Sequence alignment for CL0208

PF00179

UBC21_CAEEL/25-161RKCKEVA......NAS-------DI---------------TEAGIHVEIKE.----------------------------
UBC35_ARATH/9-141RIIKETQ......RLL-------SE---------------PAPGISASPSE.----------------------------
UBC24_ARATH/678-815L...............-------..---------------.PNTIYVRVCE.----------------------------
UBC2_NEUCR/8-145RLMRDFK......RMQ-------TD---------------PPAGVSASPVP.----------------------------
UB2L6_HUMAN/6-144RVVKELE......DLQ-------KK---------------PPPYLRNLSSD.----------------------------
UB2G1_RAT/9-161LLRRQLA......ELN-------KN---------------PVEGFSAGLID.----------------------------
UBE2K_MOUSE/8-147RIKREFKEV.LKSE..-------ET---------------SKNQIKVDLVD.----------------------------
UBCX_YEAST/21-174RIVKEYKVI.LKTLAS-------DD---------------PIANPYRGIIES----------------------------
UBC1_SCHPO/8-144RIAKELA......DVQ-------QD---------------KQAGIQVWTIN.----------------------------
UBC12_YEAST/31-172RLKRDLDS....L...-------DL---------------PPTVTLNVITSP----------------------------
O48838_ARATH/33-171RLWKEFQ.........-------.E---------------KDDVLKIHVRS.----------------------------
UBC13_SCHPO/6-141RIIKEIE......TLT-------RD---------------PPPGIVAAPTE.----------------------------
Q9VH01_DROME/4536-4692RLAQEAV......TLS-------TS---------------LPLSFSSSVFVR----------------------------
UBC14_SCHPO/11-149RLTKEYS......DLR-------EH---------------PIPDIRVNLVD.----------------------------
Q9VZ73_DROME/14-153RMNRELAL...MLE..-------DK---------------QNLQFRNLLVE.----------------------------
Q9VJS5_DROME/7-142RIIKETQ......RLL-------ED---------------PVPGISATPDE.----------------------------
UBC84_DROME/6-144RLTRELS......DLV-------EA---------------KMSTLRNIESS.----------------------------
UBC15_SCHPO/9-160LLRKQLK......EIQ-------KN---------------PPQGFSVGLVD.----------------------------
UBC9_CAEEL/8-152RLAEERK......HWR-------KD---------------HPFGFIAKPVK.----------------------------
UBC34_ARATH/9-146RLQKEYR.........-------..---------------..ALCKEPVSHV----------------------------
Q43780_SOLLC/6-143RVQKELH.....ECNR-------DV---------------QVSGINVTLKG.----------------------------
UBC2_MEDSA/8-145RLMRDFK......RLQ-------HD---------------PPAGISGAPQD.----------------------------
UBC2_YEAST/8-145RLMRDFK......RMK-------ED---------------APPGVSASPLP.----------------------------
UBCX_PICAN/7-177RLLKEYRAV.KKELT.-------EK---------------RSPIHDTGIVD.----------------------------
UBC12_DROME/30-165RIQKDINE....L...-------NL---------------PNTCATDF....----------------------------
UB2G2_MOUSE/8-159RLMAEYK......QLT-------LN---------------PPEGIVAGPMN.----------------------------
Q95039_PARTE/244-382RILKELQDV..TA...-------QG---------------DKLNFKCYPTA.----------------------------
UB2J2_MOUSE/16-153RLKQDYL.........-------..---------------..RIKKDPVPYI----------------------------
UB2L3_MOUSE/6-144RLMKELE......EIR-------KC---------------GMKNFRNIQVD.----------------------------
UBE2C_DROME/36-172RLHKELM......NLM-------MA---------------NERGISAFPDG.----------------------------
AKTIP_MOUSE/72-217PFYLEYSLLAEFTLVV-------KQ---------------KLPGVYVQPSY.----------------------------
UBC3_YEAST/11-164LLLRQYRE....LTDP-------KK---------------AIPSFHIELED.----------------------------
UBE2C_SPISO/34-170RLQQELR......TLL-------MS---------------GDPGITAFPDG.----------------------------
Q9VGD6_DROME/17-152RLDRDVN.........-------RL---------------LASGYRTTVDD.----------------------------
Q9XZ32_DROME/1125-1274AVQREYLML.KSSLP.-------..---------------.NGVVVRAYED.----------------------------
UBC9_YEAST/8-152RLQEERK......KWR-------KD---------------HPFGFYAKPVK.----------------------------
Q9TZ69_CAEEL/8-147RLQRECKE...VVTNS-------EI---------------SETGIMIEILN.----------------------------
UBCD2_DROME/90-225RIQKELA......EIT-------LD---------------PPPNCSAGPKG.----------------------------
UBC12_MOUSE/33-168RIQKDINE....L...-------NL---------------PKTCDISF....----------------------------
Q20617_CAEEL/17-156RIRKEIA......DLA-------KN---------------KRRFIKDFRKI.----------------------------
UBC12_SCHPO/27-162RIQKDVTD....L...-------EI---------------PSTMSTSW....----------------------------
SCE1_ARATH/9-153RLAEERK......SWR-------KN---------------HPHGFVAKPET.----------------------------
UBC9_MESAU/8-152RLAQERK......AWR-------KD---------------HPFGFVAVPTK.----------------------------
UBC7_YEAST/8-159RLLKELQ......QLI-------KD---------------SPPGIVAGPKS.----------------------------
UBCD4_DROME/8-147RIKREFKE...VMRSE-------EI---------------VQCSIKIELVN.----------------------------
Q9VYN3_DROME/66-201RIKSELQ......DIR-------KN---------------PPPNCTADLHH.----------------------------
Q20872_CAEEL/39-180TVKEEKA......KWD-------ER---------------TPQGYTAKPISF----------------------------
UBC7_SCHPO/9-160RLMKEYK......ELT-------EN---------------GPDGITAGPSN.----------------------------
UB12L_ARATH/35-171RLHKDISE....L...-------NL---------------PKSCKISF....----------------------------
UBC8_YEAST/7-143RIETDVM.........-------KL---------------LMSDHQVDLIN.----------------------------
UBE2S_HUMAN/15-152LVYKEVTT....LT..-------AD---------------PPDGIKVFPNE.----------------------------
Q9Y165_DROME/341-479FLRGEANL....LN..-------SY---------------ESEGISAIPLD.----------------------------
UBCB_DICDI/6-141RLQKEIT......DML-------KT---------------PPSWCSAHLVD.----------------------------
UBE2A_MOUSE/8-145RLMRDFK......RLQ-------ED---------------PPAGVSGAPSE.----------------------------
UBC11_YEAST/12-150RLQNELL......QLL-------SS---------------TTESISAFPVD.----------------------------
UBC9_SCHPO/8-152RLQEERK......QWR-------RD---------------HPFGFYAKPCK.----------------------------
UBC5_ARATH/7-143RREMDLM.........-------KL---------------MMSDYKVEMIN.----------------------------
Q9U1Q1_CAEEL/8-159RLMTEYK......ELT-------TR---------------PPEGIIAAPID.----------------------------
UBC13_ARATH/8-159LLQKQLK......DLC-------KH---------------PVDGFSAGLVD.----------------------------
Q9XWF6_CAEEL/8-149RLMKELA......QLK-------SE---------------APEGLLVDNTST----------------------------
Q6AWG5_DROME/66-223ALAMEYK......SLQ-------EE---------------PVEGFRVKLIN.----------------------------
UBC7_WHEAT/11-161SSRSSSE......ISR-------TT---------------PSMGFQLGFVD.----------------------------
Q9VFR8_DROME/9-160LLNRQLS......ELQ-------RH---------------PVEGFSAGLVS.----------------------------
Q9U5Q3_9CILI/34-174RLLTDFKR...INQSQ-------DN---------------DDESVLATPHE.----------------------------
Q9VQ00_DROME/25-160RIQKELD......EIT-------RD---------------PPQYCSAGPKE.----------------------------
UBC11_SCHPO/32-170RLRSELM......SLM-------MS---------------NTPGISAFPDS.----------------------------
UBC17_ARATH/19-158RLQKEFM......EWQ-------TN---------------PPSGFKHRVSD.----------------------------
UBE2C_HUMAN/34-170RLQQELM......TLM-------MS---------------GDKGISAFPES.----------------------------
UBE2H_MOUSE/10-145RMDTDVV.........-------KL---------------IESKHEVTILG.----------------------------
UBC6_ARATH/7-143RREMDMM.........-------KL---------------MMSDYKVDTVN.----------------------------
UBC15_ARATH/19-158RLQKELS......EWQ-------LN---------------PPTGFRHKVTD.----------------------------

PF14461

Q4FRY8_PSYA2/12-152C.....G----------------FK---------------YLKN.SQRQSI-----------------------------
A5G3M9_GEOUR/17-151LLVKSVA----------------EL---------------HPKRLAEPWAK-----------------------------
Q2K8Q4_RHIEC/18-161A.....V----------------EN---------------LATE.TEWFVL-----------------------------
Q8KW20_9RHOB/16-149E.....L----------------AS---------------LAAA.SAWLEE-----------------------------
D3GMN6_9ENTR/13-154C.....G----------------YR---------------YTRA.RNLPEK-----------------------------
A0L3D6_SHESA/1-142M......----------------..---------------LSEI.KQHLIN-----------------------------
A3W6V2_9RHOB/1-135M......----------------DA---------------WERV.REVLAG-----------------------------
Q2NBP1_ERYLH/4-143L.....A----------------DR---------------WRAI.AATLAN-----------------------------
Q2L5J8_CLOPF/12-145LN...SF----------------EN---------------IKNV.KEIKKN-----------------------------
A0AW81_ARTS2/19-154S......----------------..---------------WLQDLGIACRI-----------------------------
A3TSK9_9RHOB/18-157S.....I----------------EQ---------------AAA..GEWFRF-----------------------------
A3GXG6_VIBCL/12-153C.....G----------------FR---------------YTPA.KQMPKG-----------------------------
E0TAZ7_PARBH/17-149RL...GA----------------YL---------------LSAFDAQPFSA-----------------------------
Y4OA_RHISN/9-149D.....Q----------------DN---------------WWQA.YPGLYA-----------------------------
Y4QC_RHISN/29-153L......----------------..---------------HSAA.GESLLV-----------------------------

PF05743

Q7Q6B6_ANOGA/22-142TKKDVMNALRIYH...-------.G---------------LQHRVEEYVF.-----------------------------
UEVLD_HUMAN/21-141TVEELRNVNVFFP...-------.H---------------FKYSMDTYVF.-----------------------------
Q6FS29_CANGA/27-147VFHDAVQTLTEFK...-------.N---------------LRPRTRVFTD.-----------------------------
Q4SDZ6_TETNG/21-141AIEELQKFHRIFP...-------.E---------------MIPSTGTYTF.-----------------------------
Q4TA00_TETNG/24-145TQADLRRVRSRFS...-------.D---------------LRLHVDYYRF.-----------------------------
UEVLD_XENTR/21-141TIEELKDLNRTFP...-------.S---------------FIFSMETYTF.-----------------------------
Q5KKQ1_CRYNJ/24-146ITQEVLYVLQQRR...-------.T---------------LAVKTDAFTF.-----------------------------
TS101_RAT/21-141TVRQTVNVIAMYK...-------.D---------------LKPVLDSYVF.-----------------------------
Q5BAA9_EMENI/33-155TYYDVANVLAKFP...-------.T---------------LAPETAVYTY.-----------------------------
Q75EU1_ASHGO/32-146TFHDVVIALRAYK...-------.K---------------LRPRTRVFTD.-----------------------------
STP22_YEAST/31-162TFHDSLALLDNFH...-------.S---------------LRPRTRVFTH.-----------------------------
Q4UHS4_THEAN/19-133LMCDINGLFGKYH...-------.N---------------FSCSM......-----------------------------
O76258_CAEEL/21-141AKKDIIGALSQFK...-------.D---------------LSPGTDTFMF.-----------------------------
Q9VVA7_DROME/22-142TKKDVVDVVTSFR...-------.S---------------LTYDLQRFVF.-----------------------------
TS101_DICDI/47-167ISKDLKETFHLFP...-------.N---------------LSPFYE.....-----------------------------
P78998_SACPS/31-154TFHDSLALLDKFH...-------.R---------------LRPRTRVFTH.-----------------------------
Q4PAN2_USTMA/23-145VFADVDRALIAVS...-------.S---------------LSPKTEVFTF.-----------------------------
UEVLD_DANRE/21-141AVEELQKVYRVYP...-------.D---------------MKIMAGTYTS.-----------------------------
Q6ESB7_ORYSJ/45-167IRNHLVALADAFP...-------.S---------------LHPKAALFTH.-----------------------------
ELC_ARATH/37-158IRQHLLNLISSYP...-------.S---------------LEPKTASFMH.-----------------------------
Q59WF8_CANAL/24-164VYAHVFQFLQLHLKKN-------LN---------------FKIRTQIYTSS-----------------------------
Q4N7T6_THEPA/34-148LMIDLDGLFLKYH...-------.N---------------FKCSM......-----------------------------
Q4SAD8_TETNG/22-142TVREITNVISQYK...-------.D---------------LKPVMDAYVF.-----------------------------

PF08694

UFC1_ARATH/6-167PNTKSTLTRIPLLTTKAGPRDG.AA---------------WTQRLKEEYKSL----------------------------
UFC1_AEDAE/4-164ESTRKTLSSIPLLQTKAGPRDK.EL---------------WVQRLKEEYQAL----------------------------
A0DET8_PARTE/1-156MQTQSQQTNI...TISAGPRD..AQ---------------WIDRLKEEYAAL----------------------------
UFC1_RAT/4-164EATRRVVSEIPVLKTNAGPRDR.EL---------------WVQRLKEEYQSL----------------------------
Q4N8N9_THEPA/4-172GLSHLSVEGIPLCKTNTGPFDNPED---------------WETRLNEEFAAL----------------------------
Q4DHG1_TRYCC/3-163PAVKESVSRIPLLKTKAGPRDN.EK---------------WTQRLKEEYMSL----------------------------
Q5DBD5_SCHJA/4-164ETTKKTLASIPLLKTRAGPLDG.DM---------------WIQRLKEEYQAL----------------------------
Q22BA5_TETTS/2-180EGIKSIVEKIPLCKVNAGPRD..EK---------------WLDRVKEEYLIL----------------------------
UFC1_DICDI/3-163NHTKQTVQQIPLLTVKAGPRDG.DK---------------WIDRLKEEYQAL----------------------------

PF05773

Q4WEH2_ASPFU/8-134LSNTDLA----------------EE---------------IEAINAIYEPDTV...........................
Q4WU06_ASPFU/41-154NYREIHQ----------------NE---------------AEALRSIYGDDF............................
Q757B9_ASHGO/407-512ESSNIWR----------------DE---------------LESLSSIYTDKI............................
RNF25_HUMAN/11-125EEDWVLP----------------SE---------------VEVLESIYLDELQ...........................
Q4WZQ4_ASPFU/386-489GDEDSWV----------------EE---------------QDTLEAIFGERY............................
Q4WQA1_ASPFU/1-121MGREEQV----------------EE---------------REVLDSIFPEEI............................
Q4WDC1_ASPFU/6-159LSEDERS----------------VE---------------LSSITAIYPEIKIDPTS.......................
E2AK4_HUMAN/18-134SYPQRQD----------------HE---------------LQALEAIYGADFQDL.........................
IMPCT_XENLA/7-113ENVQRQI----------------DE---------------VEALTSIYGDEW............................
Q6BMK3_DEBHA/392-504ESQELWE----------------QE---------------IDGIQMIDANKI............................
Q6BNZ6_DEBHA/2-136DPQEEQQ----------------SE---------------LEVLESIYPDEL............................
Q6BX55_DEBHA/1-103MTVEELH----------------DE---------------VSAIDAIFPDST............................
Q6BWT3_DEBHA/17-158FSDDIRI----------------QE---------------LQSLEAIYSNTTDINYK.......................
IMPCT_CAEEL/2-99SDEEQRI----------------AE---------------IESLASIFPDLL............................
Q640E2_XENLA/7-130ECLELQL----------------LE---------------MEMLLSMFPNKELILENANS..................VL
Q5ADM3_CANAL/405-504ESQEIWN----------------EE---------------IEGLEMTGI...............................
Q59S39_CANAL/9-125DLEHRQQ----------------DE---------------ISSISSIYGDIFKDI.........................
Q6YUR1_ORYSJ/47-192ANNQTQE----------------DE---------------LLALQAIYGDDLVIFDNK.....................D
YL419_YEAST/423-528ESIECWN----------------QE---------------LESLESIYEGCV............................
Q5AU57_EMENI/6-130LSNAELA----------------DE---------------IEAINAIYDPETI...........................
RWDD3_PONAB/1-111MAEPVQ.----------------EE---------------LSALAAIFCGPHE...........................
Q3ZAU6_RAT/4-134EDLEAQE----------------DE---------------LLALASIYDGDEFRKAE.......................
Q4PDS7_USTMA/6-155EYEATLA----------------EE---------------LEVLESIYIDEL............................
Q20871_CAEEL/2-135TDRDLQI----------------YE---------------LEALESVLREKKLAKSSDWS.................DKN
IMPCT_DICDI/1-152MNEE.QE----------------NE---------------ILAISSIYPDSFSEIETIV...................GE
Q55GT9_DICDI/415-519QSKEIIE----------------NE---------------ILALQSIYMNNE............................
Q4CY49_TRYCC/190-316EGDAILE----------------NE---------------LETMQSLFDESF............................
Q4P4B8_USTMA/14-135EITELQR----------------TE---------------IEAIESILDQDFTRVE........................
RWDD3_DANRE/1-109MSKEAF.----------------DE---------------LSVLSAIYCEQGE...........................
Q75F11_ASHGO/10-125EYYEIQQ----------------NE---------------LEAMESIYAGDFVDL.........................
Q9VZ55_DROME/176-361EILDMRA----------------DE---------------KEALESIFDKAY............................
A8X836_CAEBR/4-137DDRETQL----------------FE---------------LEALESVLRENKVTKTSDWT.................DEN
Q9XVY4_CAEEL/15-135ENQHLQE----------------EE---------------KLALDAVYLNQITY..........................
Q86I15_DICDI/66-198LIKTLQQ----------------NE---------------IYTLKQLYRNNFLIIKNTDR.................CYR
Q4RFR0_TETNG/5-135DWAESQL----------------AE---------------IELLTSMFPSQEELEVTDQLAL..............AELR
Q9LQM5_ARATH/184-320MNDQLQE----------------DE---------------LLALGYIYGGNMFIFDRY.....................N
Q6FVK3_CANGA/2-158DYKEEQE----------------QE---------------LEVLRSIYPDEL............................
Q6CTZ2_KLULA/2-106VLNDDVN----------------DE---------------IDAINAIYPDLL............................
Q5JKR6_ORYSJ/3-122DYEQEQE----------------ME---------------VEALQAILMDDIKEI.........................
Q7X7C1_ORYSA/108-233NNRQRQE----------------DE---------------IY....IHYDLNDGAE........................
Q8IDE3_PLAF7/67-179VCAELQQ----------------KE---------------LEALKYIYVLDS............................
Q4SZQ6_TETNG/2-108TANEDQE----------------ME---------------LEALRSIYDGDE............................
YIH1_SCHPO/2-94ENNEEFQ----------------DE---------------LLALESIYPSCL............................
Q4RIS5_TETNG/2-125SDKEAQE----------------DE---------------LLALTSIYDEEEFHRAD.......................
Q6CDD7_YARLI/1-89MSLE...----------------EE---------------VETIDAIFPDSL............................
Q5BB34_EMENI/40-153NYQEIHQ----------------EE---------------VEALRSIYGDDFEDV.........................
Q9VJ60_DROME/3-109TPLEQQT----------------EE---------------REALQSIYEGDT............................
Q7S2B9_NEUCR/1-108MSEQ.LA----------------DE---------------LEAINSIYGDGT............................
Q7Q0B4_ANOGA/9-123TIRERQE----------------NE---------------LEVIKSIFHDEVED..........................
Q4STD1_TETNG/1-114DSQE.QE----------------DE---------------LLALQSIFGPEEFCRKE.......................
Q4D6B4_TRYCC/5-103DDNA...----------------EE---------------VELLLSISPEVV............................
Q95RT3_DROME/4-116NYKEDQT----------------NE---------------VEALDSIYCGDM............................
ITT1_SCHPO/9-132DNKHLVA----------------DE---------------LIALQSIYPEIHLDGN........................
Q6CTQ8_KLULA/10-125QYYEIQK----------------LE---------------TEALQSIYMDDFTDL.........................
Q8X0V7_NEUCS/437-541DADECWE----------------EE---------------MATLEACFGEKF............................
IMPCT_MOUSE/7-113GNSQRQS----------------EE---------------IEAMAAIYGEEW............................
Q4RHJ9_TETNG/221-397ECLAQRQ----------------EE---------------ALALAAIYGERF............................
Q4RLP9_TETNG/13-130EHTIQQD----------------NE---------------LEALASIFGDDFQDL.........................
Q6C972_YARLI/2-130DPLEEQQ----------------QE---------------LEVLQSIYPEEI............................
Q9C2M7_NEUCS/8-183DSDSPRD----------------TE---------------LSSLVAIYPEIQHPRSD.......................
Q6CS85_KLULA/412-516EVNETWN----------------QE---------------LEALKSIYESNF............................
Q8T6F6_DROPS/41-151FCRDLQD----------------NE---------------VQTLHYLGL...............................
Q3ZC53_BOVIN/3-111DYGEEQR----------------NE---------------LEALESIYPDSF............................
Q5A855_CANAL/1-106MTVEELT----------------DE---------------ISAIEAIYPESV............................
YCF9_SCHPO/1-111MTSAI.E----------------EE---------------REILESIYPEEF............................
Q6CDA6_YARLI/420-527ESLSIWN----------------EE---------------MEALEAIFEPER............................
Q7QK93_ANOGA/171-363ELDTLRA----------------DE---------------REALESIYDKLF............................
Q5RIL0_DANRE/1-124E.ADAQL----------------AE---------------IELLISMFPSEEELQVDEISH...............AELR
Q6FSE4_CANGA/10-125EYYEIQC----------------NE---------------LEAIKSIYMDDFEDR.........................
Q8MZ95_DROME/27-143YFRDLQE----------------NE---------------VRTMHYLGL...............................
Q4QCY6_LEIMA/5-109T..EMQE----------------ME---------------MEMVQGMYD..T............................
Q5PQ37_XENLA/4-135EDIEAQL----------------SE---------------LDLLSSMFPTEDEFVVTDQVAL..............AELR
Q7QBP1_ANOGA/4-115NHHEDQC----------------NE---------------IEALDSIYCGEL............................
Q7XSB8_ORYSJ/29-143GDQAALA----------------DE---------------LTALGSIFLEDF............................
Q750B2_ASHGO/2-157DYQEEQK----------------QE---------------LEVLESIYADDL............................
Q5AYM1_EMENI/6-166LPEDERS----------------EE---------------LSSIAAIFPEIKIDPSS.......................
Q7SXJ6_DANRE/2-114AAESDVL----------------SE---------------IEVLQSIYLDEL............................
Q7F9L6_ORYSA/43-178SNDQLQE----------------DE---------------MLALEAIYGDNISILSAK.....................D
Q4DGH6_TRYCC/4-108T..EMQS----------------ME---------------MDTVQSMYD..S............................
Q5CGP2_CRYHO/1-151MDD..LN----------------LE---------------LEALQAIYSDKE............................
Q75EM4_ASHGO/2-106ALNEEVA----------------EE---------------ISAVDAIYPGNL............................
RWD2A_MACFA/7-131ESLQLQL----------------LE---------------MEMLFSMFPNQGEVKLEDVN.................ALT
Q6CB97_YARLI/1-115M......----------------EE---------------LETLAAIYPELEYDTD........................
IMPCT_DANRE/10-115NNLQSQI----------------EE---------------IEALSSIYGEEW............................
Q5KE91_CRYNJ/3-101SAQEITD----------------CR---------------IE......................................
Q7PMA0_ANOGA/3-108EAKEMQD----------------DE---------------REALISIYEGDS............................
Q5ANG1_CANAL/15-141FSDDIRV----------------QE---------------LQSCKYIYPDCEIDLS........................
GCN2_SCHPO/9-124LCKEIQE----------------NE---------------IEALKAIFMDDFEEL.........................
Q7SCW3_NEUCR/1-116MGREEQI----------------EE---------------REVLDSIFPDEI............................
Q5DET7_SCHJA/1-111MSSEDCE----------------HE---------------LLALESIYEDKY............................
Q4KLB7_XENLA/4-134EDKEAQE----------------DE---------------LLALASIYPEDEFKRSE.......................
Q5DEU0_SCHJA/3-107VC.DLRE----------------EE---------------AQVLKSIFSEDE............................
Q55I55_CRYNB/4-118ANKALQE----------------EE---------------LESLRAIYPDEWHDIP........................
GIR2_YEAST/2-156DYKEEQK----------------QE---------------LEVLESIYPDEL............................
Q5M8G9_XENTR/55-165DCNESLQ----------------QE---------------LQVLESIYPDEL............................
Q9C8I1_ARATH/3-122EYKQEQE----------------ME---------------IEALEAILMDEFKEI.........................
GCN2_ARATH/30-145EDNELLS----------------EE---------------ITALSAIFQEDC............................
IFKC_DICDI/67-194QLKDQQD----------------ME---------------LEALQAIFNDEFITMDPIII.................NRN
O01712_DROME/9-127SFRERQA----------------QE---------------LEVIKSIFGCDVEDL.........................
Q55CB4_DICDI/4-208EDSYSQS----------------QE---------------LEVLKSIYGDDFFSQMEYYENDIHNHSNENYSSGCSGSED
Q6FMC2_CANGA/1-102M.DELVV----------------EE---------------LESLEAIYPDLL............................
O74297_NEUCS/43-157HYQEVQE----------------SE---------------VMVLQAIYGEDFTQH.........................
DHX57_HUMAN/243-419ECMEQRQ----------------EE---------------AFALKSICGEKF............................
Q6FPE1_CANGA/415-520ESKEMWI----------------QE---------------LESLKCIFEDKI............................
Q5AGV1_CANAL/2-149DPIEEQA----------------QE---------------IEVLQSIYPDEL............................
Q4CVK5_TRYCC/246-363SLDAACE----------------EE---------------IGLLTSMYGEEC............................
Q4TU20_ARATH/1-111MTEEEVA----------------ME---------------VEALEAVYSEDC............................
O18131_CAEEL/2-116SHQEQQE----------------QE---------------IEALEAIYSEEE............................
Q6CQJ5_KLULA/2-165DYKEEQT----------------QE---------------LEILESIYPDEF............................
Q4Y347_PLACH/2-106DYKSEQA----------------TE---------------KESLSLLYE..Y............................
RWDD4_RAT/2-108GANEDQE----------------ME---------------LEALRSIYEGDE............................
Q6IQ68_DANRE/3-126ADQEAKE----------------DE---------------LLALASIYDEEEFHRAG.......................
Q4XYA3_PLACH/66-179KCEELQK----------------QE---------------LEALKLIYVGDR............................
Q5DGN4_SCHJA/1-112MDNKVQE----------------E.---------------LDLLREIFPDEF............................
Q556K0_DICDI/1-107MSEE.KD----------------ME---------------VEALSAIYMDHF............................
DHX57_MOUSE/243-419ECVEQRQ----------------EE---------------TLALKSICGEKF............................
RWD2B_HUMAN/34-162EQAEAQL----------------AE---------------LDLLASMFPGENELIVNDQLAV..............AELK
Q4CLS7_TRYCC/23-139EVSDVIE----------------DE---------------IEFLKQNYD..G............................
Q55VL2_CRYNB/13-165QCESMQE----------------DE---------------LTVLESIYPGQIKIHPNPNN.................RPG

PF14457

Q21PA7_SACD2/14-175IHDVIRWL---------------DE---------------TRSVAGIQTVTS----------------------------
A0L5E1_MAGSM/13-169ALEQVADI---------------VA---------------ASNGTVELVQID----------------------------
Q4ZFT1_CLOPF/15-178NDDFTMFY---------------KG---------------LLECKNVKNITI----------------------------
A9BTW4_DELAS/5-166IADALHQL---------------QR---------------HRGLIRVGEPRT----------------------------
A1U5J0_MARAV/18-180HIQMLVAA---------------IL---------------QHQRSEDHQVTE----------------------------
Q3SNL9_NITWN/14-180AERFLAAA---------------LR---------------HPECRGGRLISV----------------------------
Q8PFM8_XANAC/22-182DGRMQALL---------------RA---------------CNAHADINVVEL----------------------------
A1U033_MARAV/19-179NLPEPLSD---------------LA---------------DACNDNSDFDIV----------------------------
A1VVG1_POLNA/24-184RAKTLFDV---------------VS---------------RQRDYAVVQLLQ----------------------------
A3U023_9RHOB/20-179LTSSAAAS---------------FA---------------RFVDRHAAELAA----------------------------
Q5HY19_GLUOX/8-170RSRLARSV---------------IE---------------YVCDSVEHPYAT----------------------------
Q3J4T6_RHOS4/6-183DEEIPDVL---------------HP---------------VTSLLRIGVGPV----------------------------

PF14462

A1VQ26_POLNA/187-309LPEADQ-----------------RY---------------LDSHGFTVEVV-----------------------------
Q6YRV0_SYNY3/5-127LPESDR-----------------QY---------------LANKDYTYEEI-----------------------------
Q8ZSK7_NOSS1/4-126LPSNDR-----------------QY---------------LENRGLPFEEV-----------------------------
Q1QNK3_NITHX/244-367LLPVDE-----------------RH---------------LDTMGLKWETV-----------------------------
A4JA91_BURVG/127-248VMEEDA-----------------EF---------------LNSKGYTWEAV-----------------------------

PF14460

Q3M1I7_ANAVT/44-224EREGKESKYKFLSPE.....AVEKAFTSK.TAAS.....GWLSSNTIWWG.........KNPEGEAIIQFYSPQKYQIQI
Q8ZSF1_NOSS1/44-224EREGKESKYKFLSPE.....AVEKAFTSK.TAAS.....GWLSSNTIWWG.........KNPEGEAIIQFYSPQKYQIQI
Q5NXB4_AROAE/51-225TVDGLRKMFDSLDPS....RSARPVFLEP.NVLS......QGPGWLVWWM...........KPQTRRVWFES........
B3ZY45_BACCE/33-211TFKDFYLALKEVMEQGTQDNTHYSSGVLPKGCIKHEVLSKSGDKQAVWIE..........VPKAQWDIHFFE........
Q8A4F1_BACTN/53-225TYEFMNSLVESYTES....MSGIPHGRIPGNMLLC..DSRKGRERYIWYN...........PPQKRKMYFQD........
Q11ZD1_POLSJ/54-242TLTSKNLKLLAQQAQQ...GLKQDFEVIPANVLV......ANDSLLAWWM...........PKGTQLMSFDVSMHELAGK
Q21Q52_RHOFD/56-227KKDSLMAALRQLARQQ...GISDLVWVDD.QTIA......TSSTLQVWWT...........PAQSRWMHFQS........
Q120V4_POLSJ/57-235TEADYLAMVKVLAPQQ....RPQMEWQDH.CILA......KGMGKMIWWT...........PPMNRAMFFKKS...DMFG
A1VVA0_POLNA/62-240TQSDLNELVTGLSQSQ...SLSVPSWIDT.TMLA......LGAGRMIWYT...........PACQRAMFFKTS....SFT
Q8XYU7_RALSO/54-226SLGELSEFVEAAQTA.....TAYRGFIEP.HVLY......LAPNTVAWWR...........PAAPRTVWFSAE.......
Q5NUW6_RALME/54-226NRMALIHAVRQVAANA....LPKGEFLTP.NVLS......ISATTVTWWC...........PAASRRVFFKCE.......
Q7WX34_CUPNH/54-226NRMALIHAVREVAEAS....LPNGEFLTP.NVLS......ISPTAVTWWC...........PAAQRRVFFDCK.......
A4JUM7_BURVG/54-227DRKVLVQTLQQLAEHV....APRAEFLPA.TVLG......VSPEAVTWWC...........PPAMRRVFFECE.......
Q47D10_DECAR/55-233TPRAAMDLAKALLKR.....AAHGGFLPE.TVLY......MDGDLIVWWM...........PPARRHIAFRVD.AEQAEA
A0R7U7_PELPD/52-228DVEMLGTLINALGRN.....VSIGGYLPP.NILS......VGFDSMVWWV...........KPSKRRVFFKTN......E
C3IV16_BACTU/30-216NTLFEFVQKNCYETKTNTKKLDIPVFETP.A.........LPPGTVKYMALPDGKI.....VLFMEKKEFKHNL......
C3IUY7_BACTU/30-236NTNIETIQQIFMKEQA......METPLLP...........SQWGVVKYYRKNHYEGYVLTTPPTERVVKFDIG......R

PF14459

Y4JF_RHISN/38-168AFDDQAASCAEGQATLDLAVRLLAR---------------LYPVLAILPLDS----------------------------
Q98A20_RHILO/38-168AFDDQAASCAEGQATLDLAVRLLAR---------------LYPVLAILPLGS----------------------------
Q8KGV9_RHILI/4-134AFDDQAASCAEGQATLDLAVRLLAR---------------LYPVLAILPLGS----------------------------
Q2K2A4_RHIEC/38-168AFDEQACA.TEGRASLDLLVRLVAR---------------LYPTICLLPSGE----------------------------

PF00179

UBC21_CAEEL/25-161---...N.....NLMDIKGFI-----------------------------------------------------KGP.EG
UBC35_ARATH/9-141---...D.....NMRYFNVMI-----------------------------------------------------LGP.TQ
UBC24_ARATH/678-815---...E.....RMDLLRAAL-----------------------------------------------------VGA.PG
UBC2_NEUCR/8-145---...D.....NVMTWNAVI-----------------------------------------------------IGP.AD
UB2L6_HUMAN/6-144---...D....ANVLVWHALL-----------------------------------------------------LP..DQ
UB2G1_RAT/9-161---...D....NDLYRWEVLI-----------------------------------------------------IGP.PD
UBE2K_MOUSE/8-147---...E.....NFTELRGEI-----------------------------------------------------AGP.PD
UBCX_YEAST/21-174---..LNPIDETDLSKWEAII-----------------------------------------------------SGP.SD
UBC1_SCHPO/8-144---...D.....DISHLKGMF-----------------------------------------------------RGP.EG
UBC12_YEAST/31-172---..DSA.DRSQSPKLEVIV-----------------------------------------------------RP..DE
O48838_ARATH/33-171---...WLPSPENIFRWEATV-----------------------------------------------------NGP.VG
UBC13_SCHPO/6-141---...D.....NLRYFKITM-----------------------------------------------------EGP.QQ
Q9VH01_DROME/4536-4692---CDTD.....RLDIMKVLI-----------------------------------------------------TGP.AD
UBC14_SCHPO/11-149---...D.....NLFHWACTA-----------------------------------------------------LGP.SD
Q9VZ73_DROME/14-153---...P....NNIYKWTGLL-----------------------------------------------------MP..VA
Q9VJS5_DROME/7-142---...C.....NARYFHVLV-----------------------------------------------------TGP.KD
UBC84_DROME/6-144---...D....ESLLMWTGLL-----------------------------------------------------VP..EK
UBC15_SCHPO/9-160---...D....KSIFEWEVMI-----------------------------------------------------IGP.ED
UBC9_CAEEL/8-152---...NADGTLNLFNWECAI-----------------------------------------------------PGR.KD
UBC34_ARATH/9-146---..VARPSPNDILEWHYVL-----------------------------------------------------EGS.EG
Q43780_SOLLC/6-143---...D.....SLTHLIGTI-----------------------------------------------------PGP.VG
UBC2_MEDSA/8-145---...N.....NIMLWNAVI-----------------------------------------------------FGP.DD
UBC2_YEAST/8-145---...D.....NVMVWNAMI-----------------------------------------------------IGP.AD
UBCX_PICAN/7-177---..LHP.LEDGLFRWSAVI-----------------------------------------------------RGP.DQ
UBC12_DROME/30-165---....P.DPNDLLNFKLII-----------------------------------------------------SP..DE
UB2G2_MOUSE/8-159---...E....ENFFEWEALI-----------------------------------------------------MGP.ED
Q95039_PARTE/244-382---...D.....DIKTWKILL-----------------------------------------------------YGP.KG
UB2J2_MOUSE/16-153---..CAEPLPSNILEWHYVV-----------------------------------------------------RGP.EM
UB2L3_MOUSE/6-144---...E....ANLLTWQGLI-----------------------------------------------------VP..DN
UBE2C_DROME/36-172---...E.....NIFKWVGTI-----------------------------------------------------AGP.RN
AKTIP_MOUSE/72-217---........RSALVWFGVI-----------------------------------------------------FI..RH
UBC3_YEAST/11-164---...D....SNIFTWNIGV-----------------------------------------------------MVLNED
UBE2C_SPISO/34-170---...D.....NLFKWVATL-----------------------------------------------------DGP.KD
Q9VGD6_DROME/17-152---.........DMTNLNVCL-----------------------------------------------------EGP.LG
Q9XZ32_DROME/1125-1274---.........RMDLMSVMM-----------------------------------------------------VGP.KR
UBC9_YEAST/8-152---...KADGSMDLQKWEAGI-----------------------------------------------------PGK.EG
Q9TZ69_CAEEL/8-147---...E.....NLTEIKGHI-----------------------------------------------------RGP.PD
UBCD2_DROME/90-225---...D.....NLYEWVSTI-----------------------------------------------------LGP.PG
UBC12_MOUSE/33-168---....S.DPDDLLNFKLVI-----------------------------------------------------CP..DE
Q20617_CAEEL/17-156---...E....KCKDIFQFKI-----------------------------------------------------IG..DG
UBC12_SCHPO/27-162---....P.DPIKLNVLHLEI-----------------------------------------------------RP..DE
SCE1_ARATH/9-153---...GQDGTVNLMVWHCTI-----------------------------------------------------PGK.AG
UBC9_MESAU/8-152---...NPDGTMNLMNWECAI-----------------------------------------------------PGK.KG
UBC7_YEAST/8-159---...E....NNIFIWDCLI-----------------------------------------------------QGP.PD
UBCD4_DROME/8-147---...D.....SWTELRGEI-----------------------------------------------------AGP.PD
Q9VYN3_DROME/66-201---...G.....DLLHWTAGV-----------------------------------------------------NGP.VG
Q20872_CAEEL/39-180---..EG...ADIWCSWICTV-----------------------------------------------------PGP.RG
UBC7_SCHPO/9-160---...E....DDFFTWDCLI-----------------------------------------------------QGP.DG
UB12L_ARATH/35-171---....PNGKNDLMNFEVTI-----------------------------------------------------KP..DE
UBC8_YEAST/7-143---...D.....SMQEFHVKF-----------------------------------------------------LGP.KD
UBE2S_HUMAN/15-152---...E.....DLTDLQVTI-----------------------------------------------------EGP.EG
Q9Y165_DROME/341-479---...R.....QNNYWQATI-----------------------------------------------------LGP.PG
UBCB_DICDI/6-141---...D.....NLQKWKATV-----------------------------------------------------QGP.EG
UBE2A_MOUSE/8-145---...N.....NIMVWNAVI-----------------------------------------------------FGP.EG
UBC11_YEAST/12-150---...D....NDLTYWVGYI-----------------------------------------------------TGP.KD
UBC9_SCHPO/8-152---...SSDGGLDLMNWKVGI-----------------------------------------------------PGK.PK
UBC5_ARATH/7-143---...D.....GMQEFFVEF-----------------------------------------------------SGP.KD
Q9U1Q1_CAEEL/8-159---...E....DNFFEWECLI-----------------------------------------------------TGP.EE
UBC13_ARATH/8-159---...E....KNIFEWSVTI-----------------------------------------------------IGP.PD
Q9XWF6_CAEEL/8-149---..SN.....DLKQWKIGV-----------------------------------------------------VGA.EG
Q6AWG5_DROME/66-223---...D....DNLFEWEVAI-----------------------------------------------------FGP.PD
UBC7_WHEAT/11-161---...D....SNVFEWQVTI-----------------------------------------------------IGP.PE
Q9VFR8_DROME/9-160---...D....SDIFKWEVVI-----------------------------------------------------IGP.PD
Q9U5Q3_9CILI/34-174---...D.....DIMIWDCII-----------------------------------------------------FGP.EN
Q9VQ00_DROME/25-160---...D.....NLYEWTSTI-----------------------------------------------------IGP.AD
UBC11_SCHPO/32-170---...D....SNLLHWAGTI-----------------------------------------------------TGP.SD
UBC17_ARATH/19-158---.........NLQRWIIEV-----------------------------------------------------HGV.PG
UBE2C_HUMAN/34-170---...D.....NLFKWVGTI-----------------------------------------------------HGA.AG
UBE2H_MOUSE/10-145---.........GLNEFVVKF-----------------------------------------------------YGP.QG
UBC6_ARATH/7-143---...D.....DLQMFYVTF-----------------------------------------------------HGP.TD
UBC15_ARATH/19-158---.........NLQKWTIDV-----------------------------------------------------TGA.PG

PF14461

Q4FRY8_PSYA2/12-152-----------SFFDSIPTTR-----------------------------------------------------PIYVKD
A5G3M9_GEOUR/17-151-----------DRFVCRSYKL-----------------------------------------------------VIEL..
Q2K8Q4_RHIEC/18-161-----------DRWEIHDYKF-----------------------------------------------------AAIGSI
Q8KW20_9RHOB/16-149-----------PQFGKNADGL-----------------------------------------------------LTWSFV
D3GMN6_9ENTR/13-154-----------SILHSRERGA-----------------------------------------------------GYYTKE
A0L3D6_SHESA/1-142-----------QGFNCTTSEV-----------------------------------------------------AGGERI
A3W6V2_9RHOB/1-135-----------HGFTLVPGSG-----------------------------------------------------RDRYQG
Q2NBP1_ERYLH/4-143-----------KGFTEQQGAS-----------------------------------------------------PEFRGS
Q2L5J8_CLOPF/12-145-----------NDNFEVNYSK-----------------------------------------------------IYEFTL
A0AW81_ARTS2/19-154-----------DETKRDDHQT-----------------------------------------------------LTMELS
A3TSK9_9RHOB/18-157-----------ARWTLHHGLV-----------------------------------------------------CVEGEI
A3GXG6_VIBCL/12-153-----------ILLDTKSRRK-----------------------------------------------------GYYVKE
E0TAZ7_PARBH/17-149-----------SDLQAYNGKK-----------------------------------------------------VDRGWR
Y4OA_RHISN/9-149-----------RELAAYEGHG-----------------------------------------------------ASHRPL
Y4QC_RHISN/29-153-----------DEEAAAAGIL-----------------------------------------------------RIEFSW

PF05743

Q7Q6B6_ANOGA/22-142------NDGSTKMLLNLHGTI-----------------------------------------------------PVKYKG
UEVLD_HUMAN/21-141------KDSSQKDLLNFTGTI-----------------------------------------------------PVMYQG
Q6FS29_CANGA/27-147------EDGSPRLLLCLYGGI-----------------------------------------------------PIEQG.
Q4SDZ6_TETNG/21-141------TDSTQKDLLKLIGNL-----------------------------------------------------PVQYEG
Q4TA00_TETNG/24-145------PNKEKKQLVYLAGTV-----------------------------------------------------PVLYEG
UEVLD_XENTR/21-141------RDGSQKDLLNLTGTV-----------------------------------------------------PMKHQG
Q5KKQ1_CRYNJ/24-146------DSGHTALLLLLHGTL-----------------------------------------------------PVTYRG
TS101_RAT/21-141------NDGSSRELVNLTGTI-----------------------------------------------------PVRYRG
Q5BAA9_EMENI/33-155------ENGFSALLLQLSGTL-----------------------------------------------------PVTFRG
Q75EU1_ASHGO/32-146------EAGRSKLLLCLYGKV-----------------------------------------------------......
STP22_YEAST/31-162------SDGTPQLLLSIYGTI-----------------------------------------------------STGEDG
Q4UHS4_THEAN/19-133------STSFDCHRLNISGTV-----------------------------------------------------PYTFSG
O76258_CAEEL/21-141------PDGKRRTAFRLKGTI-----------------------------------------------------PVYYKG
Q9VVA7_DROME/22-142------NDGSSKELFTIQGTI-----------------------------------------------------PVVYKN
TS101_DICDI/47-167------NIPNRVNLICIKGTI-----------------------------------------------------PICFKG
P78998_SACPS/31-154------SDGSPQLLLSIYGTV-----------------------------------------------------G.....
Q4PAN2_USTMA/23-145------NDGRTQLLISLDGTI-----------------------------------------------------PVEFRN
UEVLD_DANRE/21-141------SDSLQKDLLKLVGNI-----------------------------------------------------PVVYQG
Q6ESB7_ORYSJ/45-167------NDGRAAHLLQADGTI-----------------------------------------------------PIHHAG
ELC_ARATH/37-158------NDGRSVNLLQADGTI-----------------------------------------------------PMPFHG
Q59WF8_CANAL/24-164------GSGEPNLLINLFGTI-----------------------------------------------------QINEQ.
Q4N7T6_THEPA/34-148------STSFDGHRLNIVGLV-----------------------------------------------------PYTFSG
Q4SAD8_TETNG/22-142------NDGSSRDLMSLTGTI-----------------------------------------------------PISYRG

PF08694

UFC1_ARATH/6-167---IAYTQMNKSNDNDWFRIS-----------------------------------------------------ASNPEG
UFC1_AEDAE/4-164---IKYVQNNKSSDSDWFRLE-----------------------------------------------------.SNKEG
A0DET8_PARTE/1-156---INYIKNNKSEDNDWVKLE-----------------------------------------------------PANKEC
UFC1_RAT/4-164---IRYVENNKNADNDWFRLE-----------------------------------------------------.SNKEG
Q4N8N9_THEPA/4-172---IQYVEENKQNNTEWFTLD-----------------------------------------------------.CNDNG
Q4DHG1_TRYCC/3-163---IKYVENNKASDNHWFQLE-----------------------------------------------------.SNEAG
Q5DBD5_SCHJA/4-164---IKYVENNKLADNDWFRIE-----------------------------------------------------.SNQSG
Q22BA5_TETTS/2-180---IKYIELNKQQDNDWIKIA-----------------------------------------------------.SDKEG
UFC1_DICDI/3-163---IKYVEINKKADNDWFNIE-----------------------------------------------------.SNPLG

PF05773

Q4WEH2_ASPFU/8-134.....TVHFSATSASAATANSTLNLGSSG.......................................PGDSLNTTVKLQ
Q4WU06_ASPFU/41-154.....EEIEHRPSAWQQSADVAF..................................................KLHLRAS
Q757B9_ASHGO/407-512........EVIDRDSCYMIDI...........................................................
RNF25_HUMAN/11-125....VIKGNGRTSPWEIYITLHP...................................................ATAEDQ
Q4WZQ4_ASPFU/386-489.........KRLSSKVCEIKS...........................................................
Q4WQA1_ASPFU/1-121.........TDISDTAYRISINLET..............................................PENDARGEE
Q4WDC1_ASPFU/6-159.PFKASLDIPVKPSTPLPVCFEQQLDAGFPEVLTPPTS.....................LDASDVELGFATKDDGRDVHT
E2AK4_HUMAN/18-134...RPDACGPVKEPPEINLVL.Y...................................................PQGLTG
IMPCT_XENLA/7-113.......CVIDEAERIFCITI.......................................................SDSS
Q6BMK3_DEBHA/392-504......HYIENSQNRIVTISL.......................................................NSKN
Q6BNZ6_DEBHA/2-136.........TKYSPTHFSIKL......................................................SLDTP
Q6BX55_DEBHA/1-103.........SEVAPQVYNLKI...........................................................
Q6BWT3_DEBHA/17-158.NLTGSAIIPIRLEKDIEIILHDGNLLVSDKQV..............................QIDSATEITDRHVRKDK
IMPCT_CAEEL/2-99.........EETTDKQLVFKF...........................................................
Q640E2_XENLA/7-130YIRRYLEGIRESLPPVIEFSV.......................................................FLNI
Q5ADM3_CANAL/405-504........PVKHEKNVATIKL...........................................................
Q59S39_CANAL/9-125..TPTGLVWNKKPSPHFQVFLS.....................................................SSNNP
Q6YUR1_ORYSJ/47-192GLRFFQISLHYQLAGDIRVYLNVCPNGRTETGA...............................ENDDDDDSDRLLYACS
YL419_YEAST/423-528........MDAKEDSHYTLNL...........................................................
Q5AU57_EMENI/6-130.....TISKTSTSCGTSTLDLGASSSSA.........................................PTTGETVIKLQ
RWDD3_PONAB/1-111.....WEVLSRSETDGTVFRIH....................................................TKAEGF
Q3ZAU6_RAT/4-134SVQGGETRIYLDLPQNFKIFVSGNSNE...........................................CLQNSGFEYT
Q4PDS7_USTMA/6-155.........ETVSSEHLRIRIEPEEDVLPLLFS...............................IGLEPGQAPTESVEQG
Q20871_CAEEL/2-135AEIQGIIEVGFDNLYDPTVTIEGTS..............................................DSGDQFHLP
IMPCT_DICDI/1-152EENDGFEDNDSQYSKIYQVIITPNISCLDENSLEDNN.......................NSNNNNNNNNNNNNNGLIID
Q55GT9_DICDI/415-519.........IEFSSNNQHIIY.........................................................NG
Q4CY49_TRYCC/190-316......LGVKQIDEKEFEGREM.....................................................YFSFS
Q4P4B8_USTMA/14-135..QKAWKGAAVSQLHEFQVVIR.....................................................PDEER
RWDD3_DANRE/1-109.....FEVLEESPEKGVVFRV......................................................HTLID
Q75F11_ASHGO/10-125..TQRKASWDKKPQRVFEISL......................................................RSIEK
Q9VZ55_DROME/176-361......EEREANRVWNLKFRIDH...................................................LLAHSP
A8X836_CAEBR/4-137AEIEGTIEVGFDSISDPKVTLTGTS..............................................ESGDEFSVS
Q9XVY4_CAEEL/15-135....IKAHWHVWVPTNCHILLKALD..............................................SCFLNGDPL
Q86I15_DICDI/66-198LCLSFDLPADRIGLSSFTTKLLEN................................................ENFEDYCT
Q4RFR0_TETNG/5-135ASVEGTAATDPPPRSRPQFLIK....................................................QKLDAE
Q9LQM5_ARATH/184-320DMRYFQVHVNVEATSEYTISTKLNLQADS.......................................SKESEDFLYSFK
Q6FVK3_CANGA/2-158......EVVKEYPGVKFELQLKLEL...............................................QELIDTSH
Q6CTZ2_KLULA/2-106.........TVVNNDRIKIKV...........................................................
Q5JKR6_ORYSJ/3-122...DPSESGLSTTARCFQIVLSPQ.................................................DDDFDES
Q7X7C1_ORYSA/108-233.VCAKLSSANEKNPKDGRCCVGIEGHG..........................................DEPEDFSYTCN
Q8IDE3_PLAF7/67-179.....ELNIKYENDEDKLTIVEI...................................................NLNDQN
Q4SZQ6_TETNG/2-108.......CFKEISPTSFQFRI.........................................................GE
YIH1_SCHPO/2-94.......LPISEQSFTYTLSI...........................................................
Q4RIS5_TETNG/2-125SAQGGEIQLCLELPADFKIVVKG..................................................HTQTEYN
Q6CDD7_YARLI/1-89.........KEIGPRRYTLSI...........................................................
Q5BB34_EMENI/40-153..QQRRSAWHRSSEVSFRLHL........................................................RAP
Q9VJ60_DROME/3-109.......NFKEIDSVTFQYKY.........................................................GE
Q7S2B9_NEUCR/1-108.....LSPSDDDSPATYILTL...........................................................
Q7Q0B4_ANOGA/9-123....LRPRTGKWKPLELRLHLT....................................................PQRGSA
Q4STD1_TETNG/1-114PNGGGEIRVHAELPAGFSVAIKEG.................................................EILSQYE
Q4D6B4_TRYCC/5-103.....CRDPTHSSTLVFLLPF...........................................................
Q95RT3_DROME/4-116......EILATEPHYKFQIPIAT..................................................EEYSSEE
ITT1_SCHPO/9-132..NYGRLNIPVNTESDYFLSFKSPD..............................................ESTLTDTIV
Q6CTQ8_KLULA/10-125..TKRHSSWDKHPQIIFEIGL......................................................RSQES
Q8X0V7_NEUCS/437-541.........SKISPEICEIKLE.....................................................GVKNG
IMPCT_MOUSE/7-113.......CVIDENAKIFCIRV.......................................................TDFM
Q4RHJ9_TETNG/221-397......SERIANAVWTVNLDLSF...................................................LSGSAA
Q4RLP9_TETNG/13-130...RNKDPWKVKRPPEVYLCLRP...................................................NGLNNG
Q6C972_YARLI/2-130.........TVLDPSTYTIDI.......................................................GLDV
Q9C2M7_NEUCS/8-183DPYAIAIDIPVNPSKPVLVYFPAAADSNPDPRAQGTLQQNGASHVNGSASGGPLNGTDRVGGAGSAEGAGAGAGALDRHE
Q6CS85_KLULA/412-516.........EQLNASSYKINL...........................................................
Q8T6F6_DROPS/41-151......PYVVLARRPRLRVKVPL...................................................STINYE
Q3ZC53_BOVIN/3-111.......TVLSENPPSFTITVT.....................................................SEAGE
Q5A855_CANAL/1-106.........TNLGPQLYTFKI...........................................................
YCF9_SCHPO/1-111.........KCINDSTFEITQPI...................................................DREESN
Q6CDA6_YARLI/420-527.........LSVADDRISVSL........................................................NCR
Q7QK93_ANOGA/171-363......VEKEHNRVWQLKFKIDH...................................................LLTHSP
Q5RIL0_DANRE/1-124AYVEGSAHTPPTSRPQFSIMV.........................................................KV
Q6FSE4_CANGA/10-125..TRKKSKWDKQPQIQFDISL......................................................RSMDK
Q8MZ95_DROME/27-143......AYVVLSRRPNLQLKVPL...................................................STQNYE
Q4QCY6_LEIMA/5-109......YERLSDDPPSYCVSL........................................................AAT
Q5PQ37_XENLA/4-135DYAEKRAASAPSSKIQFTVNVKL...................................................EESNTG
Q7QBP1_ANOGA/4-115.......EVLETEPHKFRLPIAT..................................................TEYDPEV
Q7XSB8_ORYSJ/29-143......KVTSESPQTRFTICIRP..................................................YSDGMGF
Q750B2_ASHGO/2-157.....TVVCGEYPKIQFEVDLKLDLIP...........................................LASSSFTAAA
Q5AYM1_EMENI/6-166.PYRASLDIPVKPATPLNVCFYQRPEVGFPSVLTPPTSLDA..............SEVGLGSKAKLDDQSMADTEKDVHV
Q7SXJ6_DANRE/2-114.......NVTQNDEGGWTVSLVLH.................................................PSTAEDC
Q7F9L6_ORYSA/43-178GLRCFQVHVHCEIPDGISVSAELSRDDN........................................RDQNSRFFDTFS
Q4DGH6_TRYCC/4-108......YELISVDPPTYSVLL........................................................TAT
Q5CGP2_CRYHO/1-151.....LSIETKENCQIINIQLIKEANY...........................................EINPISEKNE
Q75EM4_ASHGO/2-106.........SRLSENRVLIRI...........................................................
RWD2A_MACFA/7-131NIKRYLEGTREALPPKIEFVI.......................................................TLQI
Q6CB97_YARLI/1-115.TLSGSLEITASFEEPVKVVFGD...................................................ADTQHE
IMPCT_DANRE/10-115.......CVIDEAARVFCIRI........................................................SET
Q5KE91_CRYNJ/3-101...........INDTSLSIRIE.....................................................PEEPN
Q7PMA0_ANOGA/3-108.......AFKQVNSETYQYKY..........................................................G
Q5ANG1_CANAL/15-141.SLSGTVNIKVKSDNDITIRLIERTS............................................KGTRIIATNK
GCN2_SCHPO/9-124...KVRNAWNVTNGHVYCIHLC.....................................................SRSAN
Q7SCW3_NEUCR/1-116.........QDISDTEYRITITL...................................................DIPDDD
Q5DET7_SCHJA/1-111......QLVQSTPKRKIKVYLV....................................................GQSDDS
Q4KLB7_XENLA/4-134TAPGGEICICLDLPPNFNVAIKGDSAS...........................................NEYIGSFEGI
Q5DEU0_SCHJA/3-107........LTISGDYNLEYKV.........................................................GE
Q55I55_CRYNB/4-118..PTKTAWGTEVDAGWWEVKI........................................................CAM
GIR2_YEAST/2-156.....RIINDEYPKIKFEVAIKLEL...............................................DTGDSTSV
Q5M8G9_XENTR/55-165.......QICRGERVVLSITLHP...................................................ATGHDE
Q9C8I1_ARATH/3-122...HSSESGLNTSNRCFQITVTPQ.................................................DDELEEL
GCN2_ARATH/30-145.....KVVSDSRSPPQIAIKLRP..................................................YSKDMGY
IFKC_DICDI/67-194MDTIIEGIKPIRESARFRITIK....................................................PYVGDD
O01712_DROME/9-127...RPQANPSLWKPTDIRIQLTP..................................................LRDSSNG
Q55CB4_DICDI/4-208EDLEDKHSQNKTSTTTTTTTTTTTT..............................................TTTTTTTTT
Q6FMC2_CANGA/1-102........KRDDAENIFAMKV...........................................................
O74297_NEUCS/43-157...EAAHGAWQKSEPRFDIKI........................................................KPS
DHX57_HUMAN/243-419......IERIQNRVWTIGLELEY...................................................LTSRFR
Q6FPE1_CANGA/415-520........EVIDEPNCYVISL...........................................................
Q5AGV1_CANAL/2-149.........TLINNTHFIIRI......................................................DLDTP
Q4CVK5_TRYCC/246-363......VQRNKTPVVFLPLLLDG...................................................VSDEAS
Q4TU20_ARATH/1-111.......VILDSYPPHLHLHIKP...................................................RTAEIS
O18131_CAEEL/2-116......IHVASRDYPNIELSIQLK.................................................SNQYEDP
Q6CQJ5_KLULA/2-165.....TVLNSEYPEIELQIDIKLDPVP...........................................LDDSSYTVDS
Q4Y347_PLACH/2-106.....TNEFININDNSFKILI.........................................................DN
RWDD4_RAT/2-108.......SFRELSPVSFQYRI.........................................................GE
Q6IQ68_DANRE/3-126SAKEGEIHLCLELPPNFKLLVKG..................................................QKSAEHN
Q4XYA3_PLACH/66-179.....ELIIKNEQNKERDTIIYM...................................................ELNDEN
Q5DGN4_SCHJA/1-112......KVNFNLNQYVVTFVVTP..................................................GIGFNNP
Q556K0_DICDI/1-107.........NSIDSDHVQITLL....................................................PNPGGD
DHX57_MOUSE/243-419........IERIQNRVWTIGL......................................................ELDYL
RWD2B_HUMAN/34-162DCIEKKTMEGRSSKVYFTINM......................................................NLDVS
Q4CLS7_TRYCC/23-139......IEVVKLEGFYPKVLL......................................................TLEAE
Q55VL2_CRYNB/13-165RILTLTLPVKLSSPTKVSISTASNN..............................................GESSIPSLT

PF14457

Q21PA7_SACD2/14-175------SDDGVVVATNWRVDLPIRFE------------------------------------------------SEGETE
A0L5E1_MAGSM/13-169------PPTSEGDTLLLRVSIDTSDY------------------------------------------------TFQKGG
Q4ZFT1_CLOPF/15-178------YKLNINSVIIRLELKINLPS------------------------------------------------RRSLME
A9BTW4_DELAS/5-166------TGASTEIEVDVAVQLPNRSR------------------------------------------------RNGISE
A1U5J0_MARAV/18-180------RENELVLDVSWRVQLSSRDV------------------------------------------------EVGQSG
Q3SNL9_NITWN/14-180------DAGGSRIELDLNVEMPLAFK------------------------------------------------VDGASP
Q8PFM8_XANAC/22-182------RRIEDPFIAEIIVADVGDGA------------------------------------------------VSPGND
A1U033_MARAV/19-179------EFRRISKDSYALVVDAGDGT------------------------------------------------FDAENP
A1VVG1_POLNA/24-184------HCDDGTPKLECIVVEVECDG------------------------------------------------VPPKNG
A3U023_9RHOB/20-179------IVALRRGGAGELVELAFRTG------------------------------------------------RPQQSV
Q5HY19_GLUOX/8-170------IQEFQSDGLSDIVDLELEID------------------------------------------------LAQDRA
Q3J4T6_RHOS4/6-183------TALEGWKEWRRGFFSLPLVA------------------------------------------------RVTISP

PF14462

A1VQ26_POLNA/187-309------SDGPHTGVVLKQMQL-----------------------------------------------------PQGKFN
Q6YRV0_SYNY3/5-127------TEGSRKGLIFSKFPL-----------------------------------------------------PNQKYD
Q8ZSK7_NOSS1/4-126------VDASQKGVILREFQL-----------------------------------------------------PLGRFD
Q1QNK3_NITHX/244-367------VDGGRRWLLIEGYPV-----------------------------------------------------PEG.YN
A4JA91_BURVG/127-248------ASDAKR.IVVRGFEP-----------------------------------------------------PQG.FA

PF14460

Q3M1I7_ANAVT/44-224MGQEPEVITVPMPAFLFAGCSS..--------------------------------------------------......
Q8ZSF1_NOSS1/44-224MGQETEVITVPMPAFLFAGCGS..--------------------------------------------------......
Q5NXB4_AROAE/51-225KEIKLETAEVPHPGLVFAVTQE..--------------------------------------------------......
B3ZY45_BACCE/33-211....RPFQQVGFPRLLFRYTVYQK--------------------------------------------------RVT...
Q8A4F1_BACTN/53-225.GLHITDGTFNVPGVIYVVERE..--------------------------------------------------......
Q11ZD1_POLSJ/54-242SRLQGVSGNVPTPALVFAMMRNRN--------------------------------------------------AGGAFE
Q21Q52_RHOFD/56-227.QGLQLSLPAQNPPLVWLACGE..--------------------------------------------------......
Q120V4_POLSJ/57-235ATTFSGQGICPLPGMVWMSDGR..--------------------------------------------------......
A1VVA0_POLNA/62-240KDTFEAQGQLPTPGLVWLVMQG..--------------------------------------------------......
Q8XYU7_RALSO/54-226KPIGTRHGVTAHPPLVFIVHER..--------------------------------------------------......
Q5NUW6_RALME/54-226.EFGERNAIVAHPALVFQASHS..--------------------------------------------------......
Q7WX34_CUPNH/54-226.EFGKRSAVVPHPALVFQASQS..--------------------------------------------------......
A4JUM7_BURVG/54-227.NLGKRSAVVPHPGLVFQALNQ..--------------------------------------------------......
Q47D10_DECAR/55-233FGGQERGESVPHPGLVFAASSR..--------------------------------------------------......
A0R7U7_PELPD/52-228EIIGERSEVVPHPGLVFGVNGSG.--------------------------------------------------......
C3IV16_BACTU/30-216TYHSTKYKQIPFPNLLFVFVFRPN--------------------------------------------------GDKYIL
C3IUY7_BACTU/30-236SSELPTEVTLPIPPMLWVFEVMTD--------------------------------------------------QSGKKK

PF14459

Y4JF_RHISN/38-168-----ASSFQAQALERLAKSI------------------------------------------------------NPKIG
Q98A20_RHILO/38-168-----AASFQAQALERLAKSI------------------------------------------------------NPKVG
Q8KGV9_RHILI/4-134-----AASSQAQALERLAKSI------------------------------------------------------NPKVG
Q2K2A4_RHIEC/38-168-----EAKKLAKNLASLARSI------------------------------------------------------NEDIT

PF00179

UBC21_CAEEL/25-161TP-Y-------------AGG------------------------------------------------------------
UBC35_ARATH/9-141SP-Y-------------EGG------------------------------------------------------------
UBC24_ARATH/678-815TP-Y-------------HDG------------------------------------------------------------
UBC2_NEUCR/8-145TP-F-------------EDG------------------------------------------------------------
UB2L6_HUMAN/6-144PP-Y-------------HLK------------------------------------------------------------
UB2G1_RAT/9-161TL-Y-------------EGG------------------------------------------------------------
UBE2K_MOUSE/8-147TP-Y-------------EGG------------------------------------------------------------
UBCX_YEAST/21-174TP-Y-------------ENH------------------------------------------------------------
UBC1_SCHPO/8-144TP-Y-------------EGG------------------------------------------------------------
UBC12_YEAST/31-172GY-Y-------------NYG------------------------------------------------------------
O48838_ARATH/33-171CP-Y-------------EKG------------------------------------------------------------
UBC13_SCHPO/6-141SA-Y-------------EGG------------------------------------------------------------
Q9VH01_DROME/4536-4692TP-Y-------------ANG------------------------------------------------------------
UBC14_SCHPO/11-149SV-Y-------------AGG------------------------------------------------------------
Q9VZ73_DROME/14-153PP-Y-------------DKG------------------------------------------------------------
Q9VJS5_DROME/7-142SP-F-------------EGG------------------------------------------------------------
UBC84_DROME/6-144AP-Y-------------NKG------------------------------------------------------------
UBC15_SCHPO/9-160TL-Y-------------EGG------------------------------------------------------------
UBC9_CAEEL/8-152TI-W-------------EGG------------------------------------------------------------
UBC34_ARATH/9-146TP-F-------------AGG------------------------------------------------------------
Q43780_SOLLC/6-143TP-Y-------------EGG------------------------------------------------------------
UBC2_MEDSA/8-145TP-W-------------DGG------------------------------------------------------------
UBC2_YEAST/8-145TP-Y-------------EDG------------------------------------------------------------
UBCX_PICAN/7-177SP-F-------------EDA------------------------------------------------------------
UBC12_DROME/30-165GF-Y-------------RDG------------------------------------------------------------
UB2G2_MOUSE/8-159TC-F-------------EFG------------------------------------------------------------
Q95039_PARTE/244-382TV-Y-------------EGG------------------------------------------------------------
UB2J2_MOUSE/16-153TP-Y-------------EGG------------------------------------------------------------
UB2L3_MOUSE/6-144PP-Y-------------DKG------------------------------------------------------------
UBE2C_DROME/36-172TV-Y-------------SGQ------------------------------------------------------------
AKTIP_MOUSE/72-217GL-Y-------------QDG------------------------------------------------------------
UBC3_YEAST/11-164SI-Y-------------HGG------------------------------------------------------------
UBE2C_SPISO/34-170TV-Y-------------ESL------------------------------------------------------------
Q9VGD6_DROME/17-152SA-Y-------------EGG------------------------------------------------------------
Q9XZ32_DROME/1125-1274TP-Y-------------QNA------------------------------------------------------------
UBC9_YEAST/8-152TN-W-------------AGG------------------------------------------------------------
Q9TZ69_CAEEL/8-147TP-Y-------------AGG------------------------------------------------------------
UBCD2_DROME/90-225SV-Y-------------EGG------------------------------------------------------------
UBC12_MOUSE/33-168GF-Y-------------KSG------------------------------------------------------------
Q20617_CAEEL/17-156VL-Y-------------KNM------------------------------------------------------------
UBC12_SCHPO/27-162GY-Y-------------KGG------------------------------------------------------------
SCE1_ARATH/9-153TD-W-------------EGG------------------------------------------------------------
UBC9_MESAU/8-152TP-W-------------EGG------------------------------------------------------------
UBC7_YEAST/8-159TP-Y-------------ADG------------------------------------------------------------
UBCD4_DROME/8-147TP-Y-------------EGG------------------------------------------------------------
Q9VYN3_DROME/66-201SV-Y-------------EGG------------------------------------------------------------
Q20872_CAEEL/39-180SP-W-------------EGG------------------------------------------------------------
UBC7_SCHPO/9-160TP-F-------------EGG------------------------------------------------------------
UB12L_ARATH/35-171GY-Y-------------LSG------------------------------------------------------------
UBC8_YEAST/7-143TP-Y-------------ENG------------------------------------------------------------
UBE2S_HUMAN/15-152TP-Y-------------AGG------------------------------------------------------------
Q9Y165_DROME/341-479SP-Y-------------EGG------------------------------------------------------------
UBCB_DICDI/6-141SP-F-------------EKG------------------------------------------------------------
UBE2A_MOUSE/8-145TP-F-------------EDG------------------------------------------------------------
UBC11_YEAST/12-150TP-Y-------------SGL------------------------------------------------------------
UBC9_SCHPO/8-152TS-W-------------EGG------------------------------------------------------------
UBC5_ARATH/7-143SI-Y-------------EGG------------------------------------------------------------
Q9U1Q1_CAEEL/8-159TC-F-------------ANG------------------------------------------------------------
UBC13_ARATH/8-159TL-Y-------------EGG------------------------------------------------------------
Q9XWF6_CAEEL/8-149TL-Y-------------AGE------------------------------------------------------------
Q6AWG5_DROME/66-223TL-Y-------------QGG------------------------------------------------------------
UBC7_WHEAT/11-161TL-Y-------------DGG------------------------------------------------------------
Q9VFR8_DROME/9-160TL-Y-------------EGG------------------------------------------------------------
Q9U5Q3_9CILI/34-174SV-W-------------ENG------------------------------------------------------------
Q9VQ00_DROME/25-160SV-Y-------------ENG------------------------------------------------------------
UBC11_SCHPO/32-170TY-Y-------------EGL------------------------------------------------------------
UBC17_ARATH/19-158TL-Y-------------ANE------------------------------------------------------------
UBE2C_HUMAN/34-170TV-Y-------------EDL------------------------------------------------------------
UBE2H_MOUSE/10-145TP-Y-------------EGG------------------------------------------------------------
UBC6_ARATH/7-143SL-Y-------------QGG------------------------------------------------------------
UBC15_ARATH/19-158TL-Y-------------ANE------------------------------------------------------------

PF14461

Q4FRY8_PSYA2/12-152YK-T.............SEG------------------------------------------------------------
A5G3M9_GEOUR/17-151..-..............NGV------------------------------------------------------------
Q2K8Q4_RHIEC/18-161VA-..............HGA------------------------------------------------------------
Q8KW20_9RHOB/16-149LL-A.............GDR------------------------------------------------------------
D3GMN6_9ENTR/13-154YA-T.............DAG------------------------------------------------------------
A0L3D6_SHESA/1-142VV-ETTI..........LNH------------------------------------------------------------
A3W6V2_9RHOB/1-135QI-KV............GSV------------------------------------------------------------
Q2NBP1_ERYLH/4-143IN-V.............HGR------------------------------------------------------------
Q2L5J8_CLOPF/12-145NI-..............QKQ------------------------------------------------------------
A0AW81_ARTS2/19-154VP-ETVT..........GTA------------------------------------------------------------
A3TSK9_9RHOB/18-157LA-..............HDN------------------------------------------------------------
A3GXG6_VIBCL/12-153YS-T.............KGG------------------------------------------------------------
E0TAZ7_PARBH/17-149..-..............LPG------------------------------------------------------------
Y4OA_RHISN/9-149IQ-QDGTLILEVLWPMDSAG------------------------------------------------------------
Y4QC_RHISN/29-153PL-N.............DGR------------------------------------------------------------

PF05743

Q7Q6B6_ANOGA/22-142NT.Y----------------------------------------------------------------------------
UEVLD_HUMAN/21-141NT.Y----------------------------------------------------------------------------
Q6FS29_CANGA/27-147...L----------------------------------------------------------------------------
Q4SDZ6_TETNG/21-141RT.Y----------------------------------------------------------------------------
Q4TA00_TETNG/24-145SC.Y----------------------------------------------------------------------------
UEVLD_XENTR/21-141TT.Y----------------------------------------------------------------------------
Q5KKQ1_CRYNJ/24-146AI.Y----------------------------------------------------------------------------
TS101_RAT/21-141NI.Y----------------------------------------------------------------------------
Q5BAA9_EMENI/33-155TV.Y----------------------------------------------------------------------------
Q75EU1_ASHGO/32-146...G----------------------------------------------------------------------------
STP22_YEAST/31-162SSPH----------------------------------------------------------------------------
Q4UHS4_THEAN/19-133FT.L----------------------------------------------------------------------------
O76258_CAEEL/21-141AC.Y----------------------------------------------------------------------------
Q9VVA7_DROME/22-142NT.Y----------------------------------------------------------------------------
TS101_DICDI/47-167IN.Y----------------------------------------------------------------------------
P78998_SACPS/31-154...D----------------------------------------------------------------------------
Q4PAN2_USTMA/23-145TT.Y----------------------------------------------------------------------------
UEVLD_DANRE/21-141RS.Y----------------------------------------------------------------------------
Q6ESB7_ORYSJ/45-167AS.Y----------------------------------------------------------------------------
ELC_ARATH/37-158VT.Y----------------------------------------------------------------------------
Q59WF8_CANAL/24-164...I----------------------------------------------------------------------------
Q4N7T6_THEPA/34-148FT.V----------------------------------------------------------------------------
Q4SAD8_TETNG/22-142NV.Y----------------------------------------------------------------------------

PF08694

UFC1_ARATH/6-167TR-WTGKCWYVHNL---LKY------------------------------------------------------------
UFC1_AEDAE/4-164TK-WFGKCWYVHNL---LKY------------------------------------------------------------
A0DET8_PARTE/1-156TN-WKGKCWVVHNL---IRY------------------------------------------------------------
UFC1_RAT/4-164TR-WFGKCWYIHDF---LKY------------------------------------------------------------
Q4N8N9_THEPA/4-172TC-WFGECWYVHNM---KTY------------------------------------------------------------
Q4DHG1_TRYCC/3-163TR-WYGTCWAYYKN---EKY------------------------------------------------------------
Q5DBD5_SCHJA/4-164TR-WYGKCWYIQDM---KKY------------------------------------------------------------
Q22BA5_TETTS/2-180KV-WKGKCWYIHNL---VRY------------------------------------------------------------
UFC1_DICDI/3-163TR-WQGKCWYIYNF---KKY------------------------------------------------------------

PF05773

Q4WEH2_ASPFU/8-134IP---------------DHP............................................................
Q4WU06_ASPFU/41-154SN---------------PEV............................................................
Q757B9_ASHGO/407-512.S---------------GKF............................................................
RNF25_HUMAN/11-125DS---------------QYV............................................................
Q4WZQ4_ASPFU/386-489EA---------------PNI............................................................
Q4WQA1_ASPFU/1-121ET---------------EQP............................................................
Q4WDC1_ASPFU/6-159LS---------------YLP............................................................
E2AK4_HUMAN/18-134EE---------------VYV............................................................
IMPCT_XENLA/7-113NK---------------PTW............................................................
Q6BMK3_DEBHA/392-504LK---------------QDD............................................................
Q6BNZ6_DEBHA/2-136SN---------------RKH............................................................
Q6BX55_DEBHA/1-103.P---------------QHD............................................................
Q6BWT3_DEBHA/17-158IK---------------NLP............................................................
IMPCT_CAEEL/2-99..---------------.DR............................................................
Q640E2_XENLA/7-130QN---------------SEV............................................................
Q5ADM3_CANAL/405-504..---------------EHN............................................................
Q59S39_CANAL/9-125DR---------------PTV............................................................
Q6YUR1_ORYSJ/47-192LQ---------------HLP............................................................
YL419_YEAST/423-528.I---------------EKL............................................................
Q5AU57_EMENI/6-130VP---------------NHT............................................................
RWDD3_PONAB/1-111MD---------------ADI............................................................
Q3ZAU6_RAT/4-134IC---------------FLP............................................................
Q4PDS7_USTMA/6-155SR---------------SPI............................................................
Q20871_CAEEL/2-135LD---------------ILP............................................................
IMPCT_DICDI/1-152TS---------------YDY............................................................
Q55GT9_DICDI/415-519QS---------------PSS............................................................
Q4CY49_TRYCC/190-316SG---------------SGK............................................................
Q4P4B8_USTMA/14-135LK---------------PLV............................................................
RWDD3_DANRE/1-109NN---------------EKT............................................................
Q75F11_ASHGO/10-125EP---------------AES............................................................
Q9VZ55_DROME/176-361SE---------------VRKAREAVLAAAAAAAQAALDKKKKPPLRCRNFDRDG.......TCKYGPKCRFAHLPQQPTE
A8X836_CAEBR/4-137LD---------------ILP............................................................
Q9XVY4_CAEEL/15-135GK---------------SKL............................................................
Q86I15_DICDI/66-198VS---------------KLP............................................................
Q4RFR0_TETNG/5-135GG---------------ERT............................................................
Q9LQM5_ARATH/184-320AQ---------------HLP............................................................
Q6FVK3_CANGA/2-158LS---------------KDH............................................................
Q6CTZ2_KLULA/2-106.P---------------QHE............................................................
Q5JKR6_ORYSJ/3-122AY---------------VPV............................................................
Q7X7C1_ORYSA/108-233FE---------------YLP............................................................
Q8IDE3_PLAF7/67-179IS---------------NN.............................................................
Q4SZQ6_TETNG/2-108LE---------------DTK............................................................
YIH1_SCHPO/2-94..---------------PDS............................................................
Q4RIS5_TETNG/2-125VC---------------FLP............................................................
Q6CDD7_YARLI/1-89..---------------PDR............................................................
Q5BB34_EMENI/40-153SN---------------ADV............................................................
Q9VJ60_DROME/3-109ED---------------NYK............................................................
Q7S2B9_NEUCR/1-108PG---------------DIT............................................................
Q7Q0B4_ANOGA/9-123KE---------------AYV............................................................
Q4STD1_TETNG/1-114IS---------------FLP............................................................
Q4D6B4_TRYCC/5-103..---------------...............................................................
Q95RT3_DROME/4-116PE---------------KGL............................................................
ITT1_SCHPO/9-132VR---------------HFP............................................................
Q6CTQ8_KLULA/10-125DP---------------AEC............................................................
Q8X0V7_NEUCS/437-541SQ---------------TNV............................................................
IMPCT_MOUSE/7-113DD---------------PKW............................................................
Q4RHJ9_TETNG/221-397GQ---------------GGADGNRPARAQKVCQFYLKGKGCRFGDKCKFK................HQLLTKERPGGGPP
Q4RLP9_TETNG/13-130QG---------------CYA............................................................
Q6C972_YARLI/2-130QP---------------KGQ............................................................
Q9C2M7_NEUCS/8-183VA---------------HLP............................................................
Q6CS85_KLULA/412-516.N---------------DEF............................................................
Q8T6F6_DROPS/41-151IG---------------QWVG...........................................................
Q3ZC53_BOVIN/3-111ND---------------ETV............................................................
Q5A855_CANAL/1-106.P---------------NHE............................................................
YCF9_SCHPO/1-111CD---------------NPP............................................................
Q6CDA6_YARLI/420-527NL---------------ENG............................................................
Q7QK93_ANOGA/171-363SE---------------MKKQAEREAQQAEEEKRRMLEALAKKKKAKREKCWNFAKGKCRYGNRCHYSHELDEPKDESDK
Q5RIL0_DANRE/1-124EN---------------PAA............................................................
Q6FSE4_CANGA/10-125DP---------------EEL............................................................
Q8MZ95_DROME/27-143DG---------------ASVGAGE........................................................
Q4QCY6_LEIMA/5-109QD---------------EPP............................................................
Q5PQ37_XENLA/4-135QG---------------TGK............................................................
Q7QBP1_ANOGA/4-115ET---------------EGL............................................................
Q7XSB8_ORYSJ/29-143GD---------------SNV............................................................
Q750B2_ASHGO/2-157IS---------------KEQ............................................................
Q5AYM1_EMENI/6-166LA---------------HLP............................................................
Q7SXJ6_DANRE/2-114LS---------------QFV............................................................
Q7F9L6_ORYSA/43-178VQ---------------HLA............................................................
Q4DGH6_TRYCC/4-108AD---------------DPP............................................................
Q5CGP2_CRYHO/1-151SI---------------KFI............................................................
Q75EM4_ASHGO/2-106.P---------------NYE............................................................
RWD2A_MACFA/7-131EE---------------PKV............................................................
Q6CB97_YARLI/1-115IR---------------NLP............................................................
IMPCT_DANRE/10-115QQ---------------PKW............................................................
Q5KE91_CRYNJ/3-101SA---------------HPL............................................................
Q7PMA0_ANOGA/3-108EE---------------GNK............................................................
Q5ANG1_CANAL/15-141IS---------------NLP............................................................
GCN2_SCHPO/9-124SK---------------SIA............................................................
Q7SCW3_NEUCR/1-116AE---------------ETP............................................................
Q5DET7_SCHJA/1-111LS---------------MKV............................................................
Q4KLB7_XENLA/4-134VS---------------FLP............................................................
Q5DEU0_SCHJA/3-107HG---------------TIS............................................................
Q55I55_CRYNB/4-118ED---------------ERV............................................................
GIR2_YEAST/2-156LT---------------KEH............................................................
Q5M8G9_XENTR/55-165ET---------------QYV............................................................
Q9C8I1_ARATH/3-122AI---------------PPV............................................................
GCN2_ARATH/30-145ED---------------TDI............................................................
IFKC_DICDI/67-194EK---------------CFV............................................................
O01712_DROME/9-127LE---------------TYV............................................................
Q55CB4_DICDI/4-208TS---------------SYNDDDNNNNYNDYEDDDDDDSFDEKYKYN.....................IKIKIDLPNEYK
Q6FMC2_CANGA/1-102.P---------------QHE............................................................
O74297_NEUCS/43-157SD---------------QEL............................................................
DHX57_HUMAN/243-419KS---------------KPKESTKNVQENSLEICKFYLKGNCKFGSKCRF................KHEVPPNQIVGRIE
Q6FPE1_CANGA/415-520.M---------------EKY............................................................
Q5AGV1_CANAL/2-149SK---------------RKH............................................................
Q4CVK5_TRYCC/246-363DM---------------SLS............................................................
Q4TU20_ARATH/1-111SQ---------------QFV............................................................
O18131_CAEEL/2-116TD---------------DDF............................................................
Q6CQJ5_KLULA/2-165IT---------------NDH............................................................
Q4Y347_PLACH/2-106KN---------------KKQ............................................................
RWDD4_RAT/2-108DG---------------DPK............................................................
Q6IQ68_DANRE/3-126IS---------------FLP............................................................
Q4XYA3_PLACH/66-179DH---------------CNN............................................................
Q5DGN4_SCHJA/1-112PS---------------KLI............................................................
Q556K0_DICDI/1-107EP---------------NFV............................................................
DHX57_MOUSE/243-419TN---------------KFCKSKQKESSKNVRDTSPETCKFYLKGNCKFGSK...........CKFKHEVPPHQMIGRAE
RWD2B_HUMAN/34-162DE---------------KMA............................................................
Q4CLS7_TRYCC/23-139SN---------------PRH............................................................
Q55VL2_CRYNB/13-165LS---------------HLP............................................................

PF14457

Q21PA7_SACD2/14-175SG---------------IRS------------------------------------------------------------
A0L5E1_MAGSM/13-169LK---------------FRK------------------------------------------------------------
Q4ZFT1_CLOPF/15-178FD---------------IKE------------------------------------------------------------
A9BTW4_DELAS/5-166TG---------------VRT------------------------------------------------------------
A1U5J0_MARAV/18-180TG---------------IKR------------------------------------------------------------
Q3SNL9_NITWN/14-180NG---------------VRV------------------------------------------------------------
Q8PFM8_XANAC/22-182AG---------------IHR------------------------------------------------------------
A1U033_MARAV/19-179VG---------------IRR------------------------------------------------------------
A1VVG1_POLNA/24-184VG---------------INY------------------------------------------------------------
A3U023_9RHOB/20-179VP---------------IRR------------------------------------------------------------
Q5HY19_GLUOX/8-170VP---------------IRH------------------------------------------------------------
Q3J4T6_RHOS4/6-183GQ---------------SFP------------------------------------------------------------

PF14462

A1VQ26_POLNA/187-309HP------------------------------------------------------------------------------
Q6YRV0_SYNY3/5-127VS------------------------------------------------------------------------------
Q8ZSK7_NOSS1/4-126TE------------------------------------------------------------------------------
Q1QNK3_NITHX/244-367AA------------------------------------------------------------------------------
A4JA91_BURVG/127-248PT------------------------------------------------------------------------------

PF14460

Q3M1I7_ANAVT/44-224..---------------RYY------------------------------------------------------------
Q8ZSF1_NOSS1/44-224..---------------RYY------------------------------------------------------------
Q5NXB4_AROAE/51-225..---------------EWR------------------------------------------------------------
B3ZY45_BACCE/33-211..---------------NIS------------------------------------------------------------
Q8A4F1_BACTN/53-225..---------------CMD------------------------------------------------------------
Q11ZD1_POLSJ/54-242..---------------GLY------------------------------------------------------------
Q21Q52_RHOFD/56-227..---------------CLM------------------------------------------------------------
Q120V4_POLSJ/57-235..---------------DLF------------------------------------------------------------
A1VVA0_POLNA/62-240..---------------ALY------------------------------------------------------------
Q8XYU7_RALSO/54-226..---------------QWY------------------------------------------------------------
Q5NUW6_RALME/54-226..---------------GFS------------------------------------------------------------
Q7WX34_CUPNH/54-226..---------------GFR------------------------------------------------------------
A4JUM7_BURVG/54-227..---------------GFR------------------------------------------------------------
Q47D10_DECAR/55-233..---------------VWR------------------------------------------------------------
A0R7U7_PELPD/52-228..---------------VWA------------------------------------------------------------
C3IV16_BACTU/30-216E.---------------NKR------------------------------------------------------------
C3IUY7_BACTU/30-236LT---------------HSM------------------------------------------------------------

PF14459

Y4JF_RHISN/38-168IR---------------RSG------------------------------------------------------------
Q98A20_RHILO/38-168IR---------------RSG------------------------------------------------------------
Q8KGV9_RHILI/4-134IR---------------RSG------------------------------------------------------------
Q2K2A4_RHIEC/38-168IA---------------RRG------------------------------------------------------------

PF00179

UBC21_CAEEL/25-161----------------TFEI-KVDIPE---H-YP-F-----.EPPK-AK---FV..T....................---
UBC35_ARATH/9-141----------------VFKL-ELFLPE---E-YP-M-----.AAPK-VR---FL..T....................---
UBC24_ARATH/678-815----------------LFFF-DIMLPP---Q-YP-H-----.EPPM-VH---YH..SG...................---
UBC2_NEUCR/8-145----------------TFRL-VMHFEE---Q-YP-N-----.KPPS-VK---FI..S....................---
UB2L6_HUMAN/6-144----------------AFNL-RISFPP---E-YP-F-----.KPPM-IK---FT..T....................---
UB2G1_RAT/9-161----------------VFKA-HLTFPK---D-YP-L-----.RPPK-MK---FI..T....................---
UBE2K_MOUSE/8-147----------------RYQL-EIKIPE---T-YP-F-----.NPPK-VR---FI..T....................---
UBCX_YEAST/21-174----------------QFRI-LIEVPS---S-YP-M-----.NPPK-IS---FM..Q....................---
UBC1_SCHPO/8-144----------------YFVV-DIEIPI---D-YP-F-----.RPPK-MN---FD..T....................---
UBC12_YEAST/31-172----------------SINF-NLDFNE---V-YP-I-----.EPPK-VV---CL..K....................---
O48838_ARATH/33-171----------------VFTV-SVHIPP---K-YP-Y-----.EPPK-IT---FK..T....................---
UBC13_SCHPO/6-141----------------KFHL-ELFLPD---E-YP-M-----.MPPN-VR---FL..T....................---
Q9VH01_DROME/4536-4692----------------CFEF-DVFFPP---D-YP-N-----.QPML-IN---LE..TTG.................R---
UBC14_SCHPO/11-149----------------KFHF-SLKFPL---D-YP-F-----.QPPT-IE---FT..T....................---
Q9VZ73_DROME/14-153----------------AYKM-EIDFPL---D-YP-F-----.KPPR-IH---IN..T....................---
Q9VJS5_DROME/7-142----------------NFKL-ELFLPE---D-YP-M-----.KAPK-VR---FL..T....................---
UBC84_DROME/6-144----------------AFRI-EINFPP---Q-YP-F-----.MPPK-IL---FK..T....................---
UBC15_SCHPO/9-160----------------FFHA-TLSFPQ---D-YP-L-----.MPPK-MK---FT..T....................---
UBC9_CAEEL/8-152----------------LYRI-RMLFKD---D-FP-S-----.TPPK-CK---FE..P....................---
UBC34_ARATH/9-146----------------FYYG-KIKFPP---E-YP-Y-----.KPPG-IT---MT..T....................---
Q43780_SOLLC/6-143----------------TFKI-DITLTD---G-YP-F-----.EPPK-MK---FA..T....................---
UBC2_MEDSA/8-145----------------TFKL-SLQFSE---D-YP-N-----.KPPT-VR---FV..S....................---
UBC2_YEAST/8-145----------------TFRL-LLEFDE---E-YP-N-----.KPPH-VK---FL..S....................---
UBCX_PICAN/7-177----------------LWKL-EIDIPT---N-YP-L-----.DPPK-IK---FV..VFGEEKIRQLQRKTSSGARKV---
UBC12_DROME/30-165----------------RFVF-NFRVGS---N-YP-H-----.EPPK-VK---CA..T....................---
UB2G2_MOUSE/8-159----------------VFPA-ILSFPL---D-YP-L-----.SPPK-MR---FT..C....................---
Q95039_PARTE/244-382----------------LYIL-SYVFTQ---N-YP-F-----.RPPK-VQ---FI..T....................---
UB2J2_MOUSE/16-153----------------YYHG-KLIFPR---E-FP-F-----.KPPS-IY---MI..T....................---
UB2L3_MOUSE/6-144----------------AFRI-EINFPA---E-YP-F-----.KPPK-IT---FK..T....................---
UBE2C_DROME/36-172----------------TYRL-SLDFPN---S-YP-Y-----.AAPV-VK---FL..T....................---
AKTIP_MOUSE/72-217----------------VFKF-TVYIPD---N-YP-D-----GDCPR-LL---FD..I....................---
UBC3_YEAST/11-164----------------FFKA-QMRFPE---D-FP-F-----.SPPQ-FR---FT..P....................---
UBE2C_SPISO/34-170----------------KYKL-TLEFPS---D-YP-Y-----.KPPV-VK---FT..T....................---
Q9VGD6_DROME/17-152----------------IWTV-NVTMPQ---D-YP-L-----.TAPR-VR---FV..T....................---
Q9XZ32_DROME/1125-1274----------------LFFF-DFQFGR---D-YP-K-----.SPPV-CH---YI..SY...................---
UBC9_YEAST/8-152----------------VYPI-TVEYPN---E-YP-S-----.KPPK-VK---FP..A....................---
Q9TZ69_CAEEL/8-147----------------MFDL-DIKIPD---Q-YP-F-----.SPPN-VK---FS..T....................---
UBCD2_DROME/90-225----------------VFFL-DIHFSP---E-YP-F-----.KPPK-VT---FR..T....................---
UBC12_MOUSE/33-168----------------KFVF-SFKVGQ---G-YP-H-----.DPPK-VK---CE..T....................---
Q20617_CAEEL/17-156----------------IFTL-TLDVNV---E-YP-F-----.KPPY-LK---FC..H....................---
UBC12_SCHPO/27-162----------------KFKF-RIQIDD---N-YP-H-----.DPPK-VK---CL..N....................---
SCE1_ARATH/9-153----------------FFPL-TMHFSE---D-YP-S-----.KPPK-CK---FP..Q....................---
UBC9_MESAU/8-152----------------LFKL-RMLFKD---D-YP-S-----.SPPK-CK---FE..P....................---
UBC7_YEAST/8-159----------------VFNA-KLEFPK---D-YP-L-----.SPPK-LT---FT..P....................---
UBCD4_DROME/8-147----------------KFVL-EIKVPE---T-YP-F-----.NPPK-VR---FI..T....................---
Q9VYN3_DROME/66-201----------------HFRL-DIRFPA---S-YP-F-----.RAPR-IR---FT..T....................---
Q20872_CAEEL/39-180----------------EYEV-SVNF.H---K-WP-I-----.IPPI-CE---FK..T....................---
UBC7_SCHPO/9-160----------------LYPA-TLKFPS---D-YP-L-----.GPPT-LK---FE..C....................---
UB12L_ARATH/35-171----------------NFVF-SFQVSN---M-YP-H-----.EAPK-VK---CK..T....................---
UBC8_YEAST/7-143----------------VWRL-HVELPD---N-YP-Y-----.KSPS-IG---FV..N....................---
UBE2S_HUMAN/15-152----------------LFRM-KLLLGK---D-FP-A-----.SPPK-GY---FL..T....................---
Q9Y165_DROME/341-479----------------KFFL-FIYFPE---R-YP-M-----.TPPT-VR---FL..T....................---
UBCB_DICDI/6-141----------------VFSM-DIDIPA---D-YP-F-----.KPPT-LK---FT..T....................---
UBE2A_MOUSE/8-145----------------TFKL-TIEFTE---E-YP-N-----.KPPT-VR---FV..S....................---
UBC11_YEAST/12-150----------------KFKV-SLKFPQ---N-YP-F-----.HPPM-IK---FL..S....................---
UBC9_SCHPO/8-152----------------LYKL-TMAFPE---E-YP-T-----.RPPK-CR---FT..P....................---
UBC5_ARATH/7-143----------------VWKI-RVELPD---A-YP-Y-----.KSPS-VG---FI..T....................---
Q9U1Q1_CAEEL/8-159----------------VFPA-RITFPQ---D-YP-L-----.SPPK-MR---FT..C....................---
UBC13_ARATH/8-159----------------FFYA-IMSFPQ---N-YP-N-----.SPPT-VR---FT..S....................---
Q9XWF6_CAEEL/8-149----------------VFML-QFTFGP---Q-YP-F-----.NSPE-VM---FVGET....................---
Q6AWG5_DROME/66-223----------------YFKA-HMKFPH---D-YP-Y-----.SPPS-IR---FL..T....................---
UBC7_WHEAT/11-161----------------YFNA-IMSFPQ---N-YP-N-----.SPPT-VR---FT..S....................---
Q9VFR8_DROME/9-160----------------FFKA-HLIFPK---E-YP-L-----.RPPK-MK---FI..T....................---
Q9U5Q3_9CILI/34-174----------------VFKL-KMEFSE---E-YP-N-----.KPPH-VL---MK..T....................---
Q9VQ00_DROME/25-160----------------IFKL-DIFFPV---E-YP-F-----.APPV-VI---FR..T....................---
UBC11_SCHPO/32-170----------------KFKI-SMSFPA---N-YP-Y-----.SPPT-II---FT..S....................---
UBC17_ARATH/19-158----------------TYQL-QVEFPE---H-YP-M-----.EAPQ-VI---FQ.HP....................---
UBE2C_HUMAN/34-170----------------RYKL-SLEFPS---G-YP-Y-----.NAPT-VK---FL..T....................---
UBE2H_MOUSE/10-145----------------VWKV-RVDLPD---K-YP-F-----.KSPS-IG---FM..N....................---
UBC6_ARATH/7-143----------------VWKI-KVELPE---A-YP-Y-----.KSPS-VG---FV..N....................---
UBC15_ARATH/19-158----------------TYQL-QVEFPE---H-YP-M-----.EAPQ-VV---FV.SP....................---

PF14461

Q4FRY8_PSYA2/12-152----------------IFNV-ALVFGD---DLYT-T------LPRA-QV---LK.KP------------------KK---
A5G3M9_GEOUR/17-151----------------PVDF-YFGVKK---S.FP-L------SLPY-IF---LA.QW------------------DS---
Q2K8Q4_RHIEC/18-161----------------TYPI-RLVYPD---N.FP-L------VPAW-VE---PQ.DP------------------EA---
Q8KW20_9RHOB/16-149----------------RIPL-RLVFPA---L.FP-D------LPPF-VL---PA.DS------------------SV---
D3GMN6_9ENTR/13-154----------------NFNV-ALVIHP---DPFT-E------LPTA-FI---IE.QP------------------EQ---
A0L3D6_SHESA/1-142----------------GIQL-MLVADP---P.YY-R------LPEF-FL---INPDS------------------IG---
A3W6V2_9RHOB/1-135----------------PVSL-EIEIAD---YDFL-D------LP.K-VR---VL.KR------------------EA---
Q2NBP1_ERYLH/4-143----------------AVDI-ELVIPD---SKFV-E------LP.I-VR---LV.DR------------------KQ---
Q2L5J8_CLOPF/12-145----------------NFDI-IMCIPE---E.WN-L------KLID-FY---IK.DY------------------KN---
A0AW81_ARTS2/19-154----------------PLEL-TAVFPD---F.YP-L------VPPK-VF---AV.DL------------------G.---
A3TSK9_9RHOB/18-157----------------TYPV-RLIYPD---Q.FP-L------VPAW-VE---PA.EK------------------AR---
A3GXG6_VIBCL/12-153----------------VFVI-ALVLWN---DPHI-Q------LPFA-YI---LQ.QP------------------EQ---
E0TAZ7_PARBH/17-149----------------DPPL-HLLLDP---E.FP-Y------APPR-IA---LP.DE------------------TQ---
Y4OA_RHISN/9-149----------------SIRL-NVGYSP---L.HP-F------CRPS-IS---AP.EL------------------Q.---
Y4QC_RHISN/29-153----------------TIGL-RAVYPD---T.FP-R------LRPH-VF---LTCDP------------------SE---

PF05743

Q7Q6B6_ANOGA/22-142----------------NIPI-CIWLMD---T-HP-K......NAPI-CY---VKPTP------------------EM...
UEVLD_HUMAN/21-141----------------NIPI-RFWILD---S-HP-F......APPI-CF---LKPTA------------------NM...
Q6FS29_CANGA/27-147----------------DVPV-LIWIPE---S-YP-I......AKPL-LF---IDLEL------------------LDKD.
Q4SDZ6_TETNG/21-141----------------NFPV-QLWLLD---S-FP-F......TPPI-CL---LRPTA------------------NM...
Q4TA00_TETNG/24-145----------------NIPV-SIWLHQ---T-HP-V......SHPR-CY---VCPSV------------------SM...
UEVLD_XENTR/21-141----------------NIPI-CLWILD---S-HP-F......APPL-CF---LKPSG------------------NM...
Q5KKQ1_CRYNJ/24-146----------------QIPI-HLWVPH---E-YP-R......APPL-IF---VMPTK------------------DM...
TS101_RAT/21-141----------------NIPI-CLWLLD---T-YP-Y......NPPI-CF---VKPTS------------------SM...
Q5BAA9_EMENI/33-155----------------KFPI-ALWIPN---T-YP-R......EPPI-VY---VKPTQ------------------DM...
Q75EU1_ASHGO/32-146----------------NVDV-LIWIPF---E-YP-N......VAPH-AY---IDLEA------------------NKGR.
STP22_YEAST/31-162----------------SIPV-IMWVPS---M-YP-V......KPPF-IS---INLEN------------------FDMNT
Q4UHS4_THEAN/19-133----------------NAPL-LIQVFS---D-YP-F......SCPS-FF---VPSRN------------------T....
O76258_CAEEL/21-141----------------NIPV-TVYLWD---T-HP-Y......YAPI-CY---VNPTS------------------TM...
Q9VVA7_DROME/22-142----------------YIPI-CIWLMD---T-HP-Q......NAPM-CF---VKPTP------------------TM...
TS101_DICDI/47-167----------------YLPI-IVWVPL---N-YP-Q......EFPT-MV---LDPTP------------------EM...
P78998_SACPS/31-154----------------SLPL-IMWIPS---L-YP-V......KPPF-IS---IDLET------------------FDVSA
Q4PAN2_USTMA/23-145----------------NIPV-AYWIPR---D-YP-R......EPPM-AF---VAPTP------------------DM...
UEVLD_DANRE/21-141----------------NIPI-LLWLLD---S-FP-F......TPPI-CY---LRPTS------------------SM...
Q6ESB7_ORYSJ/45-167----------------NLPA-VLWLPE---P-YP-R......SPPL-VF---LSPTR------------------DM...
ELC_ARATH/37-158----------------NIPV-IIWLLE---S-YP-R......HPPC-VY---VNPTA------------------DM...
Q59WF8_CANAL/24-164----------------GTPI-EIWVPF---A-YP-YVDYENKGAPI-VY---IVPDH------------------SKGW.
Q4N7T6_THEPA/34-148----------------NAPL-VIQVLS---D-YP-F......STPL-FW---IRGHN------------------I....
Q4SAD8_TETNG/22-142----------------NIPV-CLWLLD---T-YP-F......NPPI-CF---VKPTS------------------AM...

PF08694

UFC1_ARATH/6-167----------------EFDL-QFDIPI---T-YP-A------TAPE-LE---LP--------------------------
UFC1_AEDAE/4-164----------------EFDV-EFDIPV---T-YP-A------TAPE-IA---LP--------------------------
A0DET8_PARTE/1-156----------------EFDF-QFEIPP---T-YP-L------APIE-IE---IP--------------------------
UFC1_RAT/4-164----------------EFDI-EFEIPI---T-YP-T------TAPE-IA---VP--------------------------
Q4N8N9_THEPA/4-172----------------KFQL-ELEIPA---G-YP-N------APFD-II---IR--------------------------
Q4DHG1_TRYCC/3-163----------------EFKV-NFDLAV---T-YP-Q------APPE-IA---LP--------------------------
Q5DBD5_SCHJA/4-164----------------EFDL-NFDIPV---S-YP-S------TNPE-LA---LP--------------------------
Q22BA5_TETTS/2-180----------------DFDL-EFEIPA---T-YP-A------SPIE-LC---LP--------------------------
UFC1_DICDI/3-163----------------EFDL-EFDMPV---T-YP-E------TAPE-IA---IP--------------------------

PF05773

Q4WEH2_ASPFU/8-134................NLSF-LLGFHA...S-YP.D------TPPK.IL...GT--------------------------
Q4WU06_ASPFU/41-154................RVDL-LVELPT...T-YP.K------TYPN.LS...LG--------------------------
Q757B9_ASHGO/407-512................NLKL-KVYKTK...Q-YP.G------TLPG.II...IS--------------------------
RNF25_HUMAN/11-125................CFTL-VLQVPA...E-YP.H------EVPQ.IS...IR--------------------------
Q4WZQ4_ASPFU/386-489................PGSL-SFRFQKPSAG-YP.S------SVPV.IA...IQ--------------------------
Q4WQA1_ASPFU/1-121................ALIL-QVSYPP...E-YP.D------VAPD.LE...IS--------------------------
Q4WDC1_ASPFU/6-159................PLRL-EIDLPE...G-YPSE------KAPI.FR...LE--------------------------
E2AK4_HUMAN/18-134................KVDL-RVKCPP...T-YP.D------VVPE.IE...LK--------------------------
IMPCT_XENLA/7-113................TLCL-QVILPP...D-YPVA------SPPL.YQ...LN--------------------------
Q6BMK3_DEBHA/392-504................LLSL-KLYKSD...N-YP.N------DLLG.IQ...LI--------------------------
Q6BNZ6_DEBHA/2-136................RLLL-DVRYPA...E-YP.E------VVPE.LD...II--------------------------
Q6BX55_DEBHA/1-103................DLEI-QMSFSE...N-YP.D------EIPTVIQ...IL--------------------------
Q6BWT3_DEBHA/17-158................PVQL-TFKVTE...K-YPFE------EPPE.FH...IN--------------------------
IMPCT_CAEEL/2-99................DIGM-TINLPE...D-YPSI------SPPI.FE...LS--------------------------
Q640E2_XENLA/7-130................KAVM-HVSLPQ...S-YP.Q------EEPQ.VF...VR--------------------------
Q5ADM3_CANAL/405-504................FLNV-KIFKSE...N-YP.N------EIPG.IH...IV--------------------------
Q59S39_CANAL/9-125................SITL-DIEFTP...T-YP.L------SPPK.VK...LL--------------------------
Q6YUR1_ORYSJ/47-192................PVVL-ACLLPR...L-YPSH------RAPY.FV...VA--------------------------
YL419_YEAST/423-528................KIKL-KVYRTK...N-YP.A------SLPG.IV...VS--------------------------
Q5AU57_EMENI/6-130................HLSF-LLAFES...D-YP.D------TPPK.IL...GT--------------------------
RWDD3_PONAB/1-111................PLES-VFHLPV...N-YP.S------CLPG.IS...IN--------------------------
Q3ZAU6_RAT/4-134................PLVL-NFELPP...D-YPSS------SPPS.FT...LS--------------------------
Q4PDS7_USTMA/6-155................VLSL-DIQCTP...E-YP.D------APPN.MSIHVVR--------------------------
Q20871_CAEEL/2-135................PIRL-KFHLPN...D-YPTV------SSPK.LE...LE--------------------------
IMPCT_DICDI/1-152................LIYF-KFKYTK...E-YPSN------EPPI.IS...IK--------------------------
Q55GT9_DICDI/415-519................SFKC-NIYLPTSLIT-YP.F------QLPI.IT...FS--------------------------
Q4CY49_TRYCC/190-316................RVVV-CVRVPN...Q-YP.A------DPPL.IL...VQ--------------------------
Q4P4B8_USTMA/14-135................SAYV-SFRLPK...N-YP.L------VTPT.II...VK--------------------------
RWDD3_DANRE/1-109................PLDI-IFHISP...E-YP.N------TPPD.IS...IS--------------------------
Q75F11_ASHGO/10-125................SLTL-HFVLVS...T-YP.H------AAPQ.IT...FK--------------------------
Q9VZ55_DROME/176-361SDTTKKDSVDENDNELWFHV-EVRFPPG.SR-YP.Y------EAPF.IY...LK--------------------------
A8X836_CAEBR/4-137................PVRL-KFKLPK...D-YPSD------SSPK.LE...LE--------------------------
Q9XVY4_CAEEL/15-135................SVIL-HVKCSE...D-YP.Q------RKPA.VD...LL--------------------------
Q86I15_DICDI/66-198................PIFL-TFKYND...D-YPLL------SSLEFFK...LE--------------------------
Q4RFR0_TETNG/5-135................DILL-SCAYPP...E-YP.R------VLPE.IT...VR--------------------------
Q9LQM5_ARATH/184-320................PIVL-KCLLPK...A-YPSH------LPPY.FL...IS--------------------------
Q6FVK3_CANGA/2-158................TLHC-TFQLPE...E-YP.D------VNPV.IS...IE--------------------------
Q6CTZ2_KLULA/2-106................DFTL-HLSFPE...H-YPET------EPPH.LLEVSLS--------------------------
Q5JKR6_ORYSJ/3-122................QLAL-IFAHTE...K-YP.D------EPPL.LN...VK--------------------------
Q7X7C1_ORYSA/108-233................PLVL-TCLLPL...S-YPSK------EPPY.FT...VT--------------------------
Q8IDE3_PLAF7/67-179................HINF-TFELPK...D-YPLG------SISI.IN...VT--------------------------
Q4SZQ6_TETNG/2-108................AFIL-DVTWPE...M-YP.E------TAPK.IS...LD--------------------------
YIH1_SCHPO/2-94................SVRL-NIQFPL...D-YP.N------SAPT.VL.....--------------------------
Q4RIS5_TETNG/2-125................PLVL-NFELPE...D-YPSK------SPPI.FA...LS--------------------------
Q6CDD7_YARLI/1-89................RALV-QLSFPS...A-YP.D------ILPE.VQ.....--------------------------
Q5BB34_EMENI/40-153................RLDL-LVELPA...T-YP.K------TCPN.IT...AE--------------------------
Q9VJ60_DROME/3-109................SFLV-ELKWGE...N-YP.D------EAPA.IN...MN--------------------------
Q7S2B9_NEUCR/1-108................SSTL-RLQFPP...A-YP.D------EPPV.VLGTHSS--------------------------
Q7Q0B4_ANOGA/9-123................KADL-YVTCSP...K-YP.K------CPPK.LE...LK--------------------------
Q4STD1_TETNG/1-114................PLLL-NFDLPE...D-YPSS------APPS.FT...LT--------------------------
Q4D6B4_TRYCC/5-103................RFVL-HVTLPP..RG-YPDV------SRPS.LF...VA--------------------------
Q95RT3_DROME/4-116................ACKL-VFTFTA...T-YP.D------GAPV.VE...IE--------------------------
ITT1_SCHPO/9-132................DLVM-EFFLPE...A-YPFN------SPPT.FF...LK--------------------------
Q6CTQ8_KLULA/10-125................SLNL-HVVLPS...T-YP.H------AAPQ.IT...FK--------------------------
Q8X0V7_NEUCS/437-541................DACV-QFRKSE...Q-YP..------TQVI.LA...MV--------------------------
IMPCT_MOUSE/7-113................TLCL-QVMLPS...E-YPGT------APPS.YQ...LN--------------------------
Q4RHJ9_TETNG/221-397DPNGPSQPGFSSYSPPVYEL-EIRFPKG.NR-YP.S------QAPV.VA...FS--------------------------
Q4RLP9_TETNG/13-130................TVDL-QVKCPP...S-YP.D------VPPE.LE...LK--------------------------
Q6C972_YARLI/2-130................CVEL-HVKYPK...D-YP.E------VVPV.IR...IV--------------------------
Q9C2M7_NEUCS/8-183................PVHL-EIIFGP...D-YPAE------KPPV.IT...IS--------------------------
Q6CS85_KLULA/412-516................KIKL-KVYKTK...S-YP.Q------TLPG.IV...VS--------------------------
Q8T6F6_DROPS/41-151...............IAMQL-LFTCPS...N-YP.M------QRPL.VE...IV--------------------------
Q3ZC53_BOVIN/3-111................QTTL-KFTYSE...K-YP.D------EAPL.YE...IF--------------------------
Q5A855_CANAL/1-106................SVSI-QLNFPL...T-YP.E------EIPQ.LLQIIVE--------------------------
YCF9_SCHPO/1-111................SLIF-TCQLSE...A-YP.D------EVPD.VK...IT--------------------------
Q6CDA6_YARLI/420-527................LLQA-TFWRSN...D-YP.A------SFPS.IA...VR--------------------------
Q7QK93_ANOGA/171-363KPGKRGTDKAADEDPNWFYL-EIRFPPG.NR-YP.F------ERPI.LL...LK--------------------------
Q5RIL0_DANRE/1-124................CITM-VCSYPN...D-YP.K------ELPD.IT...VR--------------------------
Q6FSE4_CANGA/10-125................SLVV-HFAMTP...M-YP.H------TAPE.IS...FG--------------------------
Q8MZ95_DROME/27-143............RGGYALQL-LFTCAA...N-YP.L------ARPL.VE...IV--------------------------
Q4QCY6_LEIMA/5-109................QLRV-IITYPT..EE-YPES------APCV.VA...VE--------------------------
Q5PQ37_XENLA/4-135................EIAL-HCSYPL...Q-YP.T------VPPE.IL...VR--------------------------
Q7QBP1_ANOGA/4-115................SCKL-LFTYTA...K-YP.D------TAPL.VE...IE--------------------------
Q7XSB8_ORYSJ/29-143................SATL-DVTCFA...G-YP.H------KCPK.LR...VL--------------------------
Q750B2_ASHGO/2-157................HLVV-DITLPE...R-YP.E------EAPQ.LS...IR--------------------------
Q5AYM1_EMENI/6-166................PLNL-EIELPE...G-YPSI------KPPI.FK...LN--------------------------
Q7SXJ6_DANRE/2-114................RLTL-TMDLDS...Q-YP.Y------SSPY.IS...IH--------------------------
Q7F9L6_ORYSA/43-178................PISF-TCLMPP...S-YPSH------HAPY.FT...LS--------------------------
Q4DGH6_TRYCC/4-108................ELRV-TIVYDS..EG-YPET------AAPT.VR...LE--------------------------
Q5CGP2_CRYHO/1-151................KIKV-AFLINQ...G-YPEK------SPPE.INNINIC--------------------------
Q75EM4_ASHGO/2-106................EIAI-QISFPS...N-YPAE------EPPH.ILEISIS--------------------------
RWD2A_MACFA/7-131................KIDL-QVTMPH...S-YP.Y------VALQ.LF...GR--------------------------
Q6CB97_YARLI/1-115................PVLL-FFALPE...G-YPET------KPPQ.FD...LQ--------------------------
IMPCT_DANRE/10-115................TVCL-QIILPP...D-YPSS------APPI.YQ...IN--------------------------
Q5KE91_CRYNJ/3-101................TLNL-IFEYPE...T-YP.D------VIPE.LI...IE--------------------------
Q7PMA0_ANOGA/3-108................SFLL-EICWTE...N-YP.N------ELPS.FN...LE--------------------------
Q5ANG1_CANAL/15-141................PIVL-NFQLSA...D-YPFV------APPE.IK...VT--------------------------
GCN2_SCHPO/9-124................KLDL-CIELGR...S-YP.Y------VKPV.IK...LQ--------------------------
Q7SCW3_NEUCR/1-116................SMVL-TVRYPE...D-YP.D------KPPF.LE...LA--------------------------
Q5DET7_SCHJA/1-111................KCQL-LFELTD...K-YP.N------KAPK.YQ...IL--------------------------
Q4KLB7_XENLA/4-134................PIIL-NFELPP...G-YPST------KPPA.FT...LS--------------------------
Q5DEU0_SCHJA/3-107................SFVI-QIQWPT...G-YP.N------VMPY.IS...MD--------------------------
Q55I55_CRYNB/4-118................NVIL-KGKMVQ...A-YP.H------QVPP.LL...LR--------------------------
GIR2_YEAST/2-156................TIIA-EFKLPE...N-YP.D------EPCL.IS...LE--------------------------
Q5M8G9_XENTR/55-165................RITL-ELSLPP...K-YP.A------EVPE.IS...VK--------------------------
Q9C8I1_ARATH/3-122................QLAL-VFSHTE...N-YP.D------EAPL.LD...VK--------------------------
GCN2_ARATH/30-145................SAML-IVRCLP...G-YP.Y------KCPK.LQ...IT--------------------------
IFKC_DICDI/67-194................SIYL-VVGFPE...K-YP.V------VLPS.IQ...VL--------------------------
O01712_DROME/9-127................CTKL-HVTCPS...K-YP.K------LPPK.IS...LE--------------------------
Q55CB4_DICDI/4-208IKIKDEELEYPIVCLPSINL-GFIYPK...G-YPSK------RAPI.IT...LS--------------------------
Q6FMC2_CANGA/1-102................KFTV-KISLPD...K-YPAT------EPPH.VLEVSVA--------------------------
O74297_NEUCS/43-157................SVTL-GVVMVA...T-YP.K------TPPL.LT...IK--------------------------
DHX57_HUMAN/243-419RSVDDSHLNAIEDASFLYEL-EIRFSKD.HK-YP.Y------QAPL.VA...FY--------------------------
Q6FPE1_CANGA/415-520................SLKL-KVYRTP...N-YP.Q------HIPG.IV...VS--------------------------
Q5AGV1_CANAL/2-149................SLNL-IVKYPP...T-YP.E------VIPQ.LS...IE--------------------------
Q4CVK5_TRYCC/246-363................ALRI-CMTLPR...R-YP.A------ELPK.LD...VV--------------------------
Q4TU20_ARATH/1-111................EAVV-RFQAGS...K-YP.D------EPPR.IS...LI--------------------------
O18131_CAEEL/2-116................DVEL-GIEFTE...N-YP.D------EIPI.IT...LN--------------------------
Q6CQJ5_KLULA/2-165................ILHT-IFTLPE...N-YP.D------EAPL.IK...IM--------------------------
Q4Y347_PLACH/2-106................SFYI-QFEYTE...T-YP.N------EPPI.YK...IV--------------------------
RWDD4_RAT/2-108................AFLI-EISWTE...T-YP.Q------TPPV.IS...MN--------------------------
Q6IQ68_DANRE/3-126................PLVL-SFDLPD...D-YPST------SAPV.FT...IS--------------------------
Q4XYA3_PLACH/66-179................IINI-TIELPK...D-YPLK------SFII.IN...IN--------------------------
Q5DGN4_SCHJA/1-112................KFNL-IMMFTL...K-YP.T------ESPT.IS...IE--------------------------
Q556K0_DICDI/1-107................AIIL-DIIFSV...D-YP.N------SIPK.ID...LI--------------------------
DHX57_MOUSE/243-419RNVNDPHLDADDDTTFMYEL-QIRFSKD.HK-YP.Y------QAPL.VA...FY--------------------------
RWD2B_HUMAN/34-162................MFSL-ACILPF...K-YP.A------VLPE.IT...VR--------------------------
Q4CLS7_TRYCC/23-139................RVVL-EVAIVA...G-YP.F------VAPR.VR...LR--------------------------
Q55VL2_CRYNB/13-165................ALSL-CVALPE...T-YPLL------VPPAPIS...LR--------------------------

PF14457

Q21PA7_SACD2/14-175----------------IEAV.SWVFPW---E-YP-L------RAP.QPK---LR--------------------------
A0L5E1_MAGSM/13-169----------------REGF.HIRVSS---R-FP-I------EPPIAKF---TH--------------------------
Q4ZFT1_CLOPF/15-178----------------FEPIKLLCSTN---E-IK-Y------KAPLVFS---DR--------------------------
A9BTW4_DELAS/5-166----------------VETC.VLVFGS---D-WP-L------SAP.EPF---LR--------------------------
A1U5J0_MARAV/18-180----------------LEPV.RFLIPF---A-FP-L------RPP.DIT---LR--------------------------
Q3SNL9_NITWN/14-180----------------VETV.NVRLWP---S-YP-W------SSP.SFY---LR--------------------------
Q8PFM8_XANAC/22-182----------------IERM.ALLYRT---G-AR-F------PFE.ARP---LR--------------------------
A1U033_MARAV/19-179----------------IERL.AFVLNP---N-LG-F------PWE.VRA---LR--------------------------
A1VVG1_POLNA/24-184----------------RERL..ALCVS---D-DP-K------QLIEVLA---MR--------------------------
A3U023_9RHOB/20-179----------------TERI...GVRF---A-GG-D------SMPFVYV---LR--------------------------
Q5HY19_GLUOX/8-170----------------REPV.RIVFAS---P-DD-L------IAPRVLS---LR--------------------------
Q3J4T6_RHOS4/6-183----------------AESR...WHLV---V-SS-G------SYPA...---DI--------------------------

PF14462

A1VQ26_POLNA/187-309----------------AADV-LVILPP---G-YP-D------VAPDMFF---CN--------------------------
Q6YRV0_SYNY3/5-127----------------EVDL-LILLPN---G-YP-D------IVPDMFY---LE--------------------------
Q8ZSK7_NOSS1/4-126----------------QADI-LILLPS---G-YP-D------APPDMFY---LL--------------------------
Q1QNK3_NITHX/244-367----------------VVTL-ALEIPG---P-YP-G------AQIDMFY---VH--------------------------
A4JA91_BURVG/127-248----------------KVDM-FVILPQ---G-YP-D------TQIDMVY---FS--------------------------

PF14460

Q3M1I7_ANAVT/44-224----------------LWAIKGRVF.K---PDTQLY------KPPL------PN--------------------------
Q8ZSF1_NOSS1/44-224----------------LWAVKGRVF.K---PDAQLY------KPPL------PN--------------------------
Q5NXB4_AROAE/51-225----------------VFAVQGRSRPR---PGTKLY------QAPY------WN--------------------------
B3ZY45_BACCE/33-211----------------VFAVKEDMELE---EGMKLY------QFPY------SN--------------------------
Q8A4F1_BACTN/53-225----------------IHAFKGA.IPE---ERTELY------LAPF------FN--------------------------
Q11ZD1_POLSJ/54-242----------------VFALEKSERPT---SDTSLY------RAPL------LN--------------------------
Q21Q52_RHOFD/56-227----------------VFALKENIKPG---PTTALH------HAPL------FN--------------------------
Q120V4_POLSJ/57-235----------------VYAYRGSAMPG---KETRLC------QAPL------FN--------------------------
A1VVA0_POLNA/62-240----------------VYAYKGSGRPD---KETKLY------QAPF------FN--------------------------
Q8XYU7_RALSO/54-226----------------VFALAKNERPA---PNTPLH------VAPY------FN--------------------------
Q5NUW6_RALME/54-226----------------VFALQGEDRPG---PETALF------EPPY------FN--------------------------
Q7WX34_CUPNH/54-226----------------VFALRGDERPV---PASELC------EPPY------FN--------------------------
A4JUM7_BURVG/54-227----------------VFAVACSDRPV---RETPLF------EPPY------FN--------------------------
Q47D10_DECAR/55-233----------------VWAVKGAGRPT---PATALF------QVPY------FN--------------------------
A0R7U7_PELPD/52-228----------------VCAVKGNTRPT---EDTPIW------QAPY------FN--------------------------
C3IV16_BACTU/30-216----------------CYAFRDKVF.R---DTTKLY------RFPF------SH--------------------------
C3IUY7_BACTU/30-236----------------TYVIKHELL.S---LKDKVF------HAPF------CN--------------------------

PF14459

Y4JF_RHISN/38-168----------------KS.AMVCLVAG---ATRPSL------RCTT-FF---IG--------------------------
Q98A20_RHILO/38-168----------------KS.ATICVVAG---VTRPPL------RCPT-FF---MG--------------------------
Q8KGV9_RHILI/4-134----------------KS.ATICVVAG---VTRPPL------RCPT-FF---MG--------------------------
Q2K2A4_RHIEC/38-168----------------SSALSHCLVVG---STNPEI------SCPK-FF---LG--------------------------

PF00179

UBC21_CAEEL/25-161---..RIWHPN--------ISSQT---GTI......CL.DILK............DK.......WTA.SLTLRTVLL.S-
UBC35_ARATH/9-141---..KIYHPN--------ID.KL---GRI......CL.DILK............DK.......WSP.ALQIRTVLL.S-
UBC24_ARATH/678-815---.GMRLNPN--------LY.ES---GRV......CL.SLLN............TWSGSGTEVWNAGSSSILQLLL.S-
UBC2_NEUCR/8-145---..EMFHPN--------VY.AT---GEL......CL.DILQ............NR.......WSP.TYDVAAVLT.S-
UB2L6_HUMAN/6-144---..KIYHPN--------VD.EN---GQI......CL.PIIS............SEN......WKP.CTKTCQVLE.A-
UB2G1_RAT/9-161---..EIWHPN--------VD.KN---GDV......CI.SILHEPGEDKYGYEKPEER......WLP.IHTVETIMI.S-
UBE2K_MOUSE/8-147---..KIWHPN--------ISSVT---GAI......CL.DILK............DQ.......WAA.AMTLRTVLL.S-
UBCX_YEAST/21-174---.NNILHCN--------VKSAT---GEI......CL.NILK............PEE......WTP.VWDLLHCVH.A-
UBC1_SCHPO/8-144---..KIYHPN--------VSSQT---GAI......CL.DILK............DQ.......WSP.VYTMKSALI.S-
UBC12_YEAST/31-172---..KIFHPN--------ID.LK---GNV......CL.NILR.............ED......WSP.ALDLQSIIT.G-
O48838_ARATH/33-171---..KIFHPN--------IS.EI---GEI......FV.DILG............SR.......WSS.ALTINLVLL.S-
UBC13_SCHPO/6-141---..KIYHPN--------VD.KL---GRI......CL.STLK............KD.......WSP.ALQIRTVLL.S-
Q9VH01_DROME/4536-4692---HSVRFNPN--------LY.ND---GKV......CL.SVLN............TWHGRPEEKWNAQTSSFLQVLV.S-
UBC14_SCHPO/11-149---..RIYHPN--------FD.SE---GNV......CL.AILK............QQV......FKP.SIKLRSVLE.Q-
Q9VZ73_DROME/14-153---..RMYHLN--------VN.ER---GQV......CV.PILE............VEH......WIP.TTRIDQVLQ.V-
Q9VJS5_DROME/7-142---..KIFHPN--------ID.RV---GRI......CL.DILK............DK.......WSP.ALQIRTVLL.S-
UBC84_DROME/6-144---..KIYHPN--------VD.EK---GEV......CL.PIIS............TDN......WKP.TTRTEQVLQ.A-
UBC15_SCHPO/9-160---..EIWHPN--------VH.PN---GEV......CI.SILHPPGDDKYGYEDAGER......WLP.VHSPETILI.S-
UBC9_CAEEL/8-152---..PLFHPN--------VY.PS---GTV......CL.SLLD............ENK.....DWKP.SISIKQLLI.G-
UBC34_ARATH/9-146---........--------...PN---GRFMTQKKICL.................SMSDFHPESWNP.MWSVSSILT.G-
Q43780_SOLLC/6-143---..KVWHPN--------ISSQS---GAI......CL.DILK............DQ.......WSP.ALTLKTALL.S-
UBC2_MEDSA/8-145---..RMFHPN--------IY.AD---GSI......CL.DILQ............NQ.......WSP.IYDVAAILT.S-
UBC2_YEAST/8-145---..EMFHPN--------VY.AN---GEI......CL.DILQ............NR.......WTP.TYDVASILT.S-
UBCX_PICAN/7-177---CYKMPHPN--------VNFKT---GEI......CL.DILQ.............QK......WSP.AWTLQSALV.A-
UBC12_DROME/30-165---..QVYHPN--------ID.LD---GNV......CL.NILR.............ED......WNP.VLNINSIVY.G-
UB2G2_MOUSE/8-159---..EMFHPN--------IY.PD---GRV......CI.SILHAPGDDPMGYESSAER......WSP.VQSVEKILL.S-
Q95039_PARTE/244-382---..KLYHPN--------VS.RG---GSL......CL.DVLN............TS.......WSP.LLTTTKVLD.A-
UB2J2_MOUSE/16-153---........--------...PN---GRFKCNTRLCL.................SITDFHPDTWNP.AWSVSTILT.G-
UB2L3_MOUSE/6-144---..KIYHPN--------ID.EK---GQV......CL.PVIS............AEN......WKP.ATKTDQVIQ.S-
UBE2C_DROME/36-172---..SCFHPN--------VD.LQ---GAI......CL.DILK............DK.......WSA.LYDVRTILL.S-
AKTIP_MOUSE/72-217---..PVFHPL--------VDPTS---GEL......DVKRAFA....................KWRRNHNHIWQVLMYA-
UBC3_YEAST/11-164---..AIYHPN--------VY.RD---GRL......CI.SILHQSGDPMTDEPDAET.......WSP.VQTVESVLI.S-
UBE2C_SPISO/34-170---..PCWHPN--------VD.QS---GNI......CL.DILK............EN.......WTA.SYDVRTILL.S-
Q9VGD6_DROME/17-152---..KILHPN--------IEFIT---GLV......CM.NVLK...............Q....AWSS.SYDLVNIFETF-
Q9XZ32_DROME/1125-1274---CTDRLNPN--------LY.EG---GRV......CV.SLLG............TWMGRDNEVWSP.SSTMLQVLV.S-
UBC9_YEAST/8-152---..GFYHPN--------VY.PS---GTI......CL.SILN............EDQ.....DWRP.AITLKQIVL.G-
Q9TZ69_CAEEL/8-147---..KIWHPN--------VSSQT---GVI......CL.DILK............DQ.......WAA.SLTLRTVLL.S-
UBCD2_DROME/90-225---..RIYHCN--------IN.SQ---GVI......CL.DILK............DN.......WSP.ALTISKVLL.S-
UBC12_MOUSE/33-168---..MVYHPN--------ID.LE---GNV......CL.NILR.............ED......WKP.VLTINSIIY.G-
Q20617_CAEEL/17-156---..NVYHPN--------VDPVT---CEL......CS.PMLL............QEN......WKP.ETTMEDVLL.N-
UBC12_SCHPO/27-162---..KIYHPN--------ID.IE---GNV......CL.NILR.............QD......WNP.VLNLNSILV.G-
SCE1_ARATH/9-153---..GFFHPN--------VY.PS---GTV......CL.SILN............EDY.....GWRP.AITVKQILV.G-
UBC9_MESAU/8-152---..PLFHPN--------VY.PS---GTV......CL.SILE............EDK.....DWRP.AITINQLFI.G-
UBC7_YEAST/8-159---..SILHPN--------IY.PN---GEV......CI.SILHSPGDDPNMYELAEER......WSP.VQSVEKILL.S-
UBCD4_DROME/8-147---..RIWHPN--------ISSVT---GAI......CL.DILK............DN.......WAA.AMTLRTVLL.S-
Q9VYN3_DROME/66-201---..RIYHCN--------VD.SR---GAI......CL.DVLG............ER.......WSP.VMNVAKVLL.S-
Q20872_CAEEL/39-180---..PLHHPN--------VD.LR---GSI......YL.KMLE............QEH......WSS.ETSLKKLLR.E-
UBC7_SCHPO/9-160---..EFFHPN--------VY.KD---GTV......CI.SILHAPGDDPNMYESSSER......WSP.VQSVEKILL.S-
UB12L_ARATH/35-171---..KVYHPN--------ID.LE---GNV......CL.NILR.............ED......WKP.VLNINTVIY.G-
UBC8_YEAST/7-143---..KIFHPN--------IDIAS---GSI......CL.DVIN.............ST......WSP.LYDLINIVEWM-
UBE2S_HUMAN/15-152---..KIFHPN--------VG.AN---GEI......CV.NVLK............RD.......WTA.ELGIRHVLL.T-
Q9Y165_DROME/341-479---..KILHPN--------VS.RH---GDV......GI.DIFQ............QHN......WSL.ALNVAKVLL.S-
UBCB_DICDI/6-141---..KIYHPN--------IKTSD---GAI......CA.EVFS.............T.......WSP.QLKILDVLT.T-
UBE2A_MOUSE/8-145---..KMFHPN--------VY.AD---GSI......CL.DILQ............NR.......WSP.TYDVSSILT.S-
UBC11_YEAST/12-150---..PMWHPN--------VD.KS---GNI......CL.DILK............EK.......WSA.VYNVETILL.S-
UBC9_SCHPO/8-152---..PLFHPN--------VY.PS---GTV......CL.SILN............EEE.....GWKP.AITIKQILL.G-
UBC5_ARATH/7-143---..KIYHPN--------VDEMS---GSV......CL.DVIN.............QT......WSP.MFDLVNVFETF-
Q9U1Q1_CAEEL/8-159---..GIFHPN--------IY.AD---GRV......CI.SILHAPGDDPTGYELSNER......WSP.VQSIEKILL.S-
UBC13_ARATH/8-159---..DIWHPN--------VY.PD---GRV......CI.SILHPPGDDPSGYELASER......WTP.VHTVESIML.S-
Q9XWF6_CAEEL/8-149---..IPAHPH--------IY.SN---GHI......CL.SILS............DD.......WTP.ALSVQSVCL.S-
Q6AWG5_DROME/66-223---..KVWHPN--------VY.EN---GDL......CI.SILHPPVDDPQSGELPCER......WNP.TQNVRTILL.S-
UBC7_WHEAT/11-161---..EMWHPN--------VY.PD---GRV......CI.SI.HPPGDDPNGYELASER......WTP.VHTVESIVL.S-
Q9VFR8_DROME/9-160---..EIWHPN--------ID.KA---GDV......CI.SILHEPGDDKWGYEKAEER......WLP.VHTVETILL.S-
Q9U5Q3_9CILI/34-174---..KVFHPN--------FY.VN---GEI......CI.DILK............DQ.......WSP.IYDIKSILT.S-
Q9VQ00_DROME/25-160---..PIYHCN--------IH.RL---GFI......CL.DILK............EK.......WSP.ALTISKILL.S-
UBC11_SCHPO/32-170---..PMWHPN--------VD.MS---GNI......CL.DILK............DK.......WSA.VYNVQTILL.S-
UBC17_ARATH/19-158---..APLHPH--------IY.SN---GHI......CL.DVLY............DS.......WSP.AMRLSSICL.S-
UBE2C_HUMAN/34-170---..PCYHPN--------VD.TQ---GNI......CL.DILK............EK.......WSA.LYDVRTILL.S-
UBE2H_MOUSE/10-145---..KIFHPN--------IDEAS---GTV......CL.DVIN.............QT......WTA.LYDLTNIFESF-
UBC6_ARATH/7-143---..KIYHPN--------VDESS---GAV......CL.DVIN.............QT......WSP.MFDLINVFESF-
UBC15_ARATH/19-158---..APSHPH--------IY.SN---GHI......CL.DILY............DS.......WSP.AMTVNSVCI.S-

PF14461

Q4FRY8_PSYA2/12-152---IEQVLLPH--------INS.G...GYL------CYVEEKE------------ADWNP----NNL-NALYRAVD.EQ-
A5G3M9_GEOUR/17-151---FG..ILPH--------VET.D...GYI------CYAQEDG------------SVLDF----DDV-AGIAQEAL.SR-
Q2K8Q4_RHIEC/18-161---K...WSYH--------QYGKG...GAL------CL....E------------LRPDN----WTS-RANGADVL.RS-
Q8KW20_9RHOB/16-149---R...LSQH--------QYGEG...GEL------CL....Q------------YRPDN----WHP-DCKSADVV.RS-
D3GMN6_9ENTR/13-154---FKSCLMPH--------VAL.E...GFL------CYVEQME------------ADWDS----NDL-EATYKEVD.AQ-
A0L3D6_SHESA/1-142---RLAHVSVH--------EYA.GIQIGTV------CVNAPES------------LSVNF----EQP-LLVVEESL.RR-
A3W6V2_9RHOB/1-135---LPKRLTGH--------IVS.D...GTL------CYADKAT------------FLLDR----YQP-DRSVVSCL.EQ-
Q2NBP1_ERYLH/4-143---LPAGAFGH--------ISRDDIEGSVV------CFAPATG------------LPLDF----HDP-GGSVLRVL.RQ-
Q2L5J8_CLOPF/12-145---IK..FIPH--------LEE.N...GKI------CLFDK.E------------GLLVE----ENL-NGIAIESI.ER-
A0AW81_ARTS2/19-154---....MPHH--------WNPFS...NEV------CLL...G------------TPSEE----WGT-NGSLAQLLKDQ-
A3TSK9_9RHOB/18-157---....WSSH--------QYS.G...GSL------CL....E------------LRPDN----WIP-TATGADVL.ES-
A3GXG6_VIBCL/12-153---YKGRLLPH--------INF.G...FCL------CYVTQME------------ADWNS----NDL-KSTYQDVD.EQ-
E0TAZ7_PARBH/17-149---RL..LWPH--------VET.A...GLL------CVFPT.Q------------TNIDA----FEP-EKVATALI.TD-
Y4OA_RHISN/9-149---....LERH--------QNPFT...RDL------CLL...T------------QDSAQ----WYP-HQMVADFIAER-
Y4QC_RHISN/29-153---YP...ERH--------CGS.E...GAL------CLL...G------------RDTRY----WQA-NMSLAELLDEN-

PF05743

Q7Q6B6_ANOGA/22-142...RIKVSA.Y--------VD-FN---GKI------.YLPYLH--------------------DWNP-..KNAD.....-
UEVLD_HUMAN/21-141...GILVGK.H--------VD-AQ---GRI------.YLPYLQ--------------------NWSH-..PKSV.....-
Q6FS29_CANGA/27-147..LQLATNE.S--------VE-PD---GRV------.HTRLLR--------------------QWNP-..QSAN.....-
Q4SDZ6_TETNG/21-141...VIREGK.H--------VD-AR---GRI------.FLPGLQ--------------------NWDY-..PKSS.....-
Q4TA00_TETNG/24-145...VINPACSC--------AD-AA---GLL------.HLDGLR--------------------NWTG-..GASS.....-
UEVLD_XENTR/21-141...GIRVGR.H--------ID-AQ---GRI------.YLPYLQ--------------------NWSH-..PKST.....-
Q5KKQ1_CRYNJ/24-146...GVRKSR.E--------VE-PS---GRV------.REEVVE--------------------GWWR-AWEVKN.....-
TS101_RAT/21-141...TIKTGK.H--------VD-AN---GKI------.YLPYLH--------------------DWKH-..PRSE.....-
Q5BAA9_EMENI/33-155...VVRVGQ.H--------VT-LE---GRV------.YHHYLA--------------------HWGG-AWERSS.....-
Q75EU1_ASHGO/32-146...SIIVNQ.R--------LD-GD---GLF------.YLPILG--------------------HWHP-..QNCN.....-
STP22_YEAST/31-162ISSSLPIQE.Y--------ID-SN---GWI------.ALPILH--------------------CWDP-..AAMN.....-
Q4UHS4_THEAN/19-133...KIVKNHPN--------VD-LR---GNV------.TLKYLD--------------------EWNH-...TSK.....-
O76258_CAEEL/21-141...VIKESE.H--------VN-KE---GKV------.FLPYLN--------------------EWRF-..PGYD.....-
Q9VVA7_DROME/22-142...QIKVSM.Y--------VD-HN---GKV------.YLPYLH--------------------DWQP-..HSSD.....-
TS101_DICDI/47-167...RIVKNHHH--------VN-LQ---GLV------.YHPYIS--------------------SWSS-...NST.....-
P78998_SACPS/31-154ISSSLPVQA.Y--------ID-SD---GRV------.ALPILD--------------------HWNP-..ATMG.....-
Q4PAN2_USTMA/23-145...AIRKGP.N--------VD-PS---GEI------.GGDYLS--------------------RWRS-KPEACN.....-
UEVLD_DANRE/21-141...VIREGK.H--------VD-SK---GRI------.HLPALH--------------------NWDH-..PKSS.....-
Q6ESB7_ORYSJ/45-167...VIKPHHPL--------VD-RS---GLV------ANAPYLR--------------------SWVF-..PSSN.....-
ELC_ARATH/37-158...IIKRPHAH--------VT-PS---GLV------.SLPYLQ--------------------NWVY-..PSSN.....-
Q59WF8_CANAL/24-164...YLKPNN.N--------VD-TQ---GMF------.YHPYLT--------------------RWHR-ECLRSNPDSLN-
Q4N7T6_THEPA/34-148...KIVKNHPN--------VD-LR---GNV------.TLKYLD--------------------EWNH-...TSK.....-
Q4SAD8_TETNG/22-142...MIKTGK.H--------ID-AN---GKI------.YLPYLH--------------------EWKH-..PQSD.....-

PF08694

UFC1_ARATH/6-167---EIDGKTQK--------MY-RG---GKI------CLTVHFK-------------------PLWAK-NCPRFGIAHAL-
UFC1_AEDAE/4-164---ELDGKTAK--------MY-RG---GKI------CLTDHFK-------------------PLWSR-NVPKFGIAHAM-
A0DET8_PARTE/1-156---SLDGLTPK--------MY-RG---GKI------CIDIHFA-------------------PLWQK-NAPKFGIVHAL-
UFC1_RAT/4-164---ELDGKTAK--------MY-RG---GKI------CLTDHFK-------------------PLWAR-NVPKFGLAHLM-
Q4N8N9_THEPA/4-172---SLEGKTAK--------MY-RG---GRI------CLDAHFL-------------------PLWQK-NAPKYGIAHGL-
Q4DHG1_TRYCC/3-163---ELEGKTVK--------MY-RG---GKI------CMTTHFF-------------------PLWAR-NVPYFGISHAL-
Q5DBD5_SCHJA/4-164---ELDGKTAK--------MY-RG---GKI------CLTDHFK-------------------PLWSR-NVPKFGIAHAI-
Q22BA5_TETTS/2-180---ELDGKTHK--------MY-RG---GKI------CLDIHFA-------------------PLWAK-NSPKFGIAHAL-
UFC1_DICDI/3-163---ELDGKTEK--------MY-RG---GKI------CLTIHFK-------------------PLWSR-NVPHFGIAHAL-

PF05773

Q4WEH2_ASPFU/8-134-----ASTGAR--------.....---......................................GE-GKIAVDVLEDI-
Q4WU06_ASPFU/41-154-----NSENIR--------.....---.....................................HRA-RLKIQDIIRNK-
Q757B9_ASHGO/407-512-----TFDKNY--------K....---...................................LPNYI-KQQIIKNLLHH-
RNF25_HUMAN/11-125-----NPRGLS--------.....---.....................................DEQ-IHTILQVLGHV-
Q4WZQ4_ASPFU/386-489-----GTGIPA--------.....---......................................YI-RLSAIRQAVQF-
Q4WQA1_ASPFU/1-121-----SPPNAP--------KHP..---.................................LLDIQED-RERLLEALQPT-
Q4WDC1_ASPFU/6-159-----TNPPWL--------.....---....................................SHSI-ILRLTEDGNRL-
E2AK4_HUMAN/18-134-----NAKGLS--------.....---.....................................NES-VNLLKSRLEEL-
IMPCT_XENLA/7-113-----APWLRG--------.....---......................................ED-RLTLSNCLEEM-
Q6BMK3_DEBHA/392-504-----VNNNSF--------K....---...................................LANYI-KLSILRQLIQY-
Q6BNZ6_DEBHA/2-136-----IPEEEE--------EEISD---DESDDENEN.............ETKLMLNLSETIEFESQD-INQLVSKLIEE-
Q6BX55_DEBHA/1-103-----NNNTRK--------.....---.....................................YAD-KNYLETQVKET-
Q6BWT3_DEBHA/17-158-----TTILSD--------.....---......................................SD-VESLYSSLHKL-
IMPCT_CAEEL/2-99-----GPYLRR--------.....---......................................EQ-KEVLHNSLNDV-
Q640E2_XENLA/7-130-----SVALDR--------.....---......................................QQ-QNFLNKELGSY-
Q5ADM3_CANAL/405-504-----VSKNEY--------T....---...................................LANYI-KLAIVRELLKY-
Q59S39_CANAL/9-125-----NARNLL--------.....---.....................................KIN-IAKLEKKCKDL-
Q6YUR1_ORYSJ/47-192-----AKWLDE--------.....---......................................PE-VSSFCSVLDEI-
YL419_YEAST/423-528-----TFDKNY--------K....---...................................LPDYI-KKQILTRLLHY-
Q5AU57_EMENI/6-130-----ASTAAR--------.....---......................................GE-GKIAVDVLKDI-
RWDD3_PONAB/1-111-----SEQLTR--------.....---......................................AQ-CVTVKEKLLEQ-
Q3ZAU6_RAT/4-134-----GKWLSP--------.....---......................................TQ-LSALCKHLDNL-
Q4PDS7_USTMA/6-155-----DTKGIL--------GPQTD---ESEE........................SGTESGTVERPS-VAELQAELDEV-
Q20871_CAEEL/2-135-----SYWMNQ--------.....---......................................EQ-MTSCETELAKI-
IMPCT_DICDI/1-152-----ATWLQK--------.....---......................................SD-QSILLSHLEDL-
Q55GT9_DICDI/415-519-----SAKSTP--------.....---......................................IT-NQIVIRSILNE-
Q4CY49_TRYCC/190-316-----PCGNQV--------GTLPI---L.............................GVFHADTKEL-PAALRRSILDA-
Q4P4B8_USTMA/14-135-----LNDGRH--------KG...---...................................LSASH-LTSLGGALNRK-
RWDD3_DANRE/1-109-----SNHLSR--------.....---......................................RQ-CHDLRRSLLDT-
Q75F11_ASHGO/10-125-----KVQNVL--------.....---.....................................DSQ-LALLRDDIRRI-
Q9VZ55_DROME/176-361-----TTCHDI--------.....---....................................PHEL-RLRYARHLYKE-
A8X836_CAEBR/4-137-----SDWMNQ--------.....---......................................EQ-RKMCESELSKI-
Q9XVY4_CAEEL/15-135-----DPQGLS--------.....---.....................................KED-VQNLLTILRQM-
Q86I15_DICDI/66-198-----CDWLSE--------.....---......................................NC-LCTLSNQLITL-
Q4RFR0_TETNG/5-135-----CSGLSR--------.....---......................................AQ-QTQLHTELHDY-
Q9LQM5_ARATH/184-320-----VQWMNP--------.....---......................................DK-ISSLCSKLDSL-
Q6FVK3_CANGA/2-158-----VEETLL--------NSDDE---GEGEDEDEDEQQYD...EHGNRLMSKYENIPDTISIADYV-SGPLVAELEEQ-
Q6CTZ2_KLULA/2-106-----AKISAL--------.....---......................................YD-VKYLNHLFTEV-
Q5JKR6_ORYSJ/3-122-----SVRGMK--------.....---.....................................SED-LASLKEKLEQE-
Q7X7C1_ORYSA/108-233-----VKWMDG--------.....---......................................PN-VSQLCKMLDTI-
Q8IDE3_PLAF7/67-179-----VKNFTP--------.....---......................................DT-NNYINEEVYRY-
Q4SZQ6_TETNG/2-108-----AFFNNR--------I....---....................................SAET-KQLILTRLEEQ-
YIH1_SCHPO/2-94-----......--------.....---.......................................D-AYGIDKTLAED-
Q4RIS5_TETNG/2-125-----SKWMTA--------.....---......................................AQ-MSCLCRRLDEL-
Q6CDD7_YARLI/1-89-----......--------.....---......................................ST-EHVDKGLVEDI-
Q5BB34_EMENI/40-153-----NLEDLR--------.....---.....................................QGA-QSRIRDVLQNK-
Q9VJ60_DROME/3-109-----AFYNRN--------L....---....................................LPAV-KEGIQTALSTE-
Q7S2B9_NEUCR/1-108-----GEHAKR--------.....---......................................GA-AARDLALFRDA-
Q7Q0B4_ANOGA/9-123-----HAVGLS--------.....---.....................................DSL-VRELTEKLEQL-
Q4STD1_TETNG/1-114-----CSWLSH--------.....---......................................TQ-VQNLV......-
Q4D6B4_TRYCC/5-103-----AGPNAH--------.....---.......................................L-VNQFSSQLNKA-
Q95RT3_DROME/4-116-----EPENFE--------.....---.....................................DMF-ETRLLEHLQKT-
ITT1_SCHPO/9-132-----SSWLPL--------.....---......................................KQ-KRVLTSSLIKL-
Q6CTQ8_KLULA/10-125-----NVINVP--------.....---.....................................DGQ-LNKLRQEIKEI-
Q8X0V7_NEUCS/437-541-----AALPSY--------.....---.......................................I-KLSVIKQALAY-
IMPCT_MOUSE/7-113-----APWLKG--------.....---......................................QE-RADLSNSLEEI-
Q4RHJ9_TETNG/221-397-----TTDESV--------.....---....................................GAAG-RLCVSERLFSE-
Q4RLP9_TETNG/13-130-----NVKGLS--------.....---.....................................NEK-VQNLQNELTKL-
Q6C972_YARLI/2-130-----RGQAAE--------EDYDS---DEEEVEE..................TLDYEGEPVFLDAED-YAELTSKMQEV-
Q9C2M7_NEUCS/8-183-----ADPPWL--------.....---....................................SKDT-IKRLEDDGPRL-
Q6CS85_KLULA/412-516-----TFDKSY--------K....---...................................LPNYI-KLTILEKLLHF-
Q8T6F6_DROPS/41-151-----EKRNVS--------.....---.....................................IAL-EWALHEEIVQS-
Q3ZC53_BOVIN/3-111-----AQLNLE--------.....---.....................................DND-VADILKLLALQ-
Q5A855_CANAL/1-106-----KTTQSS--------.....---....................................SFTD-IAYLEKHVDEI-
YCF9_SCHPO/1-111-----FSEPHP--------W....---...................................LGEEE-IERLKQVVAQN-
Q6CDA6_YARLI/420-527-----AIKKGH--------R....---...................................LPHYI-QLAIMRRALEM-
Q7QK93_ANOGA/171-363-----TTCSDI--------.....---....................................PEQL-CLRVNRRLVQE-
Q5RIL0_DANRE/1-124-----CAELIR--------.....---......................................SQ-QMQLHSDLNNY-
Q6FSE4_CANGA/10-125-----ERSNVT--------.....---.....................................DTQ-IKVLENRLKEI-
Q8MZ95_DROME/27-143-----EKRNVS--------.....---.....................................DAF-EQVLRKEIDLI-
Q4QCY6_LEIMA/5-109-----CISKAR--------.....---.....................................RIQ-VGAITKQVASI-
Q5PQ37_XENLA/4-135-----SISLVR--------.....---......................................SQ-QAQLNLDLSNY-
Q7QBP1_ANOGA/4-115-----EPSNFH--------.....---.....................................DGY-EEELLEHIHKT-
Q7XSB8_ORYSJ/29-143-----PEKTLS--------.....---.....................................RED-ANRLLSLLVDQ-
Q750B2_ASHGO/2-157-----PWDVRG--------GDEAG---EEDEEQEYDEH.........GNPVVAKLENIPDSISFDGE-VDGFASQAMRQ-
Q5AYM1_EMENI/6-166-----TNPRWL--------.....---....................................PLWA-VSKLLDDGKRL-
Q7SXJ6_DANRE/2-114-----NPRGLS--------.....---.....................................DDK-LLSLQKSLQME-
Q7F9L6_ORYSA/43-178-----SQWLDT--------.....---......................................VK-VSSLCLMLDTI-
Q4DGH6_TRYCC/4-108-----HIAKHR--------.....---.....................................RMQ-TAALAKEIEDL-
Q5CGP2_CRYHO/1-151-----ILDGKY--------SMNEC---PIDNYHDEE..............SDDNRILFDDSTCIYIN-TDEVINYYDSL-
Q75EM4_ASHGO/2-106-----HEKVQR--------.....---......................................YE-RSDLQPVCEEL-
RWD2A_MACFA/7-131-----SSELDR--------.....---......................................HQ-QLLLNKGLTSY-
Q6CB97_YARLI/1-115-----SLWMTD--------.....---......................................GQ-IAKLTTDLIHQ-
IMPCT_DANRE/10-115-----AAWLRG--------.....---......................................QD-RMTLSNSLEEI-
Q5KE91_CRYNJ/3-101-----AIDEES--------GD...---...................................LTEEE-REKVLGELNSI-
Q7PMA0_ANOGA/3-108-----TFYNRN--------L....---....................................SRSA-KDSIASILNEE-
Q5ANG1_CANAL/15-141-----CVWLAT--------.....---......................................SK-TDLLTKDLYDI-
GCN2_SCHPO/9-124-----NGENVL--------.....---.....................................NSQ-IRFLLDKLDTK-
Q7SCW3_NEUCR/1-116-----SAPNAP--------PHQ..---.................................YINIADD-RFQLLEGIQET-
Q5DET7_SCHJA/1-111-----KPENLS--------.....---.....................................DED-ISDMHNIINEV-
Q4KLB7_XENLA/4-134-----CKWLSP--------.....---......................................SQ-LTHLCHRLDEL-
Q5DEU0_SCHJA/3-107-----CFYNQH--------V....---....................................PQDV-KEKIVAELVSV-
Q55I55_CRYNB/4-118-----EPEYLT--------.....---.....................................ANH-VQQLHKIIQDK-
GIR2_YEAST/2-156-----AQEVAL--------NDNEE---DNEEDEDEVEYDD......HGNKVLKKFENLPDLISFKGY-LPELTVQLESQ-
Q5M8G9_XENTR/55-165-----NPRGLC--------.....---.....................................DDQ-INSIVSSLRSV-
Q9C8I1_ARATH/3-122-----SIRGIH--------.....---.....................................VSD-LTILKEKLEQE-
GCN2_ARATH/30-145-----PEQGLT--------.....---.....................................TAD-AEKLLSLLEDQ-
IFKC_DICDI/67-194-----VNKGLP--------.....---.....................................QKK-AIELEEKLIRE-
O01712_DROME/9-127-----ESKGMS--------.....---.....................................DQL-LEALRNQLQAQ-
Q55CB4_DICDI/4-208-----SCWLTL--------.....---........................................-.KQMKSLLDEL-
Q6FMC2_CANGA/1-102-----QGD...--------.....---......................................YD-SKYLTTLFQEV-
O74297_NEUCS/43-157-----DDHSLR--------.....---.....................................EST-KFKIQKFVETQ-
DHX57_HUMAN/243-419-----STNENL--------.....---....................................PLAC-RLHISEFLYDK-
Q6FPE1_CANGA/415-520-----TFSKKI--------K....---...................................LPNYI-KKQVMIKLLHH-
Q5AGV1_CANAL/2-149-----LAESPE--------DKDNY---DNGDSDEGDSDDDDDDDENADLKLALNMAETIEFDPKTDL-NDTLMNKLLEE-
Q4CVK5_TRYCC/246-363-----GGPAAH--------HV...---...................................FFERW-KLQLITKTLAY-
Q4TU20_ARATH/1-111-----ESKGLD--------.....---.....................................EQR-QKLLIGIVQEK-
O18131_CAEEL/2-116-----GIEDAF--------.....---....................................TAER-IAESIDKLRSV-
Q6CQJ5_KLULA/2-165-----PEEVPK--------FDRDD---EDVDDEDDEDKDEIE.YDDHGNPIVSKFENIPDKIHFDEF-IPQCIEKLNEQ-
Q4Y347_PLACH/2-106-----DGKNVS--------.....---.....................................ETL-KANIEQQIKET-
RWDD4_RAT/2-108-----AFFNNT--------I....---....................................SSAV-KQSILAKLQEA-
Q6IQ68_DANRE/3-126-----SKWLTR--------.....---......................................VQ-ITALCRKLDEL-
Q4XYA3_PLACH/66-179-----VKNFTV--------.....---......................................DM-NNYINQEIYKD-
Q5DGN4_SCHJA/1-112-----CVHGLK--------.....---.....................................EKD-ISNLLSYLKEL-
Q556K0_DICDI/1-107-----PHLGLE--------.....---.....................................KED-ILELQGKVIQE-
DHX57_MOUSE/243-419-----STNENL--------.....---....................................PLAC-RLHISEFLYGK-
RWD2B_HUMAN/34-162-----SVLLSR--------.....---......................................SQ-QTQLNTDLTAF-
Q4CLS7_TRYCC/23-139-----IPEGVT--------PGSI.---.................................GALDESG-AHQIQADIREA-
Q55VL2_CRYNB/13-165-----APLFKG--------HDDKL---................................GSWLFQND-LKEIESRLRRM-

PF14457

Q21PA7_SACD2/14-175-----EDFPLT.......LPHINPVVEGED......ISPCIAEVDL.....TDLLHSSGI.....EAVFGAMTHWLNNA-
A0L5E1_MAGSM/13-169-----QRFMG........QAHVQWG...........NQICLYLATD.....VEWSASDGM.....FGFIKRLDQWLGDA-
Q4ZFT1_CLOPF/15-178-----NDFPVEK......LPHTLAMGLNY.......SYICLHRGNI.....DDWYIDHSV.....EDFVNRIRFWFSDA-
A9BTW4_DELAS/5-166-----ADFPLN.......LPHINPHRQGEL......VSPCLFEGSL.....NELLHRFGL.....DAVVDQLIDWLHKA-
A1U5J0_MARAV/18-180-----SDFPREF......VPHIYPGSPGDP......VCPCIAEVGI.....TDLMFQEGI.....SGVLRSLQAWLDRA-
Q3SNL9_NITWN/14-180-----MDFPRD.......LPHVQPGPVTEP......PRPCLIDGNQ.....REYFFQFGLVELGIFNLVHQLVLWLQRA-
Q8PFM8_XANAC/22-182-----KTFPKA........LHQYATGNEGP......PSLCIMEGDW.....ELAEHRFTP.....EALLETLLAWLEKT-
A1U033_MARAV/19-179-----SDFPVT........MHQNHVEPNSP......RSLCLYVEPW.....SSVERTWSP.....QSFLARALWWLRET-
A1VVG1_POLNA/24-184-----KDFPVL........MHQNQGILDAP......ASLCLYFESV.....AAVMRTWTP.....QSFLRRIQWWLEKS-
A3U023_9RHOB/20-179-----SDFPDT........AHQNLTAEGSP......RAICIDDRGW.....AEARLTWTP.....AELVQRILAWFRRA-
Q5HY19_GLUOX/8-170-----EDFPSG.......QVHTNLDREVDG......LCLCIWEEGW.....HDLSRNLTG.....QALVERIRWWFAGM-
Q3J4T6_RHOS4/6-183-----FILPDKVAGPNLTFPHQAAVYSRDGKEPWLNGEPCLTDPTAAFGDRHGSRPEPIAL...ADRLIWKVERFSRWC-

PF14462

A1VQ26_POLNA/187-309-----LWLTLVSAGRYPTCADQPHTFMGHN----------------------------------WQR--WSRH...NNS-
Q6YRV0_SYNY3/5-127-----PAVKLVQGNRPPRATEARQQFNGRS----------------------------------WQR--WSRH...ERE-
Q8ZSK7_NOSS1/4-126-----PWVKLVQGAKYPKAADQPHQFNGQK----------------------------------WQR--WSRH...NNE-
Q1QNK3_NITHX/244-367-----PALRRLVGEEIP.ATQATETVLGRI----------------------------------FQR--WSRHRGPNSP-
A4JA91_BURVG/127-248-----PPLTRNDGKPI..RSLVTNEFEGKT----------------------------------WQG--WSRHRTANSP-

PF14460

Q3M1I7_ANAVT/44-224-----VWEDSS--------ICFGG..NSLS.MCSAATISQVWDLFWKSPFNKDLSQGKS.....KTHPDNIC........
Q8ZSF1_NOSS1/44-224-----VWEDSS--------ICFGG..NSLS.MCSAATISQVWDLFWKSPFNKDLSQGKS.....KTHPDNIC........
Q5NXB4_AROAE/51-225-----VWKGGR--------ICAGS..ARLP.SAGLQADPSGWEESFFSSR..............FSHPNIHEKDALVKYK
B3ZY45_BACCE/33-211-----VHPSGS--------VCTGR..VVIP.EFRTLKDLETFHVLFFASS..............FNHDLTHTHTEP....
Q8A4F1_BACTN/53-225-----VAG.AN--------VCLGSSSPKKPQDMDFLEFQEYWEKRFWMSE..............FSHLGGNRNP......
Q11ZD1_POLSJ/54-242-----VGEDGS--------VCWGD..GVKP.AGKTVKDISAWQALFFSSV..............FTHYNGTVPIVGDD..
Q21Q52_RHOFD/56-227-----VFANAE--------VCAGS..MQKP....KDGNAKEWVESFYAAT..............FTHANPPSRRLTTYRQ
Q120V4_POLSJ/57-235-----VWARGE--------VCVGN..ASRP.DDSAKGNPQAWERFLFDSH..............FTHPNFAQVDRLTKGV
A1VVA0_POLNA/62-240-----VWSQGK--------VCTGN..AAMP.VGDNAAIPHMWVDAFFGSN..............FTHPNFKEKDRLVKGV
Q8XYU7_RALSO/54-226-----VWERGE--------ICTGN..VSLP.DRPAPDALKAYETAFFDSR..............FTHPNHARITRHKDG.
Q5NUW6_RALME/54-226-----TWDHGR--------ICIGS..AQVP.KQIDVASISGWEEGFFNSA..............FTHPNHGGKRVAYERG
Q7WX34_CUPNH/54-226-----TWDHGK--------ICIGS..AHVP.KQIDVASIAGWEAGFFNSA..............FTHPNHGSKRVTYERG
A4JUM7_BURVG/54-227-----TWDMGR--------ICIGS..AQVP.KRVDVASIDGWEAGFFDSA..............FTHPNAGGKRIEYKDG
Q47D10_DECAR/55-233-----VNVQGN--------ICHGN..APVP.EGTTVEKIAAWNDAFLRSY..............FTHPNGPGKLIRYRGG
A0R7U7_PELPD/52-228-----VWSSGN--------ICTGT..IETP.KSVAVTETGKWEECFFSSY..............FSHPNAHGSRQLINSR
C3IV16_BACTU/30-216-----VQKDGE--------MCFFF....LT.EMQDLAQMSSFIHNWLSAA.............FTDHYYNLENKNKW...
C3IUY7_BACTU/30-236-----IGISHG--------ICWGR...TLP.EVPIPKSIQSIPARFFSQPFNYDLSGNRVKPFEWTHPNGNTEDTECAVY

PF14459

Y4JF_RHISN/38-168----------------------------------------------------------------SDGWAAKLSRTDPVG-
Q98A20_RHILO/38-168----------------------------------------------------------------SDGWAAKLSRTDPVG-
Q8KGV9_RHILI/4-134----------------------------------------------------------------SDGWAAKLSRTDPVG-
Q2K2A4_RHIEC/38-168----------------------------------------------------------------SDGWIAKFSPEEPVG-

PF00179

UBC21_CAEEL/25-161----LQAML......CSP.EPSDPQDAV--VA...KQFINN.YP...MFTATA..--VY----------
UBC35_ARATH/9-141----IQALL......SAP.NPDDPLSEN--IA...KHWKSN.E......AEAV..--DT----------
UBC24_ARATH/678-815----FQALVL....NEKPYFNEAGYDKQ--LG...RAEGEKNSV...SYNENA..--FL----------
UBC2_NEUCR/8-145----IQSLL......NDP.NTGSRANVE--AS...NLYKDN.RK...EYHKRVRE--TV----------
UB2L6_HUMAN/6-144----LNVLV......NRP.NIREPLRMD--LA...DLLTQN.PE...LFRKNAEE--FT----------
UB2G1_RAT/9-161----VISML......ADP.NGDSPANVD--AA...KEWRED.RN..GEFKRKVAR--CV----------
UBE2K_MOUSE/8-147----LQALL......AAA.EPDDPQDAV--VA...NQYKQN.PE...MFKQTA..--RL----------
UBCX_YEAST/21-174----VWRLL......REP.VCDSPLDVD--IG...NIIRCGDMS...AYQGIVKY--FL----------
UBC1_SCHPO/8-144----LQSLL......CTP.EPSNPQDAQ--VA...QVYLQN.YQ...QFVRTA..--RE----------
UBC12_YEAST/31-172----LLFLF......LEP.NPNDPLNKD--AA...KLLCEG.EK...EFAEAVRL--TM----------
O48838_ARATH/33-171----ICSIL......SNP.VEPLLVSNH--AA...RLYQKD.RK...AYEKVARE--WT----------
UBC13_SCHPO/6-141----IQALM......GAP.NPDDPLDND--VA...KIWKEN.EP...QAIANA..--RE----------
Q9VH01_DROME/4536-4692----IQSLIL....VPEPYFNEPGFERS--RG...SPSGTNSSR...EYNSNI..--YQ----------
UBC14_SCHPO/11-149----ILQLL......REP.NPDDPLVAS--IA...EQYRND.RP...SFDKIARD--YV----------
Q9VZ73_DROME/14-153----LLATI......NDP.QPENAWHIE--MA...GEYRND.PV...RFFKMADA--WV----------
Q9VJS5_DROME/7-142----IQALL......SAP.NPDDPLAND--VA...ELWKVN.ER...RAIQLA..--RE----------
UBC84_DROME/6-144----LVAIV......HNP.EPEHPLRSD--LA...EEFVRE.HK...KFMKTAEE--FT----------
UBC15_SCHPO/9-160----VISML......SSP.NDESPANID--AA...KEFREN.PQ...EFKKRVRR--LV----------
UBC9_CAEEL/8-152----IQDLL......NHP.NIEDPAQAE--AY...QIYCQN.RA...EYEKRVKK--EA----------
UBC34_ARATH/9-146----LLSFMMDTSPTTGSVNTTVIEKQR--LA...............KSSLAFNC--KT----------
Q43780_SOLLC/6-143----IQALL......SAP.EPDDPQDAV--VA...QQYLRE.HQ...TFVGTA..--RY----------
UBC2_MEDSA/8-145----IQSLL......CDP.NPNSPANSE--AA...RMFSEN.KR...EYNRRVRE--VV----------
UBC2_YEAST/8-145----IQSLF......NDP.NPASPANVE--AA...TLFKDH.KS...QYVKRVKE--TV----------
UBCX_PICAN/7-177----IVVLL......ANP.EPLSPLNID--MA...NLLKCDDTT...AYKDLVHY--YI----------
UBC12_DROME/30-165----LQFLF......LEP.NPEDPLNKE--AA...DVLQTN.RR...QFENNVKK--AM----------
UB2G2_MOUSE/8-159----VVSML......AEP.NDESGANVD--AS...KMWRDD.RE...QFYKIAKQ--IV----------
Q95039_PARTE/244-382----VSVML......QNP.NADDALDCN--IA...AIYKHE.PE...LFKQNALK--EK----------
UB2J2_MOUSE/16-153----LLSFMVEKGPTLGSIETSDFTKKQ--LA...............AQSLVFNL--KD----------
UB2L3_MOUSE/6-144----LIALV......NDP.QPEHPLRAD--LA...EEYSKD.RK...KFCKNAEE--FT----------
UBE2C_DROME/36-172----IQSLL......GEP.NNESPLNAQ--AA...MMWN.D.QK...EYKKYLDA--FY----------
AKTIP_MOUSE/72-217----RRVFY........KIDTTSPLNPE--AA...VLYEKDIQ....LFKSKVVD--SV----------
UBC3_YEAST/11-164----IVSLL......EDP.NINSPANVD--AA...VDYRKN.PE...QYKQRVKM--EV----------
UBE2C_SPISO/34-170----LQSLL......GEP.NNASPLNAQ--AA...DMWS.N.QT...EYKKVLHE--KY----------
Q9VGD6_DROME/17-152----LPQLL......RYP.NPHDSLNHR--AA...AIMKHS.EQ...LFREHVIL--CM----------
Q9XZ32_DROME/1125-1274----IQGLIL....VDEPYYNEAGYEKQ--RG...TQLGNENSR...VYNEMA..--II----------
UBC9_YEAST/8-152----VQDLL......DSP.NPNSPAQEP--AW...RSFSRN.KA...EYDKKVLL--QA----------
Q9TZ69_CAEEL/8-147----IQALM......CTP.EPKDPQDAV--VA...KQYMEK.PA...VFKATA..--EY----------
UBCD2_DROME/90-225----ICSLL......TDC.NPADPLVGS--IA...TQYLQN.RE...EHDRIA..--RL----------
UBC12_MOUSE/33-168----LQYLF......LEP.NPEDPLNKE--AA...EVLQNN.RR...LFEQNVQR--SM----------
Q20617_CAEEL/17-156----LIVLL......NEP.DLSRPVNID--AA...HDYIHN.KV...EFVKKSTE--LA----------
UBC12_SCHPO/27-162----LQFLF......LSP.NAEDPLNKE--AA...ADLHKD.PQ...GFASRVRT--AM----------
SCE1_ARATH/9-153----IQDLL......DTP.NPADPAQTD--GY...HLFCQD.PV...EYKKRVKL--QS----------
UBC9_MESAU/8-152----IQELL......NEP.NIQEPAQAE--AY...TIYCQN.RV...EYEKRFRA--QA----------
UBC7_YEAST/8-159----VMSML......SEP.NIESGANID--AC...ILWRDN.RP...EFERQVKL--SI----------
UBCD4_DROME/8-147----LQALL......AAA.EPDDPQDAV--VA...YQFKDK.YD...LFLLTA..--KH----------
Q9VYN3_DROME/66-201----IYVLM......SEC.NPDDPLVMC--IA...DQYKTN.RR...EHDKIA..--RH----------
Q20872_CAEEL/39-180----ISNLL......ATP.DLTQAANIE--AW...MEYENQ.RE...NYEAKARA--YA----------
UBC7_SCHPO/9-160----VMSML......AEP.NDESGANID--AC...KMWRED.RE...EYCRVVRR--LA----------
UB12L_ARATH/35-171----LFHLF......TEP.NYEDPLNHE--AA...AVLRDN.PK...TFEYNVRR--AM----------
UBC8_YEAST/7-143----IPGLL......KEP.NGSDPLNNE--AA...TLQLRD.KK...LYEEKIKE--YI----------
UBE2S_HUMAN/15-152----IKCLL......IHP.NPESALNEE--AG...RLLLEN.YE...EYAARARL--LT----------
Q9Y165_DROME/341-479----VQSLL......TDP.YTEVCMEPE--LG...YIYEHE.RE...RFEQLVRA--WT----------
UBCB_DICDI/6-141----IRSIL......TDP.NPDNPLETE--IA...QQFKTD.RN...AFNKTA..--KE----------
UBE2A_MOUSE/8-145----IQSLL......DEP.NPNSPANSQ--AA...QLYQEN.KR...EYEKRVSA--IV----------
UBC11_YEAST/12-150----LQSLL......GEP.NNRSPLNAV--AA...ELWDAD.ME...EYRKKVLA--CY----------
UBC9_SCHPO/8-152----IQDLL......DDP.NIASPAQTE--AY...TMFKKD.KV...EYEKRVRA--QA----------
UBC5_ARATH/7-143----LPQLL......LYP.NPSDPLNGE--AA...ALMMRD.RP...TYEQRVKE--YC----------
Q9U1Q1_CAEEL/8-159----VVSML......AEP.NDESPANVS--AA...KMWRED.RA...QFEKIADS--LV----------
UBC13_ARATH/8-159----IISML......SGP.NDESPANVE--AA...KEWREK.RD...EFKKKVSR--CV----------
Q9XWF6_CAEEL/8-149----ILSML......SSSKEKKHPIDDA--IY...VRTCSKNPS.....KTRWWF--HD----------
Q6AWG5_DROME/66-223----VISLL......NEP.NTFSPANVD--ASVMYRRWRDS.QGKDNEYPNIIRK--QA----------
UBC7_WHEAT/11-161----IISML......SSP.NDESPANIE--AA...KDWREK.QD...EFKKKVRR--AV----------
Q9VFR8_DROME/9-160----VISML......TDP.NDESAANVD--AA...KEYREN.YA...EFKRKVTR--CV----------
Q9U5Q3_9CILI/34-174----IQSLL......TDP.NPASPANVE--AA...KLYSDN.IQ...EYNKKVKE--CV----------
Q9VQ00_DROME/25-160----ICSLL......TDC.NPKDPLMAK--IG...TEYLKN.RA...EHDKKA..--RL----------
UBC11_SCHPO/32-170----LQSLL......GEP.NNASPLNAQ--AA...ELWSKD.PI...EYKRLLMQ--RY----------
UBC17_ARATH/19-158----ILSML......SSSSVKQKPKDND--HY...LKNCKHGRS...PKETRWRF--HD----------
UBE2C_HUMAN/34-170----IQSLL......GEP.NIDSPLNTH--AA...ELWK.N.PT...AFKKYLQE--TY----------
UBE2H_MOUSE/10-145----LPQLL......AYP.NPIDPLNGD--AA...AMYLHR.PE...EYKQKIKE--YI----------
UBC6_ARATH/7-143----LPQLL......LYP.NPSDPFNGE--AA...SLLMRD.RA...AYELKVKE--YC----------
UBC15_ARATH/19-158----ILSML......SSSPAKQRPADND--RY...VKNCKNGRS...PKETRWWF--HD----------

PF14461

Q4FRY8_PSYA2/12-152----VQNTL----------N.TAISSLQ.NGQIDQAEFEGE-FV---SYWKPEQT--IY.........V
A5G3M9_GEOUR/17-151----AIQVV----------V.DGISGKN......HQDFLDE-FG---AYWDRLKK--VK........FF
Q2K8Q4_RHIEC/18-161----AYGLL----------NLENPLGDGEKGKVTSAHNVGE-IQ---KYNWGESP--VFIGQECLTRLL
Q8KW20_9RHOB/16-149----AKALL----------E.ATPKDDG..FSDVESAHPTD-LP---SLLSGCSR--RF........ML
D3GMN6_9ENTR/13-154----IHQTL----------I.DSVSAAT.QGVNDKRELEGE-FA---AYWRPSET--LF........LL
A0L3D6_SHESA/1-142----HILLL----------E.KCITNPD....WNHSELLRE-FS---SEWLRICA--PD........SF
A3W6V2_9RHOB/1-135----ARTTL----------N.TLLHGNP......SVAYMAE-LA---AYWSATPY--C.........LV
Q2NBP1_ERYLH/4-143----TELSL----------E.KSFAGQG......GAEVAAE-YQ---EYWIEKEP--NF........RV
Q2L5J8_CLOPF/12-145----LNKVL----------Y.EGLNDIN......KLDFINE-FD---AYWNLLST--NN........IA
A0AW81_ARTS2/19-154----LPAAL----------K.AGMSGDE.HADWNEKPQAEP-FG---AYYNSYAN--SA........MV
A3TSK9_9RHOB/18-157----AFNLL----------HTEDPLGEG.GATAPSDHRVGE-VQ---TYGDLHLP--ALIGAGCLDRLK
A3GXG6_VIBCL/12-153----IQLTL----------D.NSVASVE.SGTSNDVELEGE-FS---AYWQSEEE--LY........LL
E0TAZ7_PARBH/17-149----ARDLI----------T.RNQSGDL......DEEFRKE-FQ---SYWTLAID--DK........AP
Y4OA_RHISN/9-149----LSQVL----------QVMTLRRNE.........QWSE-AA---SLEEQAPD--PV........TP
Y4QC_RHISN/29-153----LAHVL----------DGTGAEDPQ...........GE-PI---EYWWNSLG--QA........SG

PF05743

Q7Q6B6_ANOGA/22-142----LLDLI--------------------------QIMSV....---TFGEVPPV--------------
UEVLD_HUMAN/21-141----IVGLI--------------------------KEMIA....---KFQEELPM--------------
Q6FS29_CANGA/27-147----LFNVI--------------------------QDLAD....---MCNAIAPI--------------
Q4SDZ6_TETNG/21-141----VVSLL--------------------------KEMTA....---KFEEDPPL--------------
Q4TA00_TETNG/24-145----LSLLV--------------------------SEMVQ....---VFQKDMPL--------------
UEVLD_XENTR/21-141----VTGLI--------------------------REMAV....---KFEEELPL--------------
Q5KKQ1_CRYNJ/24-146----LDMLL--------------------------KHLAD....---VFSAAPPV--------------
TS101_RAT/21-141----LLELI--------------------------QIMIV....---IFGEEPPV--------------
Q5BAA9_EMENI/33-155----LLDLL--------------------------SILQD....---VFAKEPPV--------------
Q75EU1_ASHGO/32-146----VVKLV--------------------------QDLEQ....---AIMAQEPL--------------
STP22_YEAST/31-162----LIMVV--------------------------QELMSLLHE---PPQDQAPS--------------
Q4UHS4_THEAN/19-133----LVQAV--------------------------DHLCY....---AFSKISPI--------------
O76258_CAEEL/21-141----LSGLL--------------------------QVMAM....---VFQEKCPV--------------
Q9VVA7_DROME/22-142----LLSLI--------------------------QVMIV....---TFGDHPPV--------------
TS101_DICDI/47-167----METRV--------------------------SQQQQPQPP---QNNISPPP--------------
P78998_SACPS/31-154----LIVVV--------------------------QELMSLLSE---PSRDRVPS--------------
Q4PAN2_USTMA/23-145----LLDLI--------------------------HDCQH....---MFGREPPV--------------
UEVLD_DANRE/21-141----VNALL--------------------------AEMIG....---KFEEEPPL--------------
Q6ESB7_ORYSJ/45-167----LVDLV--------------------------RSLSH....---LFGLDPPL--------------
ELC_ARATH/37-158----LVDLV--------------------------SDLSA....---AFARDPPL--------------
Q59WF8_CANAL/24-164----MFSLV--------------------------E.LANVIYR---SVTTDSPI--------------
Q4N7T6_THEPA/34-148----LVQAV--------------------------DCLHY....---AFNKMSPI--------------
Q4SAD8_TETNG/22-142----LYGLI--------------------------QVMIV....---VFGEEPPV--------------

PF08694

UFC1_ARATH/6-167----CLG..------...................LAPWLAAEIPILVDSGAIKHK--DD----------
UFC1_AEDAE/4-164----ALG..------...................LAPWLAVEIPDLIEKGVVAYK--EK----------
A0DET8_PARTE/1-156----QLA..------...................LAPWLAAEIPVLIEEGKIK..--KD----------
UFC1_RAT/4-164----ALG..------...................LGPWLAVEVPDLIQKGVIQHK--EK----------
Q4N8N9_THEPA/4-172----ALGVS------FKH...........FSSVQLAPWLACEIPHLVNIGVL...--DN----------
Q4DHG1_TRYCC/3-163----ALG..------...................LGPWLSVEVPAMVEEGILKPT--NK----------
Q5DBD5_SCHJA/4-164----ALG..------...................LGPWLAVEIPDLISKGIVKHR--DD----------
Q22BA5_TETTS/2-180----ALGVI------SKYSNIFINLKKLFNINIQLGPWLAAEIPVLIDQGVIK..--KN----------
UFC1_DICDI/3-163----ALG..------...................LAPWLAAEVPHLVDNGIIKHK--ED----------

PF05773

Q4WEH2_ASPFU/8-134----VGRTY--------------------------Q...PG.AVCLFDVINEAVE..AF----------
Q4WU06_ASPFU/41-154----PKELL--------------------------.....G.SEMIYELAVSIQD..VL----------
Q757B9_ASHGO/407-512----VINSG--------------------------L...VG.DMLVFDMFEWLNE..NL----------
RNF25_HUMAN/11-125----AKAGL--------------------------.....G.TAMLYELIEKGKE..IL----------
Q4WZQ4_ASPFU/386-489----AEENF--------------------------L....G.ESMIFNIMDWLET..HL----------
Q4WQA1_ASPFU/1-121----IEENL--------------------------.....G.MAMVFTLVSTLKE..SA----------
Q4WDC1_ASPFU/6-159----WEDC.--------------------------.....GRDLVVYTYIDHLQQ..LA----------
E2AK4_HUMAN/18-134----AKKHC--------------------------.....G.EVMIFELAYHVQS..FL----------
IMPCT_XENLA/7-113----YLQNL--------------------------.....G.ENILYQWVEKIRE..FL----------
Q6BMK3_DEBHA/392-504----IIKNG--------------------------F...LG.DCYIFSIVEWLED..NI----------
Q6BNZ6_DEBHA/2-136----ADLQV--------------------------.....G.MPSVFALATQLKD..EA----------
Q6BX55_DEBHA/1-103----LSRIF--------------------------H...KG.EVCIFEMFTELED..LL----------
Q6BWT3_DEBHA/17-158----WDDFK--------------------------.......DQVLYASIDFIQE..KI----------
IMPCT_CAEEL/2-99----YIENI--------------------------.....G.FPVIFNWISLVQD..FI----------
Q640E2_XENLA/7-130----IRSLD--------------------------R....G.ELCISMAVQWLQD..NI----------
Q5ADM3_CANAL/405-504----LTDHI--------------------------.....G.QCMIYTIFEWLND..HV----------
Q59S39_CANAL/9-125----IKEYP--------------------------E......QEVSFTIISELIF..ML----------
Q6YUR1_ORYSJ/47-192----WAEQP--------------------------A....G.QEVVYKWVDWLST..SS----------
YL419_YEAST/423-528----LQEGN--------------------------L...IG.DMLVYHIYEWLKE..NI----------
Q5AU57_EMENI/6-130----LGRMY--------------------------Q...PG.AVCLFDVINEAIE..AF----------
RWDD3_PONAB/1-111----AESLL--------------------------.....S.EPMVHELVLWIQQ..NL----------
Q3ZAU6_RAT/4-134----WEEHR--------------------------.....G.RVVLFAWMQFLKE..ET----------
Q4PDS7_USTMA/6-155----AQDSL--------------------------.....G.MAMVFTLASHLRE..SV----------
Q20871_CAEEL/2-135----CEENQ--------------------------M......MEVLFMCYQTIID..LM----------
IMPCT_DICDI/1-152----WNQN.--------------------------.......ELVIFQMISWLQE..ES----------
Q55GT9_DICDI/415-519----LQSSI--------------------------.....G.NPMIFNIISWLDQ..NI----------
Q4CY49_TRYCC/190-316----AVETI--------------------------NG.FAG.EGCLVALMSSLHG..VI----------
Q4P4B8_USTMA/14-135----AKSLI--------------------------.....G.AEMIWELITVAQD..FI----------
RWDD3_DANRE/1-109----AQSLP--------------------------.....A.EPMVHGLMLWLQE..NF----------
Q75F11_ASHGO/10-125----HKSAR--------------------------.....G.QEILFEITTRVQE..VL----------
Q9VZ55_DROME/176-361----AKEIC--------------------------R...DG.IPCVYSICDLLQS..NE----------
A8X836_CAEBR/4-137----CEENL--------------------------M......MGVLYLCYQGIID..LI----------
Q9XVY4_CAEEL/15-135----ADTWE--------------------------.....G.CVVIAELAHRVRE..FL----------
Q86I15_DICDI/66-198----WNTNI--------------------------.....N.LPIISIWANWLKE..ES----------
Q4RFR0_TETNG/5-135----LLENC--------------------------Q....G.DVCVLAALDWVKD..NL----------
Q9LQM5_ARATH/184-320----WSEQP--------------------------.....G.QEVLYQWTDWLQN..SS----------
Q6FVK3_CANGA/2-158----IETDM--------------------------L...SG.MQMCFALISSIKE..KA----------
Q6CTZ2_KLULA/2-106----LESVF--------------------------N...PG.LVCIFDFLTELDG..VL----------
Q5JKR6_ORYSJ/3-122----ATENL--------------------------.....G.MAMVYTLVTSAQD..WL----------
Q7X7C1_ORYSA/108-233----WAELP--------------------------.....G.QEVVYRWVESLRN..SS----------
Q8IDE3_PLAF7/67-179----LQRYN--------------------------E....Q.RECILPVIYKVNE..II----------
Q4SZQ6_TETNG/2-108----VEANM--------------------------.....G.AAMMYTLFEWAKE..NQ----------
YIH1_SCHPO/2-94----VLLSV--------------------------A...TG.DVCIFSYMDLLKE..LV----------
Q4RIS5_TETNG/2-125----WEENR--------------------------.....G.CEILFTWIQFLKE..ET----------
Q6CDD7_YARLI/1-89----LAQVY--------------------------M...EG.EVVLFSLIQEVQE..VT----------
Q5BB34_EMENI/40-153----PRALL--------------------------.....G.SEMIYELADSIQE..IL----------
Q9VJ60_DROME/3-109----ADQWL--------------------------.....G.CGMTYTLFECLKD..NL----------
Q7S2B9_NEUCR/1-108----VGEVY--------------------------E...PG.QVCLFDAIEQVKE..LI----------
Q7Q0B4_ANOGA/9-123----ADELK--------------------------.....G.EVMIFELANTVQA..FL----------
Q4STD1_TETNG/1-114----.....--------------------------.....G..EELFARYDRLLLQNSL----------
Q4D6B4_TRYCC/5-103----LREEV--------------------------P...LG.GPMLLHIFTLAQD..IA----------
Q95RT3_DROME/4-116----IEENL--------------------------.....G.MEMIFSLVSSAQE..WL----------
ITT1_SCHPO/9-132----WNEIH--------------------------.......DCVLFDAIEHVRS..IA----------
Q6CTQ8_KLULA/10-125----HQRSK--------------------------.....G.QEIIYEIIIATQD..VL----------
Q8X0V7_NEUCS/437-541----ALTLE--------------------------.....GEEMKIFYVASWVQE..NI----------
IMPCT_MOUSE/7-113----YVHNM--------------------------.....G.ESILYQWVEKIRD..AL----------
Q4RHJ9_TETNG/221-397----AVAAA--------------------------R...SS.EPVVYTLITLCED..EA----------
Q4RLP9_TETNG/13-130----AAARC--------------------------.....G.EVMIYELADHIQG..FL----------
Q6C972_YARLI/2-130----AEENV--------------------------.....G.MASVFAIASSLKD..EA----------
Q9C2M7_NEUCS/8-183----WEEM.--------------------------.....GRDMVGFTYIDHIQQ..AA----------
Q6CS85_KLULA/412-516----LEESQ--------------------------L...IG.DMCVYHIVDWLQQ..NL----------
Q8T6F6_DROPS/41-151----LDQHI--------------------------.....G.LQMIAPVTIRLQT..LL----------
Q3ZC53_BOVIN/3-111----AEENL--------------------------.....G.MVMIFTLVTAVQE..KL----------
Q5A855_CANAL/1-106----LQKVF--------------------------V...PE.QVVLFELLTELQE..FF----------
YCF9_SCHPO/1-111----AEECL--------------------------.....G.MAMIFSLCSVAKE..ET----------
Q6CDA6_YARLI/420-527----SRDTL--------------------------S....G.DAQIWAICEWLED..NC----------
Q7QK93_ANOGA/171-363----CIELT--------------------------K...DG.MPCIYTVADLLQN..DE----------
Q5RIL0_DANRE/1-124----LTENC--------------------------R....G.EVCVLSAVQWIKD..NA----------
Q6FSE4_CANGA/10-125----FKELK--------------------------.....G.QEMVFEITSYIQE..KL----------
Q8MZ95_DROME/27-143----LEEHL--------------------------.....G.LQMIVPVVTRLQI..TL----------
Q4QCY6_LEIMA/5-109----CEENI--------------------------.....G.MHSVVLALQQVQD..FL----------
Q5PQ37_XENLA/4-135----LKSNC--------------------------S....G.DVCILSATEWVRD..NA----------
Q7QBP1_ANOGA/4-115----IEENL--------------------------.....G.IEMIFSLVSSAQE..WL----------
Q7XSB8_ORYSJ/29-143----ANIYS--------------------------R...EG.RVMIFNLVEAAQE..FL----------
Q750B2_ASHGO/2-157----VEEDM--------------------------L...LG.IQMCFALISSIKE..DA----------
Q5AYM1_EMENI/6-166----WEEF.--------------------------.....GRSLVVFSYIDHLQQ..LA----------
Q7SXJ6_DANRE/2-114----AEECV--------------------------.....G.TPVLYQLIERAKE..IL----------
Q7F9L6_ORYSA/43-178----WSQQL--------------------------.....G.LEVVYGWVQWLQS..SA----------
Q4DGH6_TRYCC/4-108----CAEQI--------------------------.....G.MHSVISVLQKAQE..YL----------
Q5CGP2_CRYHO/1-151----KESYI--------------------------.....G.RVCLFDIIENLQV..FI----------
Q75EM4_ASHGO/2-106----MASVY--------------------------S...KG.FVCLFDFISELSN..VL----------
RWD2A_MACFA/7-131----IGTFD--------------------------P....G.ELCVCAAIQWLQD..NS----------
Q6CB97_YARLI/1-115----WEQV.--------------------------.....KDESTLFACVDLIKE..QV----------
IMPCT_DANRE/10-115----YVENA--------------------------.....G.ESILYLWVEKIRE..FL----------
Q5KE91_CRYNJ/3-101----AEESL--------------------------.....G.MAMSFTIASAARE..AL----------
Q7PMA0_ANOGA/3-108----AQQWI--------------------------.....G.CGMTYTLFECLKD..KL----------
Q5ANG1_CANAL/15-141----WKEYR--------------------------.......DQVLFNLIDHLQD..QV----------
GCN2_SCHPO/9-124----AKDLL--------------------------.....G.EEMIFELASIVQD..YL----------
Q7SCW3_NEUCR/1-116----IEENL--------------------------.....G.MAMIFTVVSALKD..AA----------
Q5DET7_SCHJA/1-111----IERSL--------------------------.....G.FVMLFDILTDVQQ..KL----------
Q4KLB7_XENLA/4-134----WEKYT--------------------------.....G.GVVLFAWMQFLKE..QT----------
Q5DEU0_SCHJA/3-107----AEDQL--------------------------.....G.SALTYILVEYIKE..NH----------
Q55I55_CRYNB/4-118----ARSKV--------------------------.....G.EVMIFELIDTVRD..FI----------
GIR2_YEAST/2-156----IETDM--------------------------L...LG.MQMCFALISSIKE..RC----------
Q5M8G9_XENTR/55-165----AEQGV--------------------------.....G.CPILYELIEKGKE..ML----------
Q9C8I1_ARATH/3-122----ASENL--------------------------.....G.MAMIYTLVSSAKD..WL----------
GCN2_ARATH/30-145----ANSNA--------------------------R...EG.RVMIFNLVEAAQE..FL----------
IFKC_DICDI/67-194----SQGKI--------------------------.....G.NIMIFDLCEIAKD..FL----------
O01712_DROME/9-127----SQELR--------------------------.....G.EVMIYELAQTVQA..FL----------
Q55CB4_DICDI/4-208----INNQW--------------------------E...CG.ELVIFKYVDWLKT..NL----------
Q6FMC2_CANGA/1-102----MDSMF--------------------------H...QG.SVCLFDFFTELDG..VL----------
O74297_NEUCS/43-157----PKIYA--------------------------Q....AEQEMIDQIVEGIRD..IL----------
DHX57_HUMAN/243-419----ALTFA--------------------------E...TS.EPVVYSLITLLEE..ES----------
Q6FPE1_CANGA/415-520----VKESG--------------------------I...IG.GEMIYEIYQWLLD..NI----------
Q5AGV1_CANAL/2-149----SELNL--------------------------.....G.IPMIFNLITILKE..ES----------
Q4CVK5_TRYCC/246-363----LRDDL--------------------------G...VG.NAMLLPAMMFAGE..QA----------
Q4TU20_ARATH/1-111----ASQLS--------------------------.....S.SLMLVELCEEAVE..RL----------
O18131_CAEEL/2-116----AEENL--------------------------.....G.MVMVFAIVSALQD..EI----------
Q6CQJ5_KLULA/2-165----IQEDM--------------------------L...LG.MQMCFALISNIKD..YA----------
Q4Y347_PLACH/2-106----IENNL--------------------------.....G.YSMIYNIVENIRT..YI----------
RWDD4_RAT/2-108----VEVNL--------------------------.....G.TAMTYTLFEYAKD..NK----------
Q6IQ68_DANRE/3-126----WEENQ--------------------------.....G.NVVLFTWIQFLKE..ET----------
Q4XYA3_PLACH/66-179----IQNYL--------------------------E....Q.ECIILNVIYKINE..LV----------
Q5DGN4_SCHJA/1-112----ISERK--------------------------.....G.DPVLFDLVDFCRE..FI----------
Q556K0_DICDI/1-107----AENNI--------------------------.....G.MSMIFILCGLIKE..WV----------
DHX57_MOUSE/243-419----ALEFA--------------------------K...TS.EPVVYSLITLLEE..ES----------
RWD2B_HUMAN/34-162----LQKHC--------------------------H....G.DVCILNATEWVRE..HA----------
Q4CLS7_TRYCC/23-139----ISPCL--------------------------L...VG.APCIMQIISVVER..VL----------
Q55VL2_CRYNB/13-165----WDDDK--------------------------EAWDQG.QGVLWKWWDWVVNGDFL----------

PF14457

Q21PA7_SACD2/14-175----ASGEL--------------------------LCPVQGWEPVRRDNASG.LI--SADTYAIREELN
A0L5E1_MAGSM/13-169----AQDQL--------------------------DPDDAPLHPPAVYHSSD.TK--FSVEIDTPELAD
Q4ZFT1_CLOPF/15-178----ACNNL--------------------------IKPGDDFEPMINYTETG.NI--VYSYNKLTKFIE
A9BTW4_DELAS/5-166----AAGTL--------------------------LDLEQGWEPTRRDSCPS.TV--VFSAEKVAAAAP
A1U5J0_MARAV/18-180----AQGTL--------------------------MDPSQGWEPILFQNIAG.SF--LDDKGSFLRGVR
Q3SNL9_NITWN/14-180----AEGTL--------------------------IHHGRGWEPTLRCDLND.VI--ALNAEACRAVVD
Q8PFM8_XANAC/22-182----ADGTI--------------------------HEADRGLEPVFYSLGQC.LM--LPPDFAEALSDP
A1U033_MARAV/19-179----ACENL--------------------------HQANQPLEQLFFEPADQ.FV--LPEDYFERLTDT
A1VVG1_POLNA/24-184----ARGEL--------------------------HPTDQPVEHLFFATRYE.LV--LPWNLSTLRKSA
A3U023_9RHOB/20-179----AEGAL--------------------------HDARQPVDPLMFGTGYNI.I--MSRALIDNANTQ
Q5HY19_GLUOX/8-170----ADGSL--------------------------HADDQILEPLVATTSDT.IV--FPLGTFVGPWFI
Q3J4T6_RHOS4/6-183----ELAAA--------------------------GRLHNPGDHFELPPLSG.HT--NPMTIGFHETEG

PF14462

A1VQ26_POLNA/187-309----WRPGV------------------------------DGLHTMIKRIEHALAE--AK----------
Q6YRV0_SYNY3/5-127----WRRGV------------------------------DGIWTMLKRVEHALEV--AA----------
Q8ZSK7_NOSS1/4-126----WRPGT------------------------------DGIWTMLKRIENALEV--AA----------
Q1QNK3_NITHX/244-367----WSSRL------------------------------DNVMTHLTLVDGALAK--EV----------
A4JA91_BURVG/127-248----WRQGI------------------------------DNVGTHLMLVDDFLRA--EL----------

PF14460

Q3M1I7_ANAVT/44-224......NQL--------------------------IKLHESKA.KSYPSSDLVPV--H-----------
Q8ZSF1_NOSS1/44-224......NQL--------------------------IKLHESKA.KSYPSSDLVPV--H-----------
Q5NXB4_AROAE/51-225GG..SAKFW--------------------------NAMLSGKF.KSFPQEVLVPA--E-----------
B3ZY45_BACCE/33-211....VGELF--------------------------KRFEN....QSFDDSILMES--E-----------
Q8A4F1_BACTN/53-225....TRSNL--------------------------VSVTEHARNNPFDYSELQQS--G-----------
Q11ZD1_POLSJ/54-242....PYAFI--------------------------ADLMETEA.KEFPAAALKPM--K-----------
Q21Q52_RHOFD/56-227G...EKALW--------------------------KHLMTSKKKPAFPTDKLKPF--G-----------
Q120V4_POLSJ/57-235K...PAEFW--------------------------KKMVAKP.AQKFPESVLVDL--E-----------
A1VVA0_POLNA/62-240C...PIDFW--------------------------KAMTEKP.LPVFPEGRLVDL--P-----------
Q8XYU7_RALSO/54-226....GGALW--------------------------AHLLDHPEITEFPATALLPR--K-----------
Q5NUW6_RALME/54-226....VYAFW--------------------------KDMLDGKF.PDFPKQVLVPM--K-----------
Q7WX34_CUPNH/54-226....AYAFW--------------------------KDMLDGQF.PDYPKQVLVPM--K-----------
A4JUM7_BURVG/54-227....EYAFW--------------------------RDMLDGKFGETFPLNALVPM--K-----------
Q47D10_DECAR/55-233....AYTFW--------------------------RDMLDGRF.QRFPERVLVDV--K-----------
A0R7U7_PELPD/52-228IN..PYQFW--------------------------KTVLDGKY.KTFPTQKLVQT--N-----------
C3IV16_BACTU/30-216....GWPLR--------------------------QIFSETQGQPHFNYDKLIEE--D-----------
C3IUY7_BACTU/30-236HMMNEADKL--------------------------KAAKEAGEAYSYPFDSLKPA--G-----------

PF14459

Y4JF_RHISN/38-168----SGSSL--------------------------LPYGAGAASCFGAANVFRTIFAAQ----------
Q98A20_RHILO/38-168----SGSSL--------------------------LPYGAGAASCFGAANVFRTIFAAQ----------
Q8KGV9_RHILI/4-134----SGSSL--------------------------LPYGAGAASCFGAANVFRTIFAAQ----------
Q2K2A4_RHIEC/38-168----TAGSN--------------------------NAFGAGAAACIAASNLFRHIFRDQ----------

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window