAEEFFTLLD
PPR_BHV1C/44-376ELVLTREQVARALPPAA........PLPINIDHASACEVGAVLA------------LADDDAGLFFVGVINCPQLADTLA
PPR_HHV7J/21-315NFYLPRRTIQEEINSGNG......LNIPLNINHNENAVIGTVSS------------LSVYST.VCFVARVQSKEFLTIIK
PPR_HCMVA/31-415ELLLPRDVVEHWLHAQGQGQPSLSVALPLNINHDDTAVVGHVAA------------MQSVRDGLFCLGCVTSPRFLEIVR
PPR_SHV21/21-310VLYLNLDDVSKCLPLTK........PIPLNIEHLPESTIGHTIG------------LYAVTHGVFCVGVIHSEKFLHLTE
PPR_ILTVT/28-358EYELTREQSKSALPVLPG.......TIPINIDHESSCVVGTVLT------------ILDLPRGLFCLGVVSTALAPIFLS

PF03420

Q9XJ88_BPKV4/1-213------------------------MELQLLIEDWGVSSYATAETGEKPLVEAKMPAEKGGD..LYIEGIFMQSN------
PCPP_BPT4/3-212------------------------.EPQLLIETWGQPGEIIDGV...PMLESHDGKDLGLKPGLYIEGIFMQAE------

PF14550

B9J6K3_BACCQ/38-159----------------...VEDSHGDT....MTAEEIEKAAYTFMEN.....YQHIDKQHDE...IAGKGTVVENWIAKS
B0P3E9_9CLOT/21-150----------------GNQLIDRQNDL....IDPEELEQTAYTYVEF.....YREAGEMHER....GGAGVLIESIIFTK
F1D5Z3_9CAUD/31-169----------------...TPDAHGMY....YSDTTIEKGYQSFDKAWKEG.RLSMNLFHQIDDVDKKYVELLKHYIVPF
D3DZY3_METRM/1-134----------------...ERDCEFDYGEEPLTEGQIRQIAHEYLAN.....YSLVDKNHEFFETREVIGVPVESYITNE
Q08QA7_STIAD/304-428----------------...TVDAQGDI....YSAAEIRQAAHRFMEE.....FGGLGLMHQM..RVNGHVKVLESYLAPV
B3ZWM2_BACCE/37-157----------------...TIDAHGDF....ADAKTIEKAAHEFMLK.....YRQIDKNHDF...VAGVGEVVESYIAPA
E8VED4_BACST/36-157----------------...TVDAHGDF....MTAAEIEKAAHGFLKD.....AREIDKQHDF...QGGVGEVVESYVAPA
C0ED09_9CLOT/23-156----------------GEQVCDLQSDL....IDTEDLEKAAYIYATN.....YRAGGEMHIQDMAHKNIGTMIESCVFTK
B4AH51_BACPU/36-157----------------...VADAHGDY....MAPAEIEKAAHGFLKD.....AREIDKQHDF...QGGVGEVVESYIAPS
D7CZA0_GEOSC/3-124----------------...EPDSDGDV....VTAEKIEEVAHKFLEQ.....YGNIDLQHTL....NNVGKVVESYILPF
C3FD53_BACTU/38-157----------------...VADAHNDF....MTAEEIEKAAHEFMKE.....AQNIDTQHDF...TAGAGEIVESYIAPD
E0U1S1_BACPZ/36-158----------------...VPDAHGDF....MTAEEIEKAAHGFLAE.....AREIDINHSF...EGGTGVVVESYVAPD
D6RRF8_BPKPP/7-135----------------...EVDLHGDI....YSAVEVEKACIQFNRH.....CMKANLFHAV...ETEAAQIEQSFINLA
C8PIK5_9PROT/34-156----------------...EVDSQGEF....ANAAEIKKAAYDFMKRADL..SYCVDVNHDL...RPAPAYICESWIVKE
E3E570_PAEPS/36-162----------------...AEDTHGDI....MTADEIEKAVHGFMSNLAIAKGAVMDTQHDF...DPGVGDVVECYVAPV
C2WX90_BACCE/38-159----------------...IEDAHGDI....MTAEEIERAAYNFLEK.....YRYIDKNHDE...LAGKGTVVESWISKN
B0VF67_CLOAI/84-211----------------...IHDSQGDY....YTREEIQKACDHFAKHGL...VGKCDVNHNM..QPVPEFTVVENYILKT
D4M9P0_9BACT/38-162----------------...QVDSQGEY....AEKGEIEKAAYGFMKGLR...LLNVDAQHDF...DPKAAFVAESWITKG
C2VKX1_BACCE/36-162----------------NPETHDSHGDF....MEASDIEKSAHNFILK.....YRNIDTQHDF...NAGAGEVVESYIAPA
A5GZ28_9CAUD/35-156----------------...VEDAHGDF....MDAETIEKAAHGFMEE.....YQNIDKQHDF...KTSAGKVVESYVAPS
C2PP47_BACCE/36-162----------------DPNTHDAHGDF....MTAEEIEKSAHNFIAK.....YRNIDAQHDF...NAGAGEVVESYVAPV
C6LG49_9FIRM/22-151----------------GVTIEDWQGDL....LDPEDLERAAYNYVKL.....YREGGEMHLR....GGAAVLIESVVLTT
D0LP87_HALO1/215-339----------------...VVDAQGDI....YSADEVRQAAHRFMEE.....FGGLGLMHQM..RVNGQVRVLESFLAPV
A5ZPY2_9FIRM/75-197----------------...TEDTDGNY....MTEEEITKAAHWFMKN.....SGKPDIQHCF..EKADNVEIVESYVAKS
D3T2F8_NATMM/9-129----------------...ELDHQLDF....VYPDGVQAMYNP.........APEDGVLHAA..FPEDAAELEFNEVLEE
B3RGK2_9CAUD/39-171----------------...TKDAHGEW....MSKDTIKKAKDNWDAAYAAG.LVSENLFHLT...STDAFTIEKTWIQEE
B4AHK1_BACPU/37-158----------------...TPDAHQDF....MTAKEIERAAHGFMKD.....ARHIDKQHDF...QDGVGEVVESYIAPA
C6JB26_9FIRM/31-160----------------GEVLEDWQHDI....IEPEELEQAAYKFVNL.....YREGGEMHER....GGVAYLIESVVFTE
Q9HH51_9CAUD/107-236----------------...EPDLDGDV....VTAEQVEEVAYKFMED.....YQNIDIMHRF....RNVARPVESYILRA
B3Z210_BACCE/37-157----------------...VLDSHNDF....ADESTIEKAAHEFILK.....YRQIDKDHDF...QAGVGEVVESYIAPA
C4ZCA6_EUBR3/24-153----------------GEEIEDWQEDI....IEPEELENAAYQYVLL.....YREGGEMHER....GGAAVLVESVVFTE
A0RNP3_CAMFF/36-158----------------...EIDTQGDA....ASAAEIEKAAFSFMKGLN...IKNVDRDHNF...KPEGAYICESWIVKS
Q92CB9_LISIN/36-157----------------...VEDAHGDF....MKAEEIEKAAHQFMKD.....ARNIDKQHDF...NAGVGEVVESYIAPT
A0ZYR5_9CAUD/12-145----------------...KADLQNDY....VREETLRSFADQFATFYEAG.QAGGGVMHAV..FPDDWMDLERNGVLDE
D4N438_9CAUD/23-155----------------GDSTTDLHADT....YSEEEVEKACINFNTH.....CNVANIFHKI...ETQEAEIVQSFIAPS

PF04586

VP4_BPHK7/11-167-------------------NTDS.........DGDIILPGAFKNALANQTRK...VAMFFNH---KTWEL.PVGKWD...
Q8LTC1_9CAUD/10-182-------------------RQSEIMGSG.ELSFREHIDPHALDNADMS..N....VVALFNH---DQ.NQ.VLGRTGVN.
Q8XLC1_CLOPE/14-176-------------------TLSQYLG......FFEEVLPGAFDKTLADGHN....IYAMYNH---NS.DM.ILGSTKSGS
Q73HU3_WOLPM/8-161-------------------IVDK.........QNDLILPGAFKENLNRNK.....IKLLWQH---NP.DE.PIGSII...
Q6NFQ8_CORDI/19-166-------------------.............EMGDTSAGRFAVARDAIALPDDLGEVKLFR---DH.SN.AGGSPVGYA
Q9AZM3_9CAUD/12-176-------------------TPSTAMA.....PFIEYIAPIALDNVDLS..D....VLALYNH---DY.AN.VLGRVDAGT
Q928F8_LISIN/13-177-------------------SETELFP.....GAFEEILPGAFDNTLEN..D....VRALINH---DT.AL.VLGRNVSKT
Q8HAD3_9CAUD/21-178-------------------VKDS.........HDDVVMSGAFAASLREWSDRKALPALLWQH---RM.DE.PIGVYT...
Q9RNH0_RHOCA/16-167-------------------LPDQ.........GGDVVAKGAYAKSLAAIAARGGSVKMLWQH---DP.AQ.PIGVWD...
Q6QGD7_BPT5/23-174-------------------KD...........RAGDVIPASAWKTSNALTNYMKNPIILFGH---DH.RR.PIGKCI...
Q8SBP9_9CAUD/15-184-------------------VESQILRDWWGDKFVEVVAEGAFDNSLRSNT.....IKALYNH---NT.DN.VLGSTKSGT
Q8SBH9_BPSF5/9-172-------------------CRSELIFG....SFREIIRPGAFDDVLGD..D....VRALFNH---DP.NF.ILGRSAAGT
Q830G5_ENTFA/12-173-------------------SPTELWE.....GLNEVIKPGAFSRALSN.SD....VRCLFDH---DW.GK.VLGRTRSGT
Q81Z10_BACAN/15-178-------------------KKSVVMGYY..RKFREQFKNGAFTETLQN.DD....QRFLWSH---DT.SK.VLGRTKNNT
Q6JIM8_9CAUD/15-172-------------------VVDS.........YKEIVAPGAFSNSLDALKKSGRALPVLWQH---DS.YT.PIGSWA...
Q81XX9_BACAN/12-175-------------------MKSVTMGYW..QRFKEQFKKGAFTESLTQ.DD....QLALWSH---DT.SQ.VLGRTKNGT
Q9AZY6_9CAUD/13-176-------------------SETELYE.....GCFEEISPESFDNVDLS..D....VRALIDH---ET.SK.VLGRTKSGT
Q8DXJ7_STRA5/5-163-------------------NTDR.........EGDVMAKGCFDNTLKSKAV....VPMCLNH---DR.NC.VIGKH....
Q9ZXF7_BPPH1/11-184-------------------KWSERLG.....WFKEIISRTALDSADMS..N....VIALFNH---QQ.DF.PLARNTVSG
O80044_9CAUD/9-174-------------------TWSENLG.....GFKETISRRALENTDLS..D....VRCLVDH---IP.SQ.IIGRTKSGT
Q813K0_BACCR/5-168-------------------RESRMLPSP.RGYFKERIVPKTFEKALKKAKN....VDLLFNH---DK.NR.NLGSIENGN
Q88MK5_PSEPK/15-174-------------------VVDS.........YNEVVAPGAFLESIAEAKAKGRTFPVLWQH---RT.GE.PIGSWNIE.
Q7DBD8_ECO57/8-161-------------------PDR..........DGDILEPEGAEFGSA........IPFLWQH---DH.SR.PVGQCTVRR
Q83LG5_SHIFL/7-171-------------------KLSELLWG....EFYEKFQRGAFTEWLAAGND....VRGLYEH---DH.SM.LLGRTRSGT
A9CJN9_AGRT5/15-165-------------------EVDL.........GKDVIERGAFRRSIEERGAAG..IRMLYQH---DP.AE.PIGAWR...
Q8G796_BIFLO/11-163-------------------QRIGLWRG....AAEEFAPDCDFGDT..........TRTKLSR---DH.DR.LIGKVT...
Q6N8L6_RHOPA/13-166-------------------EIDQ.........ARDMVMPGAFTQTLKQRGLRK..IPMLFQH---DP.AE.PVGVWL...
Q859C2_9CAUD/12-177-------------------ELSHDLG.....GFRERIVPGAGAPSLRQ.ND....VYATFNH---DT.RA.LLGRTSSGT
Q8XYS5_RALSO/12-178-------------------TRSALIAG....LFVEEIMPGAFDGVLGD..D....VRALFNH---DP.NF.VLGRTRSNT
P71948_MYCTU/7-165-------------------EVTTVRDLD..GEFREMFAPGAFRRSIAERGHK...VKLLVSH---DARTRYPVGRAV...
O21873_9CAUD/8-151-------------------VENR.........NGIVLTPNCIEFARER.......YPLLYEH---GA.GS...SEVIGDA
Q6NK35_CORDI/146-313-------------------NVDS.........YGDVVIPGAFEETLGEWQKSGNTIPLLYGH---DF.KD.PFSNIGGVT
Q9L8M7_HAEIF/3-170-------------------SPSEVLYC....DFVEQFSANAFSESLSSGAD....VRALFEH---DH.SK.LLGRTRAGT
Q6R4V3_9CAUD/35-179-------------------.............SPGAIRMGRLKNG..........APLLDSH---SL.RE.QIGVVEE..
Q8G1W3_BRUSU/11-164-------------------LPDL.........GNDVIEQGAFARALKERGASG..VRMLWQH---DA.AE.PIGVWT...
Q854Q0_9CAUD/24-197-------------------QYEMYGGPANGYGWIEQLDRRAFEKTLREKPD....LHLLVNH---.A.GT.PLARTKSGT

PF00716

PPR_VZVD/28-373EAAHSNFFGNRDS...VLSPLERALYLVTNYLPSVSLSSKR....LSPNEIP...DGNFFTHVALCVVGRRVGTVVNYDC
PPR_SCMVC/22-347KASEKSELVSRGPPSESSLRPDGVLEFLSGSYSGLSLSSR..RDINAADGAAGDAETACFKHVALCSVGRRRGTLAVYGR
PPR_HHV11/37-365TAASAAIFERRGP...PLSREERLLYLITNYLPSVSLATKR....LGGEAHP...DRTLFAHVALCAIGRRLGTIVTYDT
PPR_EBVB9/24-327SIYHDCDIAQSQR...LPLPREPKVEALHAWLPSLSLASLHP...DIPQTTADGGKLSFFDHVSICALGRRRGTTAVYGT
PPR_EHV1B/31-382TAAGPDFFGELSE...GLSEQERLLYLVSNYLPSASLSSRR....LGPDEEP...DETLFAHVSLCVIGRRVGTIVTYDA
PPR_EHV2/58-381RLCAASSVARTRAD..HHLPPNPTLEMLHTWLPELSLSSIHP...DALPGAKG.GDTPIFQHVALCAMGQRRGTVAVYGE
PPR_BHV1C/44-376GVAHPAFFGADAP...SLTPRERFLYLVSNYLPSVSLSSRR....LAPDEEA...DGTLFAHVALCVLGRRVGTIVTYDA
PPR_HHV7J/21-315KIAAKSKLITN..TEEKTLPPDPEIECLNSIFPGLSLSNR.....VGGNE.....RDPFFKHVSICGVGRRPGTIAIFGR
PPR_HCMVA/31-415RASEKSELVSRGP..VSPLQPDKVVEFLSGSYAGLSLSSRRCDDVEAATSLSG.SETTPFKHVALCSVGRRRGTLAVYGR
PPR_SHV21/21-310NLFSNSCVAQATS...KFLPYQPLLEMLHTWLPALSLSSLCP...TAQNAAN....TNMFQHVSLCALGRRRGTVAVYSM
PPR_ILTVT/28-358YVQDDALFANAEEG.MVLTETEKFLYLLSNILPSLSLSSRR....LEKNEVP...GKDFFAHVALCELGRREGTVAIYGA

PF03420

Q9XJ88_BPKV4/1-213-------------------VVNRNGRR----YPKKVMENAVSKYIQEQVKTNQALGELNHP----SRSNVDPAEAAIRIT
PCPP_BPT4/3-212-------------------VVNRNKRL----YPKRILEKAVKDYINEQVLTKQALGELNHP----PRANVDPMQAAIIIE

PF14550

B9J6K3_BACCQ/38-159.DMTVGE...Q..EVKAGTWLM-----------------------------------TVRV...DD..TDT-WEE....I
B0P3E9_9CLOT/21-150EKMKTLGIEEG..TLPEGWWV.-----------------------------------GFHI...TD..DDV-WAK....I
F1D5Z3_9CAUD/31-169.DCEVNG...Q..KVKAGTWCA-----------------------------------EVKF...HD..STL-WKARTTPL
D3DZY3_METRM/1-134.PISLKGLDGTVNEYPKGTWIA-----------------------------------TTRI...TD..EEE-MEK....A
Q08QA7_STIAD/304-428.DFNLGE...V..PVRKGTWLL-----------------------------------AVRV...LS..DEL-WGR....V
B3ZWM2_BACCE/37-157.DMELNG...E..PVKKGTWIL-----------------------------------TTKA...DE...ET-WEA....V
E8VED4_BACST/36-157.DFEMNG...E..TIKKGSWVL-----------------------------------VTKA...SE...EV-WEQ....I
C0ED09_9CLOT/23-156EKQLAMGLPEG..VVPEGWWI.-----------------------------------GFKI...HS..DEA-WDK....I
B4AH51_BACPU/36-157.DFEMGD...E..FIKKGSWVL-----------------------------------VTKA...SD...EI-WEQ....I
D7CZA0_GEOSC/3-124.DWKVDD...E.LTIPKGSWMM-----------------------------------GVRV...QD..EDV-WQA....V
C3FD53_BACTU/38-157.DLEING...T..TIQKGSWVI-----------------------------------ATKA...SD...EV-WEK....I
E0U1S1_BACPZ/36-158.EFMIGS...K..QIAKGSWVL-----------------------------------VTRA...SD...EV-WEQ....I
D6RRF8_BPKPP/7-135DFDTDDG...R..TITKGTWCT-----------------------------------WMHFPEGDALADDL-WAG....V
C8PIK5_9PROT/34-156KDAFFS.........ETGAWAV-----------------------------------GIKL...ED..EDL-RAR....V
E3E570_PAEPS/36-162.DFEMGE...E..TIKKGSWVL-----------------------------------VTKA...SD...DI-WEK....I
C2WX90_BACCE/38-159.NTVVGK...Q..NIKKGTWLM-----------------------------------TVRV...DD..SET-WKE....I
B0VF67_CLOAI/84-211.SDREHF...P..DTKVGAWVQ-----------------------------------VLKC...EDLGSEL-WQK....V
D4M9P0_9BACT/38-162ADPLFPD...E....PEGSWAV-----------------------------------GIRV...ED..EAL-WAS....V
C2VKX1_BACCE/36-162.DMEVNG...E..TIIKGSWVL-----------------------------------VTKA...TE...EI-WES....I
A5GZ28_9CAUD/35-156.DMTVGD...T..AIAKGTWVL-----------------------------------VTKA...TD...EL-WES....I
C2PP47_BACCE/36-162.DMEING...E..TITKGTWIL-----------------------------------VTKA...TD...EI-WKD....I
C6LG49_9FIRM/22-151EKMRAMGIPEG..TLPVGWWI.-----------------------------------GFQI...TD..KAV-WEK....V
D0LP87_HALO1/215-339.DFAIGD...V..SVRKGTWLL-----------------------------------AVRI...LS..DAL-WAQ....V
A5ZPY2_9FIRM/75-197.DMEIEG...Q..QIKKGTWLM-----------------------------------TMEV...AD..DDV-WGK....I
D3T2F8_NATMM/9-129.DQEIDG...E..EFEEGDWVV-----------------------------------RRKY...HD..DEL-WSF....V
B3RGK2_9CAUD/39-171FDVVVIG...TEQVIKAGSWVA-----------------------------------KVKY...NN..PEL-WEA....K
B4AHK1_BACPU/37-158.DVEVGG...E..LIRKGSWVL-----------------------------------VTKA...SQ...EI-WDQ....I
C6JB26_9FIRM/31-160EKMMAMGIPEG..VLPVGWWI.-----------------------------------GFQV...TD..ADV-WEK....V
Q9HH51_9CAUD/107-236.DEEING...V..HLPRGTWMI-----------------------------------TARI...YD..DGI-WEG....V
B3Z210_BACCE/37-157.DMEVNG...E..TITKGTWIL-----------------------------------VTKA...TE...EV-WEA....I
C4ZCA6_EUBR3/24-153EKMQAMGIPAG..TLPIGWWI.-----------------------------------GFKV...TD..EDV-WEK....V
A0RNP3_CAMFF/36-158GDPLFPN...E....KEGSWAV-----------------------------------GIKL...ES..DEL-KEA....V
Q92CB9_LISIN/36-157.DFSISD...Q..VITKGSWVM-----------------------------------ATKA...SD...AI-WES....I
A0ZYR5_9CAUD/12-145.SEEIGG...E..TVDAGAWVQ-----------------------------------EWAI...KD..DGL-WGL....I
D4N438_9CAUD/23-155AFTTDDG...R..EIKKGTWLQ-----------------------------------WWHFPEGSEVADTL-WEG....V

PF04586

VP4_BPHK7/11-167.......---SLAEDEKGLYVR-----------------------------------GQL.TPGHSGAADL.KAA----M
Q8LTC1_9CAUD/10-182....L..---ELTVDETGLKYT-----------------------------------LTP..PDTQLGRDL.LEN----V
Q8XLC1_CLOPE/14-176....L..---KLNTDEVGLHFE-----------------------------------LKI.NSNISYANDL.YEL----V
Q73HU3_WOLPM/8-161.......---DIYENDVGLYIT-----------------------------------AHL.LLGIQKAEEV.YLM----L
Q6NFQ8_CORDI/19-166T......---HAEIKDDGLYMS-----------------------------------FHV..ADTPDGKAA.MAD----V
Q9AZM3_9CAUD/12-176....L..---KLSIDKVGLHFV-----------------------------------LDM..PDTTVGHDV.YNN----I
Q928F8_LISIN/13-177....L..---SLRVDDKGLWGQ-----------------------------------IKI.NPLDSDAINL.YER----V
Q8HAD3_9CAUD/21-178.......---EMKEDDVGLYVK-----------------------------------GRLLIDDDPLAKRA.HAH----M
Q9RNH0_RHOCA/16-167.......---EIREDARGLWVK-----------------------------------GRL.LPEVARAREA.LAL----I
Q6QGD7_BPT5/23-174.......---DLNPTEMGLEIE-----------------------------------CEINESSDPAI....FSL----I
Q8SBP9_9CAUD/15-184....L..---RLESDSIGLRFE-----------------------------------IDL..PNTTVANDL.YES----V
Q8SBH9_BPSF5/9-172....L..---NLSVDERGLRYD-----------------------------------IQA..PETQTIRDLVLAP----M
Q830G5_ENTFA/12-173....L..---KLEEDDKGLRFE-----------------------------------VEL..PNTTVANDL.IQS----M
Q81Z10_BACAN/15-178....L..---RLNEDAVGLRFE-----------------------------------LDL..PDTTLGNDT.YKS----I
Q6JIM8_9CAUD/15-172.......---GLKEDDKGLYGD-----------------------------------GDLWIDEAPNARIA.YRG----M
Q81XX9_BACAN/12-175....L..---RLFEDEIGLRFE-----------------------------------LDL..ANTTLGNDT.YET----I
Q9AZY6_9CAUD/13-176....L..---TLSVDAKGVYGE-----------------------------------IKV.NENDTEAMNL.YSR----V
Q8DXJ7_STRA5/5-163.......---ELSVDEKGLRTR-----------------------------------STF.NLSDPEAKKT.YDL----M
Q9ZXF7_BPPH1/11-184DTGRL..---ELETDGIGLKFR-----------------------------------FKP..SDTSYARDL.MEN----V
O80044_9CAUD/9-174....L..---ELETDDVGLKYR-----------------------------------CKL..PNTTFARDL.YEN----M
Q813K0_BACCR/5-168....L..---ELYEDNIGLRAI-----------------------------------ATV..TDEQVIKKA....----.
Q88MK5_PSEPK/15-174.......---SLKEDDRGLFGE-----------------------------------GGLWLADAPYARIA.HRG----M
Q7DBD8_ECO57/8-161....VSE---GLEITATLVKPV-----------------------------------PDMPSQLAARLDEV.WAA----I
Q83LG5_SHIFL/7-171....L..---KLEEDETGLRFE-----------------------------------LTP..PDTSTGRDV.IEL----V
A9CJN9_AGRT5/15-165.......---TIREDERGLYVE-----------------------------------GIL.APGVARSREV.HSL----M
Q8G796_BIFLO/11-163.......---NATREADGLHIT-----------------------------------ASI..SDTAEGRDA.VQL----I
Q6N8L6_RHOPA/13-166.......---ELAEDLRGLRAR-----------------------------------GRL.IPDVARGREL.LAL----L
Q859C2_9CAUD/12-177....L..---RVGEDREGGWYE-----------------------------------IDL..PDTTVGRDV.AEL----L
Q8XYS5_RALSO/12-178....L..---QISVDSRGLAYT-----------------------------------VTP..PNTQTVRDLLLAP----M
P71948_MYCTU/7-165.......---ELREEPHGLFGA-----------------------------------FEL..ANTPDGDEA.LAN----V
O21873_9CAUD/8-151.......---KVYYDLASNKYL-----------------------------------TDF..TLYDNAPNI.NKA----V
Q6NK35_CORDI/146-313.......---SAVEDAHGLKIT-----------------------------------AQL.DLDNPKARQV.YNL----L
Q9L8M7_HAEIF/3-170....L..---KLEEDTIGLRFE-----------------------------------LMP..PDTTLGRDL.LVG----V
Q6R4V3_9CAUD/35-179.......---VWLDDDRRLRAR-----------------------------------VRF..SRSAKAEEL.WQD----V
Q8G1W3_BRUSU/11-164.......---QIREDARGLYVE-----------------------------------GRL.AKGVARAREA.LEL----M
Q854Q0_9CAUD/24-197....L..---DLSVDDKGLKVV-----------------------------------ARL.DKRDPDVQSL.AVK----M

PF00716

PPR_VZVD/28-373TPESSIEPFRVLSMESKARLLS...LVKDYAGLNK..........VWKVSEDKLAKVLLSTAVNNMLLRDR-WDV----V
PPR_SCMVC/22-347QPDWVMERFPDLTEADREALRN....QLSGSGEVAAKESAESSAAAAVDPFQSDSYGLLGNSVDALYIQER-LPK----L
PPR_HHV11/37-365GLDAAIAPFRHLSPASREGARRLAAEAELALSGR...........TWAPGVEALTHTLLSTAVNNMMLRDR-WSL----V
PPR_EBVB9/24-327DLAWVLKHFSDLEPSIAAQIENDANAAKRESG..............CPEDHPLPLTKLIAKAIDAGFLRNR-VET----L
PPR_EHV1B/31-382TPENAVAPFKRLSPSSREELLITAREAQSRLGDAA..........TWHLSEDTLTRVLLSTAVNNMLLRNR-WNL----V
PPR_EHV2/58-381SLDWILSKFTSLSPEERGAIAE....GYASPA..........PESLPEPHFTCSNEILMAKAIDAGFIKNR-LEI----L
PPR_BHV1C/44-376TPDACVAPFRRLSPRARAALLANAEAARAALGDR...........AWPVPREALAQTLLSTAVNNMLVRDK-WDT----V
PPR_HHV7J/21-315NLNWILDRFSSITEAEKEKILS....TDQSCV...........QFFAEEQFKVDLYDLLADSLDTSYIKVR-FPK----L
PPR_HCMVA/31-415DPEWVTQRFPDLTAADRDGLRA....QWQRCG........STAVDASGDPFRSDSYGLLGNSVDALYIRER-LPK----L
PPR_SHV21/21-310NLEDAISQFCSISQAEVENIYQ....DSKNVD..........INSLPKPVFNIDPHILMAKAIDAGFIKDR-LQL----L
PPR_ILTVT/28-358TASEAIGAFDDLSAPIKEQLYEIATREKCAEVP.............RELSRPEITRVLMKKFIHGAFLMDR-GTC----L

PF03420

Q9XJ88_BPKV4/1-213----------ELWWDGDNVMGK-----------------------------------AIVLNTPK..GQIV-RGL----I
PCPP_BPT4/3-212----------DMWWKGNDVYGR-----------------------------------ARVIEGDHGPGDKL-AAN----I

PF14550

B9J6K3_BACCQ/38-159KKG..EVTGFSMGG...---------------------------------------------------------------
B0P3E9_9CLOT/21-150KDG..TYTMFSIEG...---------------------------------------------------------------
F1D5Z3_9CAUD/31-169EDGTTEIAGLSIRGWGV---------------------------------------------------------------
D3DZY3_METRM/1-134LNG..EYTGYSITT...---------------------------------------------------------------
Q08QA7_STIAD/304-428KDG..QLTGFSIGG...---------------------------------------------------------------
B3ZWM2_BACCE/37-157KKG..EFQGYSLAG...---------------------------------------------------------------
E8VED4_BACST/36-157KKG..EITGYSMAG...---------------------------------------------------------------
C0ED09_9CLOT/23-156KDG..TYKMFSIEG...---------------------------------------------------------------
B4AH51_BACPU/36-157QKG..EITGYSMAG...---------------------------------------------------------------
D7CZA0_GEOSC/3-124KEG..KLTGFSIMG...---------------------------------------------------------------
C3FD53_BACTU/38-157QKG..EITGYSMAG...---------------------------------------------------------------
E0U1S1_BACPZ/36-158KAG..IITGYSMAG...---------------------------------------------------------------
D6RRF8_BPKPP/7-135LDG..SFNGVSIGA...---------------------------------------------------------------
C8PIK5_9PROT/34-156KSG..ELSGLSMYG...---------------------------------------------------------------
E3E570_PAEPS/36-162QNE..EVTGYSMAG...---------------------------------------------------------------
C2WX90_BACCE/38-159KKG..KITGFSMGG...---------------------------------------------------------------
B0VF67_CLOAI/84-211EKG..EFNGVSIYG...---------------------------------------------------------------
D4M9P0_9BACT/38-162KKG..ELAGLSMAG...---------------------------------------------------------------
C2VKX1_BACCE/36-162QKG..NYTGYSLAG...---------------------------------------------------------------
A5GZ28_9CAUD/35-156QKG..EFTGYSLAG...---------------------------------------------------------------
C2PP47_BACCE/36-162KDG..KMTGYSLAG...---------------------------------------------------------------
C6LG49_9FIRM/22-151KDG..TYSMFSIEG...---------------------------------------------------------------
D0LP87_HALO1/215-339RTG..ALTGFSIGG...---------------------------------------------------------------
A5ZPY2_9FIRM/75-197EKG..EITGFSMGG...---------------------------------------------------------------
D3T2F8_NATMM/9-129GE...VLHGFSIGGDVS---------------------------------------------------------------
B3RGK2_9CAUD/39-171KAG..IVGGLSIQA...---------------------------------------------------------------
B4AHK1_BACPU/37-158QKG..HITGYSMAG...---------------------------------------------------------------
C6JB26_9FIRM/31-160KNG..TYSMFSIEG...---------------------------------------------------------------
Q9HH51_9CAUD/107-236KTG..KYTGFSITA...---------------------------------------------------------------
B3Z210_BACCE/37-157QKG..DYKGYSLAG...---------------------------------------------------------------
C4ZCA6_EUBR3/24-153KDG..TYPMFSIEG...---------------------------------------------------------------
A0RNP3_CAMFF/36-158KKG..DLKALSMAG...---------------------------------------------------------------
Q92CB9_LISIN/36-157KKG..EITGYSMAG...---------------------------------------------------------------
A0ZYR5_9CAUD/12-145QDD..IISGYSIGA.VQ---------------------------------------------------------------
D4N438_9CAUD/23-155KSG..EFTGVSIGA...---------------------------------------------------------------

PF04586

VP4_BPHK7/11-167QHG--TVEGMSVGFSVA.....KDDYTIIPT......-------------------------------------------
Q8LTC1_9CAUD/10-182RRG--IISQSSFAFTIAP.DKDAQKWQKSN...ERGV-------------------------------------------
Q8XLC1_CLOPE/14-176SNG--DIDGCSFGFYVL.....DDEWTYTE...DKVD-------------------------------------------
Q73HU3_WOLPM/8-161KTG--TINGLSIGYIPI.....EYDVDHKSG......-------------------------------------------
Q6NFQ8_CORDI/19-166RAR--VRDALSVELREF...................E-------------------------------------------
Q9AZM3_9CAUD/12-176KAG--NLKGMSFGFSVA...DGGDSWQQGA...DSPI-------------------------------------------
Q928F8_LISIN/13-177KRG--DVSQCSFGFNII.....KEQEEWRD...DGSV-------------------------------------------
Q8HAD3_9CAUD/21-178KAG--SLTGLSIGYVLK.....DWEYDRSKE......-------------------------------------------
Q9RNH0_RHOCA/16-167AAG--AIDGLSIGYRTI.....AAEKDAKG.......-------------------------------------------
Q6QGD7_BPT5/23-174KNG--VLKTFSIGFRCL.....DAEWDEATD......-------------------------------------------
Q8SBP9_9CAUD/15-184KRG--DVDGTSFGFKVL.....DDKWSKVEIDGEEIM-------------------------------------------
Q8SBH9_BPSF5/9-172QRG--DINQSSFAFRVA...RDGEEWYQDE...DGVV-------------------------------------------
Q830G5_ENTFA/12-173SRG--DINQCSFGFYPT.....EETWDYSS...DPVL-------------------------------------------
Q81Z10_BACAN/15-178KRG--DVDGVSFGFSMI.....SEEIQEPD...DDLM-------------------------------------------
Q6JIM8_9CAUD/15-172KAK--AITGLSIGYYVL.....SSDYNEKTG......-------------------------------------------
Q81XX9_BACAN/12-175KRG--DVDGVSFGFQMV.....KEEWDESD...PDNV-------------------------------------------
Q9AZY6_9CAUD/13-176QRG--DVDQCSFGFNIL.....DEAMETRD...DGSY-------------------------------------------
Q8DXJ7_STRA5/5-163KMG--ALDSLSIGFFIK..........DYEPIDAKQP-------------------------------------------
Q9ZXF7_BPPH1/11-184RSG--VINQCSFAFSLDYGDAEADEWRINE...DEDI-------------------------------------------
O80044_9CAUD/9-174RVG--NRNQCSFGFMLD...DKGDEVRFDE...QENI-------------------------------------------
Q813K0_BACCR/5-168RNK--ELRGWSFGFVSE.....KDSWEEGE...SGVQ-------------------------------------------
Q88MK5_PSEPK/15-174QTR--SITGLSIGYYVR.....ESSFDEKTR......-------------------------------------------
Q7DBD8_ECO57/8-161KTG--LVRGLSVGFRPH.....EYTFLDGG.......-------------------------------------------
Q83LG5_SHIFL/7-171KRG--DISGMSFGFRSR.....KDVWDTTTDPC....-------------------------------------------
A9CJN9_AGRT5/15-165KTG--ALDGLSIGFRTV.....RSGKGAGSG......-------------------------------------------
Q8G796_BIFLO/11-163RDG--VLDSFSVGFMPV...........TTDKRTEGD-------------------------------------------
Q6N8L6_RHOPA/13-166RAG--AIDGLSIGYRTV.....RGQIDPRTR......-------------------------------------------
Q859C2_9CAUD/12-177KRG--DLQGSSFTFRVL...DGGQRRADDDDPDTGLP-------------------------------------------
Q8XYS5_RALSO/12-178ARG--DINGSSFSFRVA...PDGDEWRKEG...E.LV-------------------------------------------
P71948_MYCTU/7-165KAG--VVDAFSVGFRPI...............RDRRE-------------------------------------------
O21873_9CAUD/8-151ENG--AFDSLSIAYYIT.....DYEFNEND.......-------------------------------------------
Q6NK35_CORDI/146-313KAK--RLSQMSFAFDVV.....EGSWGEREQQE....-------------------------------------------
Q9L8M7_HAEIF/3-170ERG--DITGMSFGFWAK.....EETWNFDVEPC....-------------------------------------------
Q6R4V3_9CAUD/35-179LDG--IRRHISIGYIIH..........EMVLESSGDQ-------------------------------------------
Q8G1W3_BRUSU/11-164RSG--GLDGLSIGFRTV.....RARKDARTG......-------------------------------------------
Q854Q0_9CAUD/24-197ERG--DMDEMSFAFRVK.....AQKWEATDEFPEDDQ-------------------------------------------

PF00716

PPR_VZVD/28-373AKRR-REAGIM.GHVYLQASTGYGLARITNVNGVESKLPNAG................VINATFHPGG.......P.IYD
PPR_SCMVC/22-347RYDK-RLVGVTARESYVKASVSPAEQETCDIKVEKER.........................PKEPEQ...........S
PPR_HHV11/37-365AERR-RQAGIA.GHTYLQASEKFKMWGAEPVSAPARGYKNGA................PESTDIPPGS....IAAAPQGD
PPR_EBVB9/24-327RQDR-GVANIP.AESYLKASDAPDLQKPD....KALQ...........................SPPP............
PPR_EHV1B/31-382ARRR-REAGIE.GHTYLQASASFGITNGCN...KADFCGAEL................VDTCGYKSGEK...VHGAPYSR
PPR_EHV2/58-381KTDK-GVAEVK.APTYLKASVQG..LPANLDEVDSARG........................GEDPPTAAIATTPHPATD
PPR_BHV1C/44-376SRRR-REAGIA.GHTYLQASAVFPLPTGG..EGPERTGGRER................AQKSAVAGGV....CIALPVAG
PPR_HHV7J/21-315QSDK-QLSGIS.KSTYIKASENL..TANNHTINVNSK..........................VTKET...........E
PPR_HCMVA/31-415RYDK-QLVGVTERESYVKASVSP..EAACDIKAASAERSGDSRSQAATPAAGARVPSSSPSPPVEPPSPVQPPALPASPS
PPR_SHV21/21-310KTDK-GVAKIK.KLTYLKASEIG..KPVTEDISEDMN...........................................
PPR_ILTVT/28-358KTRR-EMAAVY.NPKYLQANEVITIGIKEHSEETPENAIKDR....................SVSTQT.......APSFD

PF03420

Q9XJ88_BPKV4/1-213EGG--WVPGVSSRGLGSVKQV.DGINEVQD.-------------------------------------------------
PCPP_BPT4/3-212RAG--WIPGVSSRGLGSLTDTNEGYRIVNEG-------------------------------------------------

PF14550

B9J6K3_BACCQ/38-159--------------------------------------------------------------------------------
B0P3E9_9CLOT/21-150--------------------------------------------------------------------------------
F1D5Z3_9CAUD/31-169--------------------------------------------------------------------------------
D3DZY3_METRM/1-134--------------------------------------------------------------------------------
Q08QA7_STIAD/304-428--------------------------------------------------------------------------------
B3ZWM2_BACCE/37-157--------------------------------------------------------------------------------
E8VED4_BACST/36-157--------------------------------------------------------------------------------
C0ED09_9CLOT/23-156--------------------------------------------------------------------------------
B4AH51_BACPU/36-157--------------------------------------------------------------------------------
D7CZA0_GEOSC/3-124--------------------------------------------------------------------------------
C3FD53_BACTU/38-157--------------------------------------------------------------------------------
E0U1S1_BACPZ/36-158--------------------------------------------------------------------------------
D6RRF8_BPKPP/7-135--------------------------------------------------------------------------------
C8PIK5_9PROT/34-156--------------------------------------------------------------------------------
E3E570_PAEPS/36-162--------------------------------------------------------------------------------
C2WX90_BACCE/38-159--------------------------------------------------------------------------------
B0VF67_CLOAI/84-211--------------------------------------------------------------------------------
D4M9P0_9BACT/38-162--------------------------------------------------------------------------------
C2VKX1_BACCE/36-162--------------------------------------------------------------------------------
A5GZ28_9CAUD/35-156--------------------------------------------------------------------------------
C2PP47_BACCE/36-162--------------------------------------------------------------------------------
C6LG49_9FIRM/22-151--------------------------------------------------------------------------------
D0LP87_HALO1/215-339--------------------------------------------------------------------------------
A5ZPY2_9FIRM/75-197--------------------------------------------------------------------------------
D3T2F8_NATMM/9-129--------------------------------------------------------------------------------
B3RGK2_9CAUD/39-171--------------------------------------------------------------------------------
B4AHK1_BACPU/37-158--------------------------------------------------------------------------------
C6JB26_9FIRM/31-160--------------------------------------------------------------------------------
Q9HH51_9CAUD/107-236--------------------------------------------------------------------------------
B3Z210_BACCE/37-157--------------------------------------------------------------------------------
C4ZCA6_EUBR3/24-153--------------------------------------------------------------------------------
A0RNP3_CAMFF/36-158--------------------------------------------------------------------------------
Q92CB9_LISIN/36-157--------------------------------------------------------------------------------
A0ZYR5_9CAUD/12-145--------------------------------------------------------------------------------
D4N438_9CAUD/23-155--------------------------------------------------------------------------------

PF04586

VP4_BPHK7/11-167-----------------------------------------------------------------------..GRIFKNI
Q8LTC1_9CAUD/10-182-----------------------------------------------------------------------KYDRTINNI
Q8XLC1_CLOPE/14-176-----------------------------------------------------------------------..LRKVKEV
Q73HU3_WOLPM/8-161-----------------------------------------------------------------------..ARVLKQV
Q6NFQ8_CORDI/19-166-----------------------------------------------------------------------MDGDTIVSG
Q9AZM3_9CAUD/12-176-----------------------------------------------------------------------...RIINQL
Q928F8_LISIN/13-177-----------------------------------------------------------------------..KWSLEEV
Q8HAD3_9CAUD/21-178-----------------------------------------------------------------------..AFLLKEI
Q9RNH0_RHOCA/16-167-----------------------------------------------------------------------..QRLLAEL
Q6QGD7_BPT5/23-174-----------------------------------------------------------------------..IFIIKDL
Q8SBP9_9CAUD/15-184-----------------------------------------------------------------------..KRTLLEI
Q8SBH9_BPSF5/9-172-----------------------------------------------------------------------..IREITRF
Q830G5_ENTFA/12-173-----------------------------------------------------------------------..R.TIHEV
Q81Z10_BACAN/15-178-----------------------------------------------------------------------..LRTVTKA
Q6JIM8_9CAUD/15-172-----------------------------------------------------------------------..IRTLNEV
Q81XX9_BACAN/12-175-----------------------------------------------------------------------..VRSVTKA
Q9AZY6_9CAUD/13-176-----------------------------------------------------------------------..KFTIKAI
Q8DXJ7_STRA5/5-163-----------------------------------------------------------------------YGGWIFKEV
Q9ZXF7_BPPH1/11-184-----------------------------------------------------------------------.YERRINKI
O80044_9CAUD/9-174-----------------------------------------------------------------------.YKRTLTAI
Q813K0_BACCR/5-168-----------------------------------------------------------------------..KRSIEEL
Q88MK5_PSEPK/15-174-----------------------------------------------------------------------..IRTLTKL
Q7DBD8_ECO57/8-161-----------------------------------------------------------------------..GLHFLRW
Q83LG5_SHIFL/7-171-----------------------------------------------------------------------..VRTVLVA
A9CJN9_AGRT5/15-165-----------------------------------------------------------------------..VRRILEA
Q8G796_BIFLO/11-163-----------------------------------------------------------------------TSVYVRRAV
Q6N8L6_RHOPA/13-166-----------------------------------------------------------------------..VRRLYQV
Q859C2_9CAUD/12-177-----------------------------------------------------------------------..VREITAM
Q8XYS5_RALSO/12-178-----------------------------------------------------------------------..VRTIHRF
P71948_MYCTU/7-165-----------------------------------------------------------------------GDVIVRVEA
O21873_9CAUD/8-151-----------------------------------------------------------------------..ALVVNKA
Q6NK35_CORDI/146-313-----------------------------------------------------------------------..VYELKKV
Q9L8M7_HAEIF/3-170-----------------------------------------------------------------------..QRTVAKA
Q6R4V3_9CAUD/35-179-----------------------------------------------------------------------GDTYRVMDW
Q8G1W3_BRUSU/11-164-----------------------------------------------------------------------..LRHITQA
Q854Q0_9CAUD/24-197-----------------------------------------------------------------------.ALRTITEV

PF00716

PPR_VZVD/28-373LALGVGE.............SNEDCEKTVPHLKVTQLCRND......SDMASVAGNASNISPQPPSGVPTGGEFVLIPTA
PPR_SCMVC/22-347HVPTES..............MSHPMSAVATPAAS....................TVAPSQAPLALA.....HDGVYLPKD
PPR_HHV11/37-365RCPIVRQ.............RGVALSPVLPP...................MNPVPTSGTPAPAPPG....DGSYLWIPAS
PPR_EBVB9/24-327.ASTDP...............ATMLSGNAGEG......................ATACGGSAAAG......QDLISVPRN
PPR_EHV1B/31-382VTLGAKA.............FTSSSPNALPSSDNDKGGIGERTQKHISAMASSNPQTLSAAGAPLV....SGDYILVPAA
PPR_EHV2/58-381ATTMNQQ...............QPFAAQAPAGG.....................CEDLISVPRSTF.....MTMLQTNLD
PPR_BHV1C/44-376GRARQPE.............LPPAPPPPPPPP.................AMSAAHQAGAASAHPLP....AGDYVYVPTA
PPR_HHV7J/21-315ATDSVS...............QDDCAVHAPDLIS.....................TICSTTHTTH......HDLVRMNGS
PPR_HCMVA/31-415VLPAESPPSLSPSEPAEAASMSHPLSAAVPAATAPPG.............ATVAGASPAVSSLAWP.....HDGVYLPKD
PPR_SHV21/21-310...QHG.....................IVPQG......................SDDLISVPKSTF.....LSMLQNNLD
PPR_ILTVT/28-358ISESQQP.............SGQTHVPAMESATCSG...............QFLQTKNGASPSASR.....EDMVYVPFE

PF03420

Q9XJ88_BPKV4/1-213-------------------------------------------------------------------------FRLTVGV
PCPP_BPT4/3-212-------------------------------------------------------------------------FKLTVGV

PF14550

B9J6K3_BACCQ/38-159------FGERVEI---------------------------------------
B0P3E9_9CLOT/21-150------KAKRIEV---------------------------------------
F1D5Z3_9CAUD/31-169------VNDPREL---------------------------------------
D3DZY3_METRM/1-134------VSKKFAD---------------------------------------
Q08QA7_STIAD/304-428------TARRLPE---------------------------------------
B3ZWM2_BACCE/37-157------VAET.EV---------------------------------------
E8VED4_BACST/36-157------TAETIEK---------------------------------------
C0ED09_9CLOT/23-156------TGVREEV---------------------------------------
B4AH51_BACPU/36-157------TADIGKQ---------------------------------------
D7CZA0_GEOSC/3-124------VPKVALK---------------------------------------
C3FD53_BACTU/38-157------TAEV..E---------------------------------------
E0U1S1_BACPZ/36-158------TADVYEE---------------------------------------
D6RRF8_BPKPP/7-135------RATVEDL---------------------------------------
C8PIK5_9PROT/34-156------SGVIKSG---------------------------------------
E3E570_PAEPS/36-162------TAETIEK---------------------------------------
C2WX90_BACCE/38-159------VGERMEM---------------------------------------
B0VF67_CLOAI/84-211------RADDYSG---------------------------------------
D4M9P0_9BACT/38-162------YAAKVRK---------------------------------------
C2VKX1_BACCE/36-162------IAET.EV---------------------------------------
A5GZ28_9CAUD/35-156------TAEVEEV---------------------------------------
C2PP47_BACCE/36-162------VAET.EV---------------------------------------
C6LG49_9FIRM/22-151------EAERIEV---------------------------------------
D0LP87_HALO1/215-339------SARRVPD---------------------------------------
A5ZPY2_9FIRM/75-197------TGNYSTE---------------------------------------
D3T2F8_NATMM/9-129------KADEFES---------------------------------------
B3RGK2_9CAUD/39-171------TGNVDEE---------------------------------------
B4AHK1_BACPU/37-158------TADIVAI---------------------------------------
C6JB26_9FIRM/31-160------EAQRIEV---------------------------------------
Q9HH51_9CAUD/107-236------VPAQKAQ---------------------------------------
B3Z210_BACCE/37-157------IAET.EV---------------------------------------
C4ZCA6_EUBR3/24-153------EAERVEV---------------------------------------
A0RNP3_CAMFF/36-158------TAIKEED---------------------------------------
Q92CB9_LISIN/36-157------IAEVVEQ---------------------------------------
A0ZYR5_9CAUD/12-145------VDWNGPY---------------------------------------
D4N438_9CAUD/23-155------RATVEDI---------------------------------------

PF04586

VP4_BPHK7/11-167QALR..EISVCTF.P-------------ANEQAGIA.....AMKSVDGIETI
Q8LTC1_9CAUD/10-182DHLF..DVSPVTT.P-------------AYPDTEVK....VGARSLEQIKAL
Q8XLC1_CLOPE/14-176E.LI..EVTITPF.P-------------AYLDS..E....ASCRSFELHNKE
Q73HU3_WOLPM/8-161E.LW..KVSLVTF.P-------------ANLAAQVIN..VKNQNNEQGVLAR
Q6NFQ8_CORDI/19-166S.LS..AVALVPV.P-------------AYRRARVE......PSRAATLASS
Q9AZM3_9CAUD/12-176QTLS..EISVVSR.P-------------AYDDTSVQ....V.TRSMDAFLSE
Q928F8_LISIN/13-177E.LH..EVSVCTF.P-------------AYSDTGVE....ARQNDVKRHEKR
Q8HAD3_9CAUD/21-178D.LW..EVSLVTF.P-------------SNDEARIS....DVKNALARGEIP
Q9RNH0_RHOCA/16-167E.LW..EVSLVTF.P-------------MLREARVA.....AKGEAPEAAIW
Q6QGD7_BPT5/23-174E.LY..EVSVVSV.P-------------CNQDSTFN.....LAKSMNGHDYT
Q8SBP9_9CAUD/15-184D.LY..EISPTPF.P-------------AYEDTEVD......CRSLEKIKFN
Q8SBH9_BPSF5/9-172SRLL..DVSPVTY.P-------------AYQEADSA.........VRSMKAW
Q830G5_ENTFA/12-173E.LY..EVSIVSL.P-------------AYEDTEAA....LSRNK.QEMKQD
Q81Z10_BACAN/15-178K.LL..EVSAVAF.P-------------AYPDS..E....VSARGYDPYKHF
Q6JIM8_9CAUD/15-172D.LV..EISIVTN.P-------------ANANARID....AVKSIIAHGGLP
Q81XX9_BACAN/12-175K.LL..EISPVAF.P-------------AYPDS..Q....VSARSHDPYKQF
Q9AZY6_9CAUD/13-176E.LF..EVSVVTF.P-------------AYADTAVE....ARSKQIENMEKR
Q8DXJ7_STRA5/5-163E.IF..EISVVTV.P-------------ANPQATVD...NIKEFDMSAVDKR
Q9ZXF7_BPPH1/11-184NRIF..DISLVTT.P-------------AYSDTEAV....VGARSLEKVEQL
O80044_9CAUD/9-174RELT..DVSVVTY.P-------------AYKDTDVK....PALRSIETVKKE
Q813K0_BACCR/5-168E.LL..EVSILDMTP-------------AYVATSIE.......TRGENTAMI
Q88MK5_PSEPK/15-174D.LI..EISIVTV.P-------------ANDEARTD....TIKSKLAHGGLP
Q7DBD8_ECO57/8-161E.LM..EVSAVTV.P-------------ANAECTIR.....TIKSYDRPFSA
Q83LG5_SHIFL/7-171E.LY..EITVTSV.P-------------AYPDSGVE....LARRSL..YEQH
A9CJN9_AGRT5/15-165D.LW..EISVVTF.P-------------MLPSARVS........DVKHARFF
Q8G796_BIFLO/11-163K.LL..EVAVTGI.P-------------AYTGAAIT.....GQRDQEHVNQE
Q6N8L6_RHOPA/13-166D.LW..EISIVTF.P-------------LLSGARIA........TVKHTPRP
Q859C2_9CAUD/12-177D.VV..ELGPVVN.P-------------AYPTT..Q....ASLRSVQETLRI
Q8XYS5_RALSO/12-178QTLI..DVSPVTY.P-------------AYDES..H....SAQRSLTAWRQA
P71948_MYCTU/7-165A.LL..EVSLTGV.P-------------AYLGAQIA....GVRAESLAVVSR
O21873_9CAUD/8-151Q.FK..EISLVSV.P-------------ADPNAKFI..........QNALGE
Q6NK35_CORDI/146-313K.LY..EVSVVPI.G-------------ANQETSIIDVKAVVAEELANMLDS
Q9L8M7_HAEIF/3-170E.LF..EITVTSI.P-------------ANPESSVE....IAKRSMATAKGK
Q6R4V3_9CAUD/35-179E.PY..EISLISV.P-------------ADPTVGVG.......RSIDIGNIT
Q8G1W3_BRUSU/11-164D.LW..EISVVTF.P-------------MLPQARVT.......GIKAGLPTI
Q854Q0_9CAUD/24-197S.LHKGDVSVVNF.G-------------ANPTT..S....VGLRSLPEALRF

PF00716

PPR_VZVD/28-373YYSQLLTGQTKNPQV-------------SIGAPNNGQYIVGPYGSPHPPAFP
PPR_SCMVC/22-347AFFSLIGASR.....-------------.PLAEAAGARAAYPAVPPP.PAYP
PPR_HHV11/37-365HYNQLVAGHAAPQPQ-------------......PHSAFGFPAAAGSVAYGP
PPR_EBVB9/24-327TFMTLLQTNLDNKPP-------------R.QTPLPYAAPLPPFSHQAIATAP
PPR_EHV1B/31-382QYNQLVVGQHTSHPP-------------INAGP.APVTHAVPSQYIPPAYNS
PPR_EHV2/58-381TMRQTSLGQRFGQPI-------------DAP.AAPPAQLRVPPPAAPFPVHP
PPR_BHV1C/44-376QYNQLVVSQARGAAM-------------T.AAP.PPAPYFLPAAAAAAAAPP
PPR_HHV7J/21-315ATGNSASLPA.....-------------...PQFSEC.VFLPKDTFC.SLLN
PPR_HCMVA/31-415AFFSLLGASRSAVPV-------------MYPGAVAAPPSASPAPLPL.PSYP
PPR_SHV21/21-310NFKQHPRPACFPQYF-------------SPQGAYMPYELYPPQPYS..GDNI
PPR_ILTVT/28-358KYASLLAASAR.RDN-------------DRRPVSPSREFSRRSRDSTHECSP

PF03420

Q9XJ88_BPKV4/1-213DVVWGPSAPAAYVKP..VTESNEAAKSVKTEEITESNDAEFAKLAETLKTLL
PCPP_BPT4/3-212DAVWGPSAPDAWVTPKEITES.......QTAEADTSADDAYMALAEAMKKAL

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window