Sequence alignment for CL0210

PF07700

Q7Q9W6_ANOGA/1-170MYGMLLESVQHFVQLEYGEFVWRQALLTTGCK.NTVFNTHQLYPDNLIPDLAAALSAITGKPFDEFMIFFGRCFVRFFSN
GCY8E_DROME/1-170MYGLLLENLSEYIKSVYGEEKWEDIRRQAGID.SPSFSVHQVYPENLLQKLAKKAQQVLGVSERDFMDQMGVYFVGFVGQ
Q87NJ1_VIBPA/1-168MKGIIFTEFMELVESKFGLEVLDQVLELSDDE..GVYTSVGSYDHRDLVKLIVNLSKVSDIPPEQLQEVFGESVFLNLLR
GCY35_CAEEL/1-173MFGWIHESFRQLVTRKYGKDIWEKIVHMSKFELGTESEIAHYYNDDETLRLVNSMANVIGIPIEEIWEAYGGFLIQFTME
Q8EF49_SHEON/1-167MKGIIFNVLEDMVVAQCGMSVWNELLEKHAPK.DRVYVSAKSYAESELFSIVQDVAQRLNMPIQDVVKAFGQFLFNGLAS
GCY34_CAEEL/1-173MFGFIHESIRQLVIRKYGEDVWLQVLERSGFENGKENIVNHYYSDTDTYVLVDSVSIVLKVTKDQIWEMYGGFLITYSME
Q899J9_CLOTE/20-185MKGTIVATWMRTCRKLYNDDVVNKAMSSVGWDSNKIFKPTENVEDSDLKKVIEYIAKSEKLELGHLWRQIGKDNLVSFYN
Q97E73_CLOAB/1-166MKGTVVGTWVKTCKRLYGETVVENALEKVGFERKKIFSPFEDVEDSKVNNFIEDISKKVNEEKSIIWEKIGEDNVIAFHK
Q95NK5_HEMPU/1-172MYGFVNHALELLVLREHGKDKWEEIKREAAVEIEGSFLVRIVYDDVLSYDLVGAAVKVLEISANDLLEAFGRMFFEFCVE
GCYDB_DROME/1-170MYGMLYESVQHYIQQEYGMETWRKVCQIVDCK.HQSFKTHQIYPDKLMPDFAAALSASTGESFDFCMNFFGRCFVRFFSN
Q8YUQ7_NOSS1/1-172MYGLVNKAIQDMISKHHGEDTWEAIKQKAGLEDIDFFVGMEAYSDDVTYHLVGAASEVLGKPAEELLIAFGEYWVTYTSE
GCY33_CAEEL/1-170MYGLVIEGVRFMIQENWGPQVLLQVQKLTSLS.EKSVSTHDQYSEHVVPQMFKAIHEITGTPYEQIGVLAGRFFVQFLIR
Q8DAE2_VIBVU/1-168MKGIIFTEFLELVEEKFGLTVLDDILDRAGDE..GVYTAVGSYDHRKLVSLIVHLSQVTGLSVEQLQEVFGEAVFDNLLA
O77106_MANSE/1-172MYGFVNYALELLVMKTFDEETWETIKKKADVAMEGSFLVRQIYEDEITYNLITAAVEVLQIPADAILELFGKTFFEFCQD
Q80WY4_RAT/1-172MYGFVNHALELLVIRNYGPEVWEDIKKEAQLDEEGQFLVRIIYDDSKTYDLVAAASKVLNLNAGEILQMFGKMFFVFCQE
Q8RBX6_THETN/1-166MKGTIVGTWIKTLRDLYGNDVVDESLKSVGWEPDRVITPLEDIDDDEVRRIFAKVSEKTGKNVNEIWREVGRQNIKTFSE

PF02830

Q8DKK3_THEEB/150-211---------------------------------------------------------------------MFINIFDSVVA
Q7X3G7_THIRO/148-208---------------------------------------------------------------------TRLTVTDGPIC
Q8U209_PYRFU/331-392---------------------------------------------------------------------DIIVIEGKNLF
P74446_SYNY3/202-263---------------------------------------------------------------------IVAEVVNSPFV
O69184_CUPNE/150-211---------------------------------------------------------------------LVDSSEAEAHI
Q9S150_COMTE/142-203---------------------------------------------------------------------WEHSWEAEIHL
Q7WYF6_9PSED/123-184---------------------------------------------------------------------CDNSWEAESHL
Q93NB0_9BURK/126-187---------------------------------------------------------------------CDHSWEAETHK
O84957_9RALS/130-191---------------------------------------------------------------------WEDSFEGDVHR
P74443_SYNY3/170-231---------------------------------------------------------------------LFVDIFDSAVA
Q8XTP9_RALSO/107-174---------------------------------------------------------------------IELC.HSSFVL
Y150_METJA/106-167---------------------------------------------------------------------MILILKDCISC
Q84FP2_CUPPJ/61-122---------------------------------------------------------------------WDNSREGYAHR
BCHJ_RHOCB/140-199---------------------------------------------------------------------LTFRIDDNPLR
Q881E3_PSESM/120-181---------------------------------------------------------------------WHNSCEADEHL
O85963_SPHAR/121-182---------------------------------------------------------------------VHDSIEAAIHL
O67571_AQUAE/116-177---------------------------------------------------------------------MEIKIEGSILV
Q8TXN0_METKA/66-127---------------------------------------------------------------------DVVTVRNYPEC
Y745_METJA/119-179---------------------------------------------------------------------LVLKVENCSFC
BCHJ_RHOS4/143-203---------------------------------------------------------------------LSFEIARNPVV
Q8L387_9PSED/158-219---------------------------------------------------------------------WHNSFEDDEHI
Q8R5R6_THETN/52-113---------------------------------------------------------------------IIVKWHECLTC
Q8TWC8_METKA/86-147---------------------------------------------------------------------NYVAIESCPEC
O27403_METTH/188-249---------------------------------------------------------------------LVIRAYECFEC
O58847_PYRHO/335-396---------------------------------------------------------------------DIIIVEGKNLF
Y855_METJA/161-223---------------------------------------------------------------------LTVVVKDNKEC
Q8VUU3_9BURK/126-187---------------------------------------------------------------------WEHSWEAEVHR
Y1642_METJA/72-133---------------------------------------------------------------------IKIRIYDCISC
Y739_METJA/88-148---------------------------------------------------------------------VEIKVKDCIFC
Q8TXN0_METKA/224-288---------------------------------------------------------------------NRMSIEPCPEC
Q8XT87_RALSO/150-211---------------------------------------------------------------------WHNSSEDDEHL
Q9R6Q4_PSEST/128-189---------------------------------------------------------------------WIDSFEVEICQ
Q9KLM3_VIBCH/129-188---------------------------------------------------------------------FENRVEEKTLT
Q8TQT2_METAC/185-246---------------------------------------------------------------------PALQVEDDFKA
Q8KP44_PSEME/160-221---------------------------------------------------------------------WHNSLEADEHI
Y1460_METJA/95-156---------------------------------------------------------------------PPYKIKLSNPP
Q8TV82_METKA/104-164---------------------------------------------------------------------IEITMRESATA
Q8PYJ8_METMA/191-252---------------------------------------------------------------------GKIIVKDSFIA
Q43965_ACICA/134-195---------------------------------------------------------------------WLNSFEAEVHL
O26930_METTH/130-191---------------------------------------------------------------------MDVRVYECIEC
O06645_9PSED/140-201---------------------------------------------------------------------WQNSIEAEIHL
Q8DGL5_THEEB/132-193---------------------------------------------------------------------VVKTWDSPFAA
Q9F2C0_THAAR/126-187---------------------------------------------------------------------WINSWEGQSHK
Q8TXW7_METKA/177-236---------------------------------------------------------------------VVVEIEGCHEC
Q9ZHH9_9BURK/123-184---------------------------------------------------------------------SENSWEAESHL
Q06573_PSEUF/128-189---------------------------------------------------------------------WIDSFEVEICQ
Q8TX90_METKA/68-129---------------------------------------------------------------------TVEFYEENPEV
Q9F6Y2_CHLAU/138-198---------------------------------------------------------------------WRLTLADSVEA
Q9UZN4_PYRAB/331-392---------------------------------------------------------------------DIIIVEGKNLF
Q9ZGF5_HELMO/140-200---------------------------------------------------------------------KKIYIENCLSC
XYLR_PSEPU/128-189---------------------------------------------------------------------WIDSFEVDICR
Q8PU31_METMA/185-246---------------------------------------------------------------------PALRVDGGFKA

PF06505

O69184_CUPNE/38-140------------------------------------------DLAKRLRFAPQQGRIWLDDQRMMLMHISSLGALRQELI
O84957_9RALS/18-120------------------------------------------NLARRLRFAMKEGSIWLGEQRMILLHTAALGALRKELV
Q8L387_9PSED/46-148------------------------------------------DLTQSLIFSPDSGEIWLSGQRMVLMHNTGLGRLRHELI
Q8XT87_RALSO/38-140------------------------------------------DISECLYFSPGDGRIWLNDQRMLLLHSRAMGTLRRELI
O85963_SPHAR/9-111------------------------------------------DIASKLQFSPEMGRIWHDGERCVLLSQAALASWRSRLV
Q9F2C0_THAAR/14-116------------------------------------------DLRSRIHFCADTGQIWLHEHRMLLVHAEAQAALRKELI
Q881E3_PSESM/8-110------------------------------------------ELTGCLFFSPDDGRIWLNDQRMLLLHSSSFGTLRREII
Q9ZHH9_9BURK/11-113------------------------------------------DLRGLVRFSTEDGLIWLGESRMLLLHVATMAGLRRELI
Q9R6Q4_PSEST/16-118------------------------------------------DLTEQIQFQSTEGKIWLGEKRMLLMQLSALAAFRREMV
Q43965_ACICA/22-124------------------------------------------DLLDKIVFDAQHGQIWFDENRMLLMHTSILGFLRKDLY
Q8KP44_PSEME/48-150------------------------------------------QLAETVAFAPQDGNIWLCGQRMMLLQGAAFGAIRRELV
XYLR_PSEPU/16-118------------------------------------------DLSSQIRFVAAEGKIWLGEQRMLVMQLSTLASFRREII
Q9S150_COMTE/30-132------------------------------------------DLRSQVRFSTEDGLIWLSGQRMLLLHLASLHALRREMM
Q06573_PSEUF/16-118------------------------------------------DLTNLIHFQSMEGKIWLGEQRMLLLQFSAMASFRREMV
Q8VUU3_9BURK/14-116------------------------------------------DLRRLIHFSAADGRIWLGDQRMVLIHAAALGALRKEMM
O06645_9PSED/24-130------------------------------------------ALVSKLHFSPNEGRIWLDESRCLLLQVETLKDIYKELQ

PF07700

Q7Q9W6_ANOGA/1-170FGYDELIKATGRYFCDFLHSVDN.IHLQMRFTY..RK--MKSPSMQLTEV.DENGAVLVYRSTRTGFSKYLRGQLLEIAK
GCY8E_DROME/1-170YGYDRVLSVLGRHMRDFLNGLDN.LHEYLKFSY..PR--MRAPSFICENE.TKQGLTLHYRSKRRGFVYYTMGQIREVAR
Q87NJ1_VIBPA/1-168SIPSHASLQQCDNTFQFVRHVESFIHVEVKKLY..PD--ANPPKFDFISE.TQSELVFDYHSAR.CMAHVCLGLLKGCAA
GCY35_CAEEL/1-173TGWDELLRAMAPDLEGFLDSLDS.LHYFIDHVVYKTK--LRGPSFRCDVQ.ADGTLLLHYYSKRSGLYPIVKGVVREVAR
Q8EF49_SHEON/1-167RHTD..VVDKFDDFTSLVMGIHDVIHLEVNKLY..HE--PSLPHINGQLL.PNNQIALRYSSPR.RLCFCAEGLLFGAAQ
GCY34_CAEEL/1-173IGWDELVRSMSPNLKGFLDNLDS.LHYFIDHVVYKAN--LRGPSFRCEEN.PDGTLMLHYFTGRPGLYHIVKGVVKEVAK
Q899J9_CLOTE/20-185DFPA...FFQHENLYSFFNSLFD.IHVVMTKKF..PG--AKPPLVTIEPI.SSKEAIFYYESKR.GMFDYLLGLIEGSIK
Q97E73_CLOAB/1-166DFPA...FFEHENLYSFFKSMFD.VHVVMTKKF..PG--AKPPLILIKPI.SKREAIFTYRSKR.GMFDYLKGLIKGSAN
Q95NK5_HEMPU/1-172SGYDNILNVLGSTTRHFLQNLDA.LHDHLASIY..PG--MRAPSFRCSTRESDGALVLHYYSERPGLEHIVIGLVRSVAK
GCYDB_DROME/1-170FGYDKMIRSTGRYFCDFLQSIDN.IHVQMRFTY..PK--MKSPSMQLTNM.DDDGAVILYRSGRTGMSKYLIGQMTEVAK
Q8YUQ7_NOSS1/1-172EGYGELLASAGDSLPEFMENLDN.LHARVGLSF..PQ--LRPPAFECQHT.SSKSMELHYQSTRCGLAPMVLGLLHGLGK
GCY33_CAEEL/1-170NGYGDLMNVMGRRFSDFIKGLDN.IHEYFRFSY..PK--LRAPSFYCKSE.SEDGLILHYRSRRTGYLSYVIGQLVELAR
Q8DAE2_VIBVU/1-168SISNRSSLHQCHSTFQFIRHVEEYIHVEVKKLY..PD--AKPPEFIFIEQ.DRMKMVFDYKSAR.CMGHVCLGLMRGCAK
O77106_MANSE/1-172SGYDKILQVLGATPRDFLQNLDG.LHDHLGTLY..PG--MRSPSFRCTERPEDGALVLHYYSDRPGLEHIVIGIVKTVAS
Q80WY4_RAT/1-172SGYGTILRVLGSNVREFLQNLDA.LHDHLATIY..PG--MRAPSFRCTDAEKGKGLILHYYSEREGLQDIVIGIIKTVAQ
Q8RBX6_THETN/1-166WFPS...YFAGRRLVNFLMMMDE.VHLQLTKMI..KG--ATPPRLIAKPV.AKDAIEMEYVSKR.KMYDYFLGLIEGSSK

PF02830

Q8DKK3_THEEB/150-211RTLGDVGKPVCYIYAGLFAGFFS........GLIQKP..LGCIELQCYAMGET...YCKFLVGK----------------
Q7X3G7_THIRO/148-208RG.ASANEPLCDFYAGSFERLFS........RLVHPN..ARVTEVACQANGDE...SCVFEVRW----------------
Q8U209_PYRFU/331-392PRLKNFPYPAHVNYAGSIAGIVE........KLLGGE..WKGDEISCESQGHE...KCLFVIRK----------------
P74446_SYNY3/202-263ACAPQGKCPMGFLEAGILTAFFS........QLTGEN..LHCEQTTCESLGAE...KNLFILGL----------------
O69184_CUPNE/150-211AGYGIGNESVCWMLIGYACGYTS........AFMGRP..ILWRETECRGMGHV...KCRVVGKP----------------
Q9S150_COMTE/142-203REWGPQDQPSCWMLLGYASGYSS........AFFRRP..VFFKEMQCSTCGHA...HCLIEGRF----------------
Q7WYF6_9PSED/123-184QLFGVSSEPACWNMAGYASGYVT........RFFKRV..IIFRETQCVCCGAS...ACMLEGRP----------------
Q93NB0_9BURK/126-187REFGLQHEPVCWMLIGYASGYTS........AFMRRS..ILFKETSCAACGGQ...SCHFVGKP----------------
O84957_9RALS/130-191QMFGVAQAPVCWMQIGYATGYTS........ALMGKT..ILYRELECVGCGHP...HCRILGKP----------------
P74443_SYNY3/170-231RTLGDVGKPVCHIYAGLLAGFFS........RLVNKS..LNCIEIQCYAMGET...YCKFLIGK----------------
Q8XTP9_RALSO/107-174AQ.PGKEGKLCYMFAGWFAGAMDWVNDTTPEGKGAPR..AQSKEVQCAAEGHD...HCIFEVSP----------------
Y150_METJA/106-167HNVPNVGTTLCHFEAGLIAGTLE........KKLRRK..VNAVETKCCGKGDE...YCEFLVKI----------------
Q84FP2_CUPPJ/61-122HAFGLAETPACWVLLGYASGYTS........AFMGRL..IVFKETCCAACGAD...HCQIVGRP----------------
BCHJ_RHOCB/140-199AD..AAERPSCFWHAAVFERLFG........TLVWPE..VTVEEISCASVSGG...PCLFVLHP----------------
Q881E3_PSESM/120-181AACGTGQDPVCWTEIGYAIGFVS........GLFGQM..VIFREVECRGMGHA...SCRVIGKT----------------
O85963_SPHAR/121-182SATGYSTDPVCWMQTGFASGFAT........TFAGQP..IIMREVECAGRGDA...ACVLHAKP----------------
O67571_AQUAE/116-177EAIPKSDKPVCEPMAGFFKGFLS........EFLEKD..YEVKEVQCQAQGYE...QCVFRIRQ----------------
Q8TXN0_METKA/66-127AGYPGARGPVCHFMRGLIAGAHE........LETGER..TPVEEVRCRAAGDD...VCEFRIGR----------------
Y745_METJA/119-179EDL.SFEEPICYFDAGLIAGAYE........CILKKP..VVVDEIKCMARGDD...ACYFKVEV----------------
BCHJ_RHOS4/143-203AG.ESSDTPLCHWHAAVFERLFS........RLVWPH..VAVRETACCAKGAP...ACRFELLP----------------
Q8L387_9PSED/158-219ALFGIGTEAACWMLLGYAMGYTS........TLTGKM..IHLPKVECRAMGAK...VCRVIGKP----------------
Q8R5R6_THETN/52-113SHLLPIGEPQCYLETGLLAGVLN........KLFKKK..VEVKETKCWGTGEK...YCEMEATI----------------
Q8TWC8_METKA/86-147LGYVNAEGAVCNFLRGFISRAAE........HELGEV..VSVAQVACEATGDR...RCEFILGE----------------
O27403_METTH/188-249GLLHQIGESACALDSGILEAVFS........RHFKGD..VIVEETECYARGDG...RCSFRIVP----------------
O58847_PYRHO/335-396PHIRNFPYPAHVHYAGYMAKLLE........KATGER..WEGEEIKCESQTND...KCIFILRR----------------
Y855_METJA/161-223KNC.KASEPICYLTAGFIAGCLE........NMTNKTYIVEVTEEKCQAVGDP...YCTFVAKK----------------
Q8VUU3_9BURK/126-187RHFGLQTEPVCWMLIGYASGYTS........AFMGRT..ILFRETACTCKGDA...HCLIEGKP----------------
Y1642_METJA/72-133SGLPDVGKPLCHFEAGFLAGYIE........NVFNKK..CYIIETHCWGLGNK...FCQFEVRL----------------
Y739_METJA/88-148RTQ.KSEEPMCDFEAGLIAGFLE........SIKNKK..YFVKEMYCQAQGYD...ACVFIAKP----------------
Q8TXN0_METKA/224-288AGFPREHEPVCHGVRGALHETLG........TFGKEV..ERVEETECAAVTGELVGRCEFRFEL----------------
Q8XT87_RALSO/150-211EAYGVGTAPACWRQLGYAIGYVS........TLLGHL..VIFREVECRAMGAG...VCRVIGKS----------------
Q9R6Q4_PSEST/128-189TELGQMNEPVCWSLLGYACAYTS........SFRGRQ..IVFREVTCRGCGDE...KCHIVGKP----------------
Q9KLM3_VIBCH/129-188MSY.YSKRQLCAAAEGLILGAA.........KQFNQP..VKITQPVCMHCGAD...HCEIVVEF----------------
Q8TQT2_METAC/185-246RVMPAIGKPLCVLREGILEGVLK........EKLGKE..CGVLETECYGTGHT...RCLFEITI----------------
Q8KP44_PSEME/160-221ASYGLGSEPACWMEVGYASGYTS........SLLGRL..VVFREQECRCMGHS...ACRIVGKP----------------
Y1460_METJA/95-156YQWVSKEEPIHDFIAGILAGCLE........EIFKKK..FVVNEVECVSQGKD...KCVFEVKE----------------
Q8TV82_METKA/104-164AGY.DIGKKLCYYQAGFIAGILH........GATGER..WEVHETKCMAEGHD...HCEFVAIR----------------
Q8PYJ8_METMA/191-252DVYGGSDQPVCAFMSGYFAGYLT........EYFGKN..ISVREVSCKATGKN...VCEHIISL----------------
Q43965_ACICA/134-195SEFGASDQPACWMLLGYACGYSS........FVMGQT..IIYQETHCVAQGDE...HCRIIGKP----------------
O26930_METTH/130-191AGLPNIGHPICFFEAGIIAGALS........EILGCD..ADAYERRCWTNGYS...FCQFDVRA----------------
O06645_9PSED/140-201AMHGVSSHAVCWFSVAYCSGYLS........ACAGKP..IVVEEIECQAMGHT...HCRIQAKP----------------
Q8DGL5_THEEB/132-193AAPKNTGQPQCAAEAGILESFFS........QLTGRD..LHCVQTACETLGAT...HNLFVLGL----------------
Q9F2C0_THAAR/126-187RHFGTCSEPVCWTQIGYACGYST........AFMGRP..ILYKEAECAGMGAE...HCHIVGKP----------------
Q8TXW7_METKA/177-236SDLPY..GPACHLEAGIIAGVLS........NLRERP..YEVREVECCGEGAD...RCVFVAEP----------------
Q9ZHH9_9BURK/123-184REFGQTDYPVCWMRAGYASGYTS........GFLGRQ..VLMKEIECAACGAD...HCTLVGKP----------------
Q06573_PSEUF/128-189TDLGQMQDPVCWTLLGYACAYSS........AFMGRE..IIFKEVSCRGCGGD...KCRVIGKP----------------
Q8TX90_METKA/68-129KEEMGFTEPACELEQALFRKLAE........LKYDKS..MEIEETKCQLAGDD...ICKFRIVP----------------
Q9F6Y2_CHLAU/138-198RG.VRATEPVCAYYRAAFEGLLR........RVVCDR..LRVHEVACRAMGTG...RCEFAVEL----------------
Q9UZN4_PYRAB/331-392PKFENFPYPAHPHYAGSMSKLLE........KATGEL..WEGEEIKCEAQGSD...KCVFVLRR----------------
Q9ZGF5_HELMO/140-200RGL.HSSQPICSFYEGTFEKLIQ........TLIVSK..AQVREIECIALGAK...TCTYQIQF----------------
XYLR_PSEPU/128-189TELGLMNEPVCWTVLGYASGYGS........AFMGRR..IIFQETSCRGCGDD...KCLIVGKT----------------
Q8PU31_METMA/185-246MSLPVTGKPFCSLKEGIIEGILK........EKLGKE..CGVLEIECYGTGHE...HCLFEITI----------------

PF06505

O69184_CUPNE/38-140ESLGKETARGLITRIGYQAGTRD--------AAMARKVRAGLNTYDDFLAGPQ---LVSLEGMV----------------
O84957_9RALS/18-120DTLGMERARGLFMRMGFHSGVRD--------AELAKTMRSGHSDFGMLEMGPC---LHTIEGVV----------------
Q8L387_9PSED/46-148ENIGLARTRGIMQRTGFPCGASD--------AVQLRQRFSDAEALALFAAGPV---MHGFEGAV----------------
Q8XT87_RALSO/38-140DSLGIDRARGLLTRSGYVSGAHD--------ARLVRERWPDAEPSAILIAGTR---LHTLEGMV----------------
O85963_SPHAR/9-111AELGHEAASRFFWGVGFAEGARC--------AIGAKKLRPDGDYLEAFAVGPQ---AHALTGFG----------------
Q9F2C0_THAAR/14-116DTLGMARARGLLLRMGFASGARD--------AELAQTRIRTGDDLAAFMTGPQ---LHALEGIV----------------
Q881E3_PSESM/8-110ERLGQEPARGMFTRAGYLSGARD--------ARLIRERWPLADATSAFRAGTH---LHTLEGMA----------------
Q9ZHH9_9BURK/11-113LSVGIDDARRTIIRMGYEAGLRD--------AEIVRRIRRNDDDLDAYIAGPQ---LFMLEGGE----------------
Q9R6Q4_PSEST/16-118NTIGIERAKGFFLRLGYQSGLRD--------AELARKLRPHCSELDIFLAGPQ---LHSLTGMV----------------
Q43965_ACICA/22-124QMLGLERTKRFFIRCGYQAGMRD--------AEVTSKLRPNLNEAEAFMAGPQ---MHGIRGMV----------------
Q8KP44_PSEME/48-150EALGLDKARGLLTRIGWQAGTRD--------AAQVSAQWPEGDHASLYSAGPR---LHMLEGMV----------------
XYLR_PSEPU/16-118SLIGVERAKGFFLRLGYQSGLMD--------AELARKLRPAMREEEVFLAGPQ---LYALKGMV----------------
Q9S150_COMTE/30-132NTMGPDHTRRLLLRAGYAAGERD--------ALLARQIRPTASLFEMFAVGPQ---LHRLEGAV----------------
Q06573_PSEUF/16-118NTLGIERAKGLFLRHGYQSGLKD--------AELARKLRPNASEVGMFLAGPQ---MHSLKGLV----------------
Q8VUU3_9BURK/14-116ESVGPAPTRRYFTRAGFAAGERD--------AVLAREIRGNASLYDMFAVGPQ---LHMLEGAA----------------
O06645_9PSED/24-130AYSGPDYTREFLTRIGFTTGQRD--------AEMIIKKQGISSIKEQIYAGGV---LHALQGFL----------------

PF07700

Q7Q9W6_ANOGA/1-170QLYG.MDVSIKVLE----SQND
GCY8E_DROME/1-170YFYH.KEMHIELVR----EEIL
Q87NJ1_VIBPA/1-168HFGQ..VIHIMHQN----QTED
GCY35_CAEEL/1-173RIYD.TEVVMKVQE----RKQE
Q8EF49_SHEON/1-167HFQQ..KIQISHDT----CMHT
GCY34_CAEEL/1-173LVFN.LDISLVVQG----RTQR
Q899J9_CLOTE/20-185YFKE..DIEIEELE----RTNE
Q97E73_CLOAB/1-166HFNE..KIEIEEVE----KTKE
Q95NK5_HEMPU/1-172TLHG.SEVHVEIIK----NKGE
GCYDB_DROME/1-170EFYG.LDMTAYVLE----SQND
Q8YUQ7_NOSS1/1-172RFQTKVEVTQTAFR----ETGE
GCY33_CAEEL/1-170VFYQ.LDIGIQVLK----KKEK
Q8DAE2_VIBVU/1-168HFGE..ELAIQMET----LNPT
O77106_MANSE/1-172KLHN.TEVKVEILK----TKEE
Q80WY4_RAT/1-172QIHG.TEIDMKVIQ----QRSE
Q8RBX6_THETN/1-166FFKE..EISVEEVE----RGEK

PF02830

Q8DKK3_THEEB/150-211----------------------
Q7X3G7_THIRO/148-208----------------------
Q8U209_PYRFU/331-392----------------------
P74446_SYNY3/202-263----------------------
O69184_CUPNE/150-211----------------------
Q9S150_COMTE/142-203----------------------
Q7WYF6_9PSED/123-184----------------------
Q93NB0_9BURK/126-187----------------------
O84957_9RALS/130-191----------------------
P74443_SYNY3/170-231----------------------
Q8XTP9_RALSO/107-174----------------------
Y150_METJA/106-167----------------------
Q84FP2_CUPPJ/61-122----------------------
BCHJ_RHOCB/140-199----------------------
Q881E3_PSESM/120-181----------------------
O85963_SPHAR/121-182----------------------
O67571_AQUAE/116-177----------------------
Q8TXN0_METKA/66-127----------------------
Y745_METJA/119-179----------------------
BCHJ_RHOS4/143-203----------------------
Q8L387_9PSED/158-219----------------------
Q8R5R6_THETN/52-113----------------------
Q8TWC8_METKA/86-147----------------------
O27403_METTH/188-249----------------------
O58847_PYRHO/335-396----------------------
Y855_METJA/161-223----------------------
Q8VUU3_9BURK/126-187----------------------
Y1642_METJA/72-133----------------------
Y739_METJA/88-148----------------------
Q8TXN0_METKA/224-288----------------------
Q8XT87_RALSO/150-211----------------------
Q9R6Q4_PSEST/128-189----------------------
Q9KLM3_VIBCH/129-188----------------------
Q8TQT2_METAC/185-246----------------------
Q8KP44_PSEME/160-221----------------------
Y1460_METJA/95-156----------------------
Q8TV82_METKA/104-164----------------------
Q8PYJ8_METMA/191-252----------------------
Q43965_ACICA/134-195----------------------
O26930_METTH/130-191----------------------
O06645_9PSED/140-201----------------------
Q8DGL5_THEEB/132-193----------------------
Q9F2C0_THAAR/126-187----------------------
Q8TXW7_METKA/177-236----------------------
Q9ZHH9_9BURK/123-184----------------------
Q06573_PSEUF/128-189----------------------
Q8TX90_METKA/68-129----------------------
Q9F6Y2_CHLAU/138-198----------------------
Q9UZN4_PYRAB/331-392----------------------
Q9ZGF5_HELMO/140-200----------------------
XYLR_PSEPU/128-189----------------------
Q8PU31_METMA/185-246----------------------

PF06505

O69184_CUPNE/38-140------HCEPVALD....IDVQ
O84957_9RALS/18-120------RVTPLTVD....INIA
Q8L387_9PSED/46-148------KVEVQRFE....FDMA
Q8XT87_RALSO/38-140------KVVPVSFS....YAPE
O85963_SPHAR/9-111------WTQIEILE....NDSS
Q9F2C0_THAAR/14-116------GVIPLQLE....FDRA
Q881E3_PSESM/8-110------KVESLHFK....FDAE
Q9ZHH9_9BURK/11-113------RVFPLRVE....MDVP
Q9R6Q4_PSEST/16-118------KVVPIEID....IDQE
Q43965_ACICA/22-124------QVEVNELH....LSHD
Q8KP44_PSEME/48-150------NVEVVRFD....IDSS
XYLR_PSEPU/16-118------KVRLLTMD....IAIR
Q9S150_COMTE/30-132------RATPEIFE....ADEQ
Q06573_PSEUF/16-118------KVRPTELD....IDKE
Q8VUU3_9BURK/14-116------QVAPVRFD....VDIE
O06645_9PSED/24-130------TSIQAGSSALNAVDMK

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window