Sequence alignment for CL0240

PF00781

DGK3_CAEEL/427-552PLLVLVNPK-------------S..GGKQGV.......KILQK.F..EYL..L.NP......R..QV.YDL..S..K..T
CERK1_MOUSE/132-277HLLVFINPF-------------G..GKGQGK.RIY.EKTVAPL.F..TLA..S.IT......T..EI.IIT..E..HANQ
Q7XCS9_ORYSJ/234-367KILVILNPR-------------S..GHGRSSKVF..HGKVEPI.F..KLA..G.FK......M..EV.VKT..T..H..A
DGKG_HUMAN/434-558PLLVLVNPK-------------S..GGRQGE.......RILRK.F..HYL..L.NP......K..QV.FNL..D..N..G
DGKQ_HUMAN/588-715PLLVFVNPK-------------S..GGLKGR.......DLLCS.F..RKL..L.NP......H..QV.FDL..T..N..G
BMRU_BACSU/5-132KALLIHNGN-------------A..GNKNIE..KA.LGAVVPV.L..SHH..L.DE......V..II.KQT..K..K...
DGKA_DICDI/334-467VLFVFVNSK-------------S..GGQFGS.......TLIRK.L..SSL..L.NP......L..QI.IDL..I..K.CG
DGK1_DROME/552-676PLLVFVNPK-------------S..GGRQGD.......RILRK.F..QYM..L.NP......R..QV.YDL..S..K..G
SPHK1_HUMAN/16-153RVLVLLNPR-------------G..GKGKALQLF..RSHVQPL.L..AEA..E.IS......F..TL.MLT..E..R..R
LCBK1_ARATH/249-382KMLVILNPR-------------S..GHGRSIKVF..HNVVEPI.F..KLA..G.IK......M..EV.VKT..T..K..A
Q7QIP4_ANOGA/172-308KMLIILNPK-------------S..GSGKAREMF..QQRVAPI.F..AEA..E.IP......Y..DL.HIT..K.K...S
YEGS_PSEPK/6-128AMLVLHGKQ-------------A..MNEDVR.......SAVGD.L..RDS..G.WV......L..DV.RVT..W.E...A
DGK2_DROME/812-938PVIVFINPK-------------S..GGNQGH.......KLLGK.F..QHL..L.NP......R..QV.FDL..T..Q..G
O05848_MYCTU/2-130RAVLIVNPT-------------A..TATTPA.....GRDLLAH.A..LES..R.LQ......L..TV.EHT..N..H..R
DGKZ_RAT/296-420PLLVFVNPK-------------S..GGNQGA.......KIIQS.F..LWY..L.NP......R..QV.FDL..S..Q..G
LCB4_SCHPO/107-265RFIVFINPH-------------G..GKGKAK..HIWESEAEPV.F..SSA..H.SI......C..EV.VLT..R..R..K
DAGK_BACSU/3-131RARIIYNPT-------------S..GREIFKKHL...AQVLQK.F..EQA..G.YE......T..ST.HAT..T..C..A
YTLR_BACSU/3-130HWFFIINPT-------------A..GHRNGL.......RVWKS.I..QKE..L.IK......R..KV.EHR..S..FLTE
O44334_DROME/205-332PLIVIANTK-------------S..GSSTGA.......NVLSL.L..RGY..L.HP......L..QV.MEL..G..S..R
DAGK_MYCTU/13-145KVTALTNPL-------------S..GHGAAVKAA...HGAIAR.L..KHR..G.........V..DV.VEI..V..G..G
O65419_ARATH/379-515RLLVFVNPF-------------G..GKKSAR.EI.....FVKE.V..KPL..F.ED......A..DV.QLE..I..QETK
O65419_ARATH/909-1042KLLVFVNPF-------------G..GKKTARKIF..QEEVKPL.F..EDA..N.IQ......L..EI.QET..K..Y...
O82359_ARATH/53-194DLVFVVNPQ-------------G..ANGRTAKEW...KKLLPH.L..RSR..LGKD......C..NV.SEL..L..T..S
DGKA_MOUSE/372-495PLLVFINLK-------------S..GGKQGQ.......SVLWK.F..QYI..L.NP......R..QV.FDL..K..D...
O88885_MOUSE/138-275RVLVLLNPQ-------------G..GKGKALQLF..QSRVQPF.L..EEA..E.IT......F..KL.ILT..E..R..K
DGKE_HUMAN/219-350PLIILANSR-------------S..GTNMGE.......GLLGE.F..RIL..L.NP......V..QV.FDV..T..K..T
P72262_RHOER/199-320GLLVVVNPE-------------S..GPDSVD........PSEE.I..ATA..L.PQ......A..HV.RAL..D..T.DH
P72269_RHOER/199-326GLLVFTNPG-------------S..GSEDDG........IVES.I..REL..L.PE......A..IV.YEF..D..A.DI
LCB5_YEAST/270-410SIFVIINPF-------------G..GKGKAK.KL....FMTKA.K..PLL..L.AS......R..CS.IEV..V..Y.TK
DGK5_CAEEL/418-545PLLVFVNPK-------------S..GGNKGS.......KALHT.L..CWL..L.NP......R..QV.FDI..T..S.LK
Y510_MYCBO/72-200SASFLWAPD-------------P..GTMRLV.......TSIRK.R..GRR..I.SV......A..DV.ELT..Q..G..G
LCB4_YEAST/228-368SILVIINPH-------------G..GKGTAK.NL....FLTKA.R..PIL..V.ES......G..CK.IEI..A..Y.TK
Q17860_CAEEL/548-676PLLVLVNVK-------------S..GGCQGT.......ELIQS.F..RKL..L.NP......F..QV.FDV..L..N..G
Q18425_CAEEL/87-224NLLVFINPN-------------S..GTGKSLETF..ANTVGPK.L..DKS..L.IR......Y..EV.VVT..T..GPNH
DGK1_ARATH/361-490PLLVFINKK-------------S..GAQRGD.......SLRQR.L..HLH..L.NP......V..QV.FEL..S..S.VQ
Y036_SYNY3/126-267TGHLIFNPV-------------A..GQGNVEREL...DLIKEH.L..QSE..I.NL......K..IT.FTS..A..E.VN
Q7MUX7_PORGI/2-127KILAIINPI-------------S..GIGSKS.NI....PSLIA.D..VFA..H.DP......H..EL.FIT..Y..SQRA
Q7NFK6_GLOVI/25-155SACLIYNPV-------------A..GQGDAE.......ADLWL.I..RSF..L.DP......V..FD.LDI..R..L..T
Q7NHQ5_GLOVI/4-128RAWLIFNPV-------------A..GRGNGE.......TDLSL.I..EQT..L.QE......K..YD.LHV..L..L..T
Q7S9Y1_NEUCR/163-325RAWVLVNPH-------------A..GPGGADKIF..EKKVRPI.F..EAA..R.MP......L..TV.VRT..T..Y..S
Q7WU58_THESQ/26-155MVFLIYNPA-------------A..GGGRAGKIW...DRVEDL.L..KKH..G.ID......H..KV.AFT..E..R..P
Q7XN57_ORYSJ/228-361RILVILNPR-------------S..GHGRSCKVF..HDKAEPI.F..KLA..G.FH......M..EV.VKT..T..H..A
Q7XQT2_ORYSJ/45-188PVVVFINSR-------------S..GGQLGS.......SLIKT.Y..REL..L.NK......A..QV.FDL..S..E..E
Q7Z299_CAEEL/18-143PIMVIVNPK-------------S..GSGAGK.......QLLRN.F..RAH..L.HP......A..QV.VDV..L..K..S
AGK_DANRE/65-196KATVILNPA-------------A..CKGKANQLF..EKNAAPI.L..HLA..G.VE......V..KI.VKT..D..Y.EG
Q816L3_BACCR/8-134KVLLIVNPK-------------A..GQGDLHTNL...TKIVPP.L..AAA..F.PD......L..HI.LHT..K..K..Q
Q81IN1_BACCR/4-126RARIIYNPT-------------S..GRELFKKSL...PEVLQK.L..EQA..G.YE......T..SC.HAT..T..G..P
Q825G8_STRAW/196-328DLVVLVDGR-------------A..GTGLPGAVL...P.AVER.L..RVL..L.PR......A..EL.VEF..G..P.DD
Q828H5_STRAW/4-131EITLFVNPT-------------A..GRGRGA..HA.AQPAASA.L..RAA..G.FS......V..RT.ILG..E..N.AE
Q82DG7_STRAW/133-259RAFFLMNPR-------------S..GGGKVE.RF....GLREK.A..ERL..G.AR......V..HL.LDP..E..R.PE
Q82IW7_STRAW/2-133RALLVVNPA-------------A..TTTSAR.....TRDVLIH.A..LAS..E.MK......L..EA.VTT..E..Y..R
Q82KT9_STRAW/12-140RALVLANPA-------------S..GSHSPQ..L..VREVTEL.C..GSC..L.EH......V..EL.HPT..T..A.PG
Q82LY1_STRAW/212-325AGLVVVADQ-------------G..AAAPDR.........VRA.L..GDA..L.PR......A..ET.V........QCE
Q82NY8_STRAW/196-327GLHVVVNPS-------------S..GVSRST.DA...DDAVGR.L..RSL..L.PK......A..EF.LVP..Q..E..G
Q82W90_NITEU/7-134RIGLIYNPL-------------G..GWFRKH..T...ARMQSL.L..ATL..P.EI......R..QI.QAT..D..Q..I
Q830V8_ENTFA/4-144HYYLIINEQ-------------A..SSGNGR.KV..ARKVIQQ.L..KQQ..E.LK......Y..TA.LYT..D..Y..A
Q830X4_ENTFA/3-148KAVLIVNPS-------------S..GGEKAK.EF..ETLAEEK.L..KQL..F.DE......V..VV.KQT..E..K..G
Q837V1_ENTFA/3-127KARVIYNPT-------------S..GKELIKKNL...ADILSI.L..EEC..G.YE......A..SA.FAT..T..PEEN
Q839R8_ENTFA/4-131KMMVLYNET-------------S..GSSESK.......EIAER.F..KKA..A.EA......R..GE.AVI..L..QPSN
Q840Q1_STRGR/46-174RALLVVNPA-------------A..TTTSAR.....TRDVLIH.A..LAS..E.MK......L..EA.VTT..E..Y..R
Q84S01_ORYSJ/99-233KVIVILNPN-------------S..GFRSSREVF..YQKVQPT.L..ELS..G.FM......M..QV.VET..A..Y..A
YEGS_VIBPA/3-130TIRAILNGK-------------K..AGNPEL......RDAIMK.M..RDR..G.VD......V..QV.RVT..W..E..S
Q87TI4_VIBPA/240-363PTWMVVNPV-------------A..GGGKWL...QYEQHVIRE.LTKKYR..L.SI......R..QT.DET..T..S...
YEGS_PSESM/6-125AMLILHGKQ-------------S..LNEDVR.......DAVAD.K..RKQ..G.WE......L..DV.RLT..W..E..A
Q898U2_CLOTE/3-130KVKFIYNPY-------------S..GENAIISDL...DTVIDV.H..QKY..G.YT......V..IP.YRI..S..M...
Q89ZQ4_BACTN/7-138KWGVIYNPK-------------A..GTRKVQKRW...KEIKEY.M..DSK..G.VN......Y..DY.VQS..E..G..F
Q8A9E4_BACTN/3-128RIIFVVNPI-------------S..GTQSKE.LI..LNLLDEK.I..DKA..R.YT......W..EV.VYT..E..R..A
Q8CJN4_STRCO/135-258HPWVLVNRL-------------S..GGGKVD.RF...A.LVDK.A..RNA..G.........C..RV.REL..D..R..D
Y507_STAES/7-139HGVLFYHEH-------------S..GLKDIH.......NGIGE.V..AKS..L.SS......M..CK.HLS..L..Q.LS
Q8DT50_STRMU/7-131RARLIYNPT-------------S..GQEIMKKNV...AEVLDI.L..ESF..G.YE......T..SA.FQT..T..P...
Q8DZ02_STRA5/3-133SAYIFFNPK-------------S..GKDEQA.......LAKEV.K..SYL..I.EHDFQDDYV..RI.ITP..S..S..V
Q8E5W0_STRA3/6-135KARLIYNPT-------------S..GQEIMKKNVAEVLDILEG.F..GYE..T.SA......F..QT.TPT..K..N..S
Q8E7Z2_STRA3/2-129TLYIIANPH-------------A..GNKNAS.......TIVGK.I..QEL..Y.HTE....DI..SV.FYT..E..QKDD
Q8ES48_OCEIH/3-126TVAVIVNPN-------------A..GNQQLKNEI...DTIEAR.L..KDV..F.EE......V..TI.YKT..E..K..E
Q8ES76_OCEIH/3-131KARIIYNPT-------------S..GREAIKRAL..PN.ILEK.L..EVA..G.FE......T..ST.HAT..T..C..E
YEGS_ECOL6/6-132ASLLILNGK-------------S..TDNLPL......REAIML.L..REE..G.MT......I..HV.RVT..W..E..K
Q8FMN3_COREF/5-141HLLLIANPQ-------------S..TTQTAE.......LFRRV.V..PKL..L.AI.....DG..LT.MET..R..F.TH
Q8G3W8_BIFLO/116-238QYAFIVNPS-------------K..PQAEAR......RLHIQR.F..CEAKGL.NR......I..RF.YDT..Q..LDKD
Q8H350_ORYSJ/132-250RLFIIVNPY-------------G..GKRGGR.......KIFQT.E..VLP..L.IE......A..AG.ILY..T..MQTK
Q8K7G9_STRP3/3-133TVRIFYNPN-------------S..GKKEDQ..L..AGQVKDY.F..CQH..G.FS......E..DS.VEI..I..T.PK
Q8KC59_CHLTE/8-129SFTFIFNPA-------------A..DKGRAA.......DKTAL.I..ERS..L.AH......F..EV.ASL..E..T.TR
Q8L7L1_ARATH/120-252KLLVFVNPF-------------G..GKKTARKIF..QEEVKPL.F..EDA..N.IQ......L..EI.QET..K..Y...
Q8LE70_ARATH/40-181PVLVFINSK-------------S..GGQLGG.......ELILT.Y..RSL..L.NH......N..QV.FDL..D..Q..E
Q8MUB2_APLCA/403-531PLMVFVNVK-------------S..GGCQGL.......DLITS.F..RKL..L.NP......H..QV.FNL..E..N..G
DGKD_HUMAN/321-446PLLVFVNSK-------------S..GDNQGV.......KFLRR.F..KQL..L.NP......A..QV.FDL..M..N..G
Q8NMJ5_CORGL/9-145HVLLIANPE-------------S..TTQTQK........LFRR.V..VPA..L.MA......L..DG.VSLEARFTH.YG
Y688_STAAW/7-138HGVLFYHEH-------------S..GLKNIN.......QGIGE.V..TTA..L.SS......I..CK.HLS..I..Q.LS
YEGS_XANCP/5-130HWRLILNGK-------------S..TDNEDL......REAVGV.L..RKR..G.IQ......L..DV.RVT..W..E..E
Q8R6L5_THETN/1-126MIAFIVNPV-------------A..GGGRAYRKI...PEIRRI.M..KKK..L.ID......Y..KI.FIT..K..Y..A
Q9VZW0_DROME/216-357RVLVLLNPK-------------S..GSGDAREVF...N...MH.V..TPV..L.NE......A..EVPYDL..Y..V.TK
CERK1_HUMAN/132-278HLLVFINPF-------------G..GKGQGK..RIYERKVAPL.F..TLA..S.IT......T..DI.IVT..E..HANQ
Q8VZG1_ARATH/91-237PMVVFINPN-------------S..GGRHGP.......VLKER.L..QQL..M.SE......E..QV.FDL..T..E.VK
Q8XKR6_CLOPE/3-130KVRFIYNPY-------------S..GENAILKEL...DKIITM.H..QDK..G.YT......I..VP.YRI..Q..R.GV
Q8Y497_LISMO/4-132KAMIIYNPA-------------A..GKNKFR.......KLLPD.A..EKI..L.TE......A..NF.EVT..L..VPST
Q8Y6D4_LISMO/4-133HARVIYNPT-------------S..GREIIKKNL...ADVLSI.L..EQA..G.YV......T..SA.HAT..T..A.EP
Q8Y8W8_LISMO/3-130KALLIVNPS-------------S..GKEKGK.TY..QGKTEEV.L..KKR..Y.DE......V..EV.RLT..E..K..A
Q8YT45_NOSS1/28-150RALLLVNRH-------------ARQGQERLL.......EAIDH.L..KKF..N.FQ......L..IE.ETT..E..H...
Q8YVU8_NOSS1/4-134SACLIFNPV-------------A..GQGDPEVDL...A.AIRA.I..LEP..E.MD......L..DI.YLT..T..E.EI
Q92R72_RHIME/2-130KVKAIFNRD-------------G..GTFRTTDMDAYSRKVEED.F..RAA..G.HE......I..EI.AVV..G..A.DE
Q95S15_DROME/5-150RLLVFINPY-------------G..GRKAGA.QTY.ERHVRPI.F..QLA..G.VD......A..TC.ITT..Q..RANQ
Q97L83_CLOAB/3-130KVKFIYNPF-------------S..GENLIINNI...DKVIKT.H..QKY..G.YT......IVPHR.IEL..N..C...
Y1045_STRPN/3-130KAMVIINPT-------------S..GGEKAL...DYKEKLENK.A..KEY..F.EY......V..ET.KIT..E..K..A
Q98FN7_RHILO/63-205KFAAVLNRD-------------G..GTLRTTDLAAFSDRMRQT.L..EAA..G.HS......L..SI.DVV..A..G..K
Q98I19_RHILO/35-169KVGVVLNPI-------------A..GGGRLKRHW...PEVAAS.L..KKH..F.GD......F..EL.RET..Q..A..E
Q98NZ1_RHILO/168-300KVMALINKR-------------A..GAAARE..GDIERAVRDG.F..AER..G.VE......A..DV.RLV..E..G..R
DAGK_STAAM/4-132RARIIYNPT-------------S..GKELFKREL...PDALIK.L..EKA..G.YE......T..SA.YAT..E..K..I
Q9CEN8_LACLA/2-173TYYLLANPN-------------S..GAGKGARTL...ETLIPY.L..EKN..N.YE......Y..RL.FKT..K..A..A
Q9CEU7_LACLA/3-134NVKVFYNEK-------------S..GNNDEDKVL...KTIKDF.F..ARP..E.NS......A..SK.LEF..I..N.PE
Q9CIE3_LACLA/3-135KARLIYNPT-------------S..GQEIIKKYI...ADILDK.L..EQY..G.YE......A..SA.YQT..T..A..E
Q9F3M0_STRCO/2-143RALLVVNPA-------------A..TTTSAR.....TRDVLIH.A..LAS..E.MK......L..EA.VTT..E..Y..R
Q9FFN7_ARATH/342-471PLLVFINAK-------------S..GGQLGP.......FLHRR.L..NML..L.NP......V..QV.FEL..G..S.CQ
Q9FHH4_ARATH/90-236PLMVFVNPK-------------S..GGRQGP.......LIKER.L..QNL..I.SE......E..QV.YDL..T..E..V
Q9FVC9_SOLLC/40-183PVLVFVNSK-------------S..GGQLGG.......ELLRT.F..RHL..L.NK......Y..QV.FDL..G..D..E
YEGS_PSEAE/6-128VLLVLHGKQ-------------A..GNEEVR.......AAVAA.Q..REA..G.RE......L..AV.RVT..W..E..D
SPHK2_MOUSE/147-284RLLILVNPF-------------G..GRGLAW......QRCMDH.V..VPM..I.SE......A.GLS.FNL..I..Q.TE
Q9KC00_BACHD/4-128RAFLLYNGK-------------A..GNGKTDKYL...KDVVPR.A..LQS..I.GE......L..TI.IPS..K..E..K
Q9KF21_BACHD/3-130TARLIYNPT-------------S..GREQIRKSL...AYILER.L..ELA..G.YE......T..ST.HAT..T..G.EG
SPHK2_HUMAN/182-319RLLLLVNPF-------------G..GRGLAWQWC..KNHVLPM.I..SEA..G.LS......F..NL.IQT..E..R..Q
Q9RJ98_STRCO/3-124QFTAVVNPT-------------A..GGATSA......AALLGV.A..RLL..R.EA......G..AG.LET..E..Y.SH
Q9RS93_DEIRA/20-138DATLIFNRK-------------A..GGSEGY........APEQ.F..TEK..L.QQ......V..GY.RPV..Y..R...
Q9RU35_DEIRA/21-149PFAVVLNAQ-------------A..GRGLAGREW...PRLRGE.L..EAR..G.IA......Y..QL.VAA..Q..S...
Q9RUM1_DEIRA/11-127RMLVVFNPK-------------S..GQGESG..L...SEFVEH.L..RAA..G.AE......V..TE.REL..A..E..G
Q9VL10_DROME/56-181KVLVVMNPV-------------A..NKKRSEKFF..KNYCEPV.L..HLA..G.YS......V..EI.LRT..N..H..I
Q9VYY8_DROME/190-333QLLILLNPK-------------S..GSGKGR.......ELFQKQV..APL..L.TE......A..EVQYDL..Q..I.TT
Q9ZC02_STRCO/213-325GLVMVANVG-------------S..GTSDRV..........RA.L..CDA..L.PD......A..EV.VEC..E..P..G

PF01513

ACOX_CUPNH/14-336VVGIIANPI.......SARDIRRVIANANSLQLADRVNIVLRL-L--AAL--.-ASCGVERVL--MM-PDR--E--GLRV
Q46144_9CLOT/3-316KIGIIANPS.......SGKDIRRLVSHATTVDNNEKVNIVERI-V--LSA--.-QAFGVTKVY--IM-ADT--Y--QIGY
Q97BD3_THEVO/2-346NIAFVINPVAGLGATLNLKGSDGLALEDVSKSISIVRSHRFLK-K--LDF--.-.....NGLH--FF-VPS--G--CMGE
PPNK_AQUAE/3-259KVLVFLKNS.....................KKAFETFKRVERV-L--KDL--N-L......SY--KK-FIN--R--K...
PPNK_HAEIN/10-277TIALVGKPR....................NDINLQMHKNLFHW-L--MER--.-.......GY--QV-LVE--K--EVAI
Q9I3E5_PSEAE/5-369RLGLVVNPLAGLGGPVALKGSDGVAAEALARGAEPRALERTRI-A--VEC--.-LLPLVEKIE--FL-TFP--G--AMGG
Q9HWN2_PSEAE/7-324IVGIIANPA.......SGRDLRRLTAHAGLHSSTDKASVVQRL-L--AAF--.-GATGIRHAL--LP-PDM--T--GIAA
PPNK_METJA/303-560KFGIVVRED....................KEEAINLAIEICKY-L--KDK--.-.......NI--PF-CVE--D--FL..
YEF1_YEAST/108-407NLIIICNIN....................DISTVFLMREVVEW-I--LRN--F-H......SI--TV-YVQ--D--IFKK
PPNK_METTH/3-261RIGIIARFD....................VAEAVEIAERVASF-L--LNR--.-.......GV--EI-TVD--L--KLTE
PPNK_ARCFU/2-235RAAVVYKTD......................GHVKRIEEALKR-L--EVE--.-.........--..-...--.--....
Q97Y21_SULSO/3-315AVGIIVNPE.......SGRDIRRLVAKATFVSNYAKIDTIKRF-L--YGL--N-ITNSVDEVV--FM-PDF--Y--GISL
UTR1_YEAST/129-428NLMIVTKLN....................DVSLYFLTRELVEW-V--LVH--F-P......RV--TV-YVD--S--ELKN
PPNK1_BACSU/2-248KFAVSSKGD.....................QVSDTLKSKIQAY-L--LDF--.-.........--..-...--.--....
PPNK_MYCTU/6-284SVLLVVHTG....................RDEATETARRVEKV-L--GDN--K-I......AL--RV-LSA--E--AVDR
Q52013_PSEPU/7-324IVGIIANPA.......SGRDLRRLTANAGLYSSTDKASAIQAC-W--RPS--.-VPTGIGQVL--LP-SDM--T--GIAA
PPNK2_SYNY3/5-277QVIIAHKAG....................HNESKTYAERCARE-L--EAR--.-.......GC--KV-LMG--P--SGIK
Q9V1D1_PYRAB/4-378VIGLIINPIAGMGGRVALKGTDGVVEEAIRRGARPIAQDLVKL-F--LEE--.-LSSYDLDVN--FI-TGP--G--PLGE
PPNK2_BACSU/7-253NVYFFHKQD.....................QETNEQARSLTQL-A--EEH--.-.........--..-...--.--....
O59324_PYRHO/2-376KVGLIINPIAGMGGRVALKGTDGVVEEAVKRGARPISQKLVEL-F--LKE--.-LESYNVAVE--FL-TGP--G--PLGE
PPNK_HELPY/7-261TIGVFVRPT..............HYQNPLFEKLEQAKEWVLKL-L--EDE--.-.......GF--ES-FMI--D--....
PPNK_PORGI/3-259KIAIFGSRH....................KSEQGASIKALILK-L--EEA--.-.......GT--PL-YIE--R--KFLS
YDU2_SCHPO/164-495KVLLICNDN.....................KESIERSVELAQW-L--LDT--F-SFTPS..SS--HN-NMA--S--SNTQ
PPNK_MYCGE/2-241KYKIFASTT.....................PQTEPVLNKLRAV-L--KTW--.-.........--..-...--.--....
Q9HRC1_HALSA/3-357TVGVVVNPIAGMGGRVGLKGTDGNVAEARKRGADQRAPQRART-A--LDA--.-LRDAAGDVS--VV-TYD--E--PMGG
PPNK_PYRHO/2-261KFGIVARRD....................KEEALKLAYRVYDF-L--KVH--.-.......GY--EV-VVD--K--ETYE
Q9HJA2_THEAC/8-352RVAFFVNPLAGYGSFFNLKGSDGLKIEDPEKSISIRRSMEFLR-L--VDF--.-.....SRYF--FI-VPS--G--YMGE
PPNK1_SYNY3/3-276KVGIIFNDD....................KPTACSVAQELQEQ-L--QQS--.-.......GF--TV-AME--T--GSGG
PPNK_SHIFL/7-272CIGIVGHPR....................HPTALTTHEMLYRW-L--CTK--.-.......GY--EV-IVE--Q--QIAH
Q971Y1_SULTO/4-354KIGFLVNPIAGSGGRIGHKGSDDLYIENLE.....TPLKIKRF-L--SLA--.-...PKKGVE--YI-VAE--N--KMGE
PPNK_BORBU/4-265KVLLCINTL....................KSGASILGNDVKVY-L--ETK--Y-FVEVVLI..--..-...--.--....
PPNK_MYCPN/2-241KYKIFASTT.....................PQTEPVLQKLKQV-L--KGC--.-.........--..-...--.--....
Q97ZM3_SULSO/4-354KIGFLVNPYAGSGGRIGKKGSDELNIENPE.....IPMRVTRF-L--SKA--.-....PEDAI--YL-TPR--L--KMGE

PF00365

K6PL_HUMAN/16-326KAIGVLTSG---------GDAQGMNAAVRAVTRMGIYVGAKVFLI--YEGYEGLVEGG.ENIK--QANWLSVSNIIQLGG
K6PF_HUMAN/16-326KAIAVLTSG---------GDAQGMNAAVRAVVRVGIFTGARVFFV--HEGYQGLVDGG.DHIK--EATWESVSMMLQLGG
K6PF1_THET8/2-280KRIGVFTSG---------GDAPGMNAAIRAVVRQAHALGVEVIGI--RRGYAGMIQG...EMV--PLGVRDVANIIQRGG
K6PF2_KLULA/176-488KSIAVMTSG---------GDAPGMNANVRAIVRTAIFKGCNAFVV--MEGYEGLVKGGPNYIK--QVYWETVRNWSCEGG
K6PF1_KLULA/184-494KKIAVMTSG---------GDSQGMNAAVRAVVRSSIYYGCDVYAV--YEGYEGLVKGG.DYLR--KMEWKDVRGWLSEGG
K6PF1_SHIFL/3-278KKIGVLTSG---------GDAPGMNAAIRGVVRSALTEGLEVMGI--YDGYLGLYED...RMV--QLDRYSVSDMINRGG
K6PF_LACLA/2-278KRIAVLTSG---------GDAPGMNAAIRAVVRKAISEGIEVYGI--NHGYAGMVAG...DIF--PLTSASVGDKIGRGG
K6PP_HUMAN/25-335KAIGVLTSG---------GDAQGMNAAVRAVVRMGIYVGAKVYFI--YEGYQGMVDGG.SNIA--EADWESVSSILQVGG
K6PF_LACDE/2-277KRIGILTSG---------GDAPGMNAAVRAVTRVAIANGLEVFGI--RYGFAGLVAG...DIF--PLESEDVAHLINVSG
K6PF_SPICI/3-279KKIGILTSG---------GDSQGMNAAIAGVIKTAHAKGLETYII--RDGYLGLINN...WIE--VVDNNFADSIMLLGG
K6PF_GEOSE/2-277KRIGVLTSG---------GDSPGMNAAIRSVVRKAIYHGVEVYGV--YHGYAGLIAG...NIK--KLEVGDVGDIIHRGG
K6PF_HAEIN/3-279KKIAVLTSG---------GDAPGMNAAIRGVVRSALAEGLEVFGI--YDGYQGLYNN...KIK--QLNRYSVSDVINRGG

PF00781

DGK3_CAEEL/427-552GPE..P------------------------------------------------------G......LQL.FST.LKNC.
CERK1_MOUSE/132-277AKE..T------------------------------------------------------L......YEI...N.TDSY.
Q7XCS9_ORYSJ/234-367GHA..K------------------------------------------------------S......LVS.TID.FSTC.
DGKG_HUMAN/434-558GPT..P------------------------------------------------------G......LNF.FRD.TPDF.
DGKQ_HUMAN/588-715GPL..P------------------------------------------------------G......LHL.FSQ.VPCF.
BMRU_BACSU/5-132.KD..D------------------------------------------------------A......YHF.CRS.IDDS.
DGKA_DICDI/334-467GPD..S------------------------------------------------------T......LQMINRY.LAKHP
DGK1_DROME/552-676GPK..E------------------------------------------------------G......LTL.FKD.LPRF.
SPHK1_HUMAN/16-153NHA..R------------------------------------------------------E......LVR.SEE.LGRW.
LCBK1_ARATH/249-382GHA..R------------------------------------------------------E......LAS.TVD.INLC.
Q7QIP4_ANOGA/172-308NWA..R------------------------------------------------------E......FVR.VRD.VYLW.
YEGS_PSEPK/6-128GDA..Q------------------------------------------------------R......LVAEALA.AGYS.
DGK2_DROME/812-938GPK..M------------------------------------------------------G......LDM.FRK.APNL.
O05848_MYCTU/2-130GHG..T------------------------------------------------------E......LG..QAA.VADG.
DGKZ_RAT/296-420GPR..E------------------------------------------------------A......LEM.YRK.VHNL.
LCB4_SCHPO/107-265DHA..K------------------------------------------------------S......IAK.NLD.VGSY.
DAGK_BACSU/3-131GDA..T------------------------------------------------------H......AAK.EAA.LREF.
YTLR_BACSU/3-130HPG..H------------------------------------------------------A......EVL.ARQ.ISTIQ
O44334_DROME/205-332GPQ..D------------------------------------------------------A......LQW.AAK.ASPR.
DAGK_MYCTU/13-145DAH..D------------------------------------------------------A......RHLLAAA.VAKG.
O65419_ARATH/379-515YQL..H------------------------------------------------------A......KEF.VKS.MDVSK
O65419_ARATH/909-1042.QL..H------------------------------------------------------A......KEI.VRS.MDVSK
O82359_ARATH/53-194GPS..H------------------------------------------------------A......IDITREA.IRDG.
DGKA_MOUSE/372-495GPE..P------------------------------------------------------G......LRF.FKD.VPQF.
O88885_MOUSE/138-275NHA..R------------------------------------------------------E......LVC.AEE.LGHW.
DGKE_HUMAN/219-350PPI..K------------------------------------------------------A......LQL.CTL.LPYY.
P72262_RHOER/199-320DFA..A------------------------------------------------------Q......LDA.WVA.EANP.
P72269_RHOER/199-326DFD..M------------------------------------------------------Q......IDAKIPE.LSPK.
LCB5_YEAST/270-410YPG..H------------------------------------------------------A......IEI.ARE.MDIDK
DGK5_CAEEL/418-545GPK..F------------------------------------------------------G......LEM.FRK.VVTQ.
Y510_MYCBO/72-200RTA..V------------------------------------------------------H......AVVTLGE.PEHF.
LCB4_YEAST/228-368YAR..H------------------------------------------------------A......IDI.AKD.LDISK
Q17860_CAEEL/548-676GPL..V------------------------------------------------------G......LYV.FRN.IPKY.
Q18425_CAEEL/87-224ARN..V------------------------------------------------------L......MTK..AD.LGKF.
DGK1_ARATH/361-490GPE..V------------------------------------------------------G......LFL.FRK.VPHF.
Y036_SYNY3/126-267VTD..Q------------------------------------------------------A......KEI.VKR.IKQAN
Q7MUX7_PORGI/2-127GHA..R------------------------------------------------------E......LAA.QAV.EKHY.
Q7NFK6_GLOVI/25-155TPE..V------------------------------------------------------G......ANALARA.AMERG
Q7NHQ5_GLOVI/4-128GPE..Q------------------------------------------------------E......ADALAREALACG.
Q7S9Y1_NEUCR/163-325GEA..V------------------------------------------------------T......LA...QD.LDISE
Q7WU58_THESQ/26-155GRA..M------------------------------------------------------E......ISKKAFK.EGYR.
Q7XN57_ORYSJ/228-361GHA..K------------------------------------------------------S......LAS.TFD.FSAF.
Q7XQT2_ORYSJ/45-188APE..K------------------------------------------------------V......LHRLYCN.FEKLK
Q7Z299_CAEEL/18-143NIA..A------------------------------------------------------S......LRW.IDE.HPNV.
AGK_DANRE/65-196QAK..K------------------------------------------------------L......MEL.....MEQT.
Q816L3_BACCR/8-134GDA..T------------------------------------------------------K......Y...CQE.FASK.
Q81IN1_BACCR/4-126GDA..T------------------------------------------------------V......AAR.QAA.DRKF.
Q825G8_STRAW/196-328DFA..A------------------------------------------------------L......LAGAAGR.AARR.
Q828H5_STRAW/4-131DAL..A------------------------------------------------------R......ARE.AVA.GGTG.
Q82DG7_STRAW/133-259PED..V------------------------------------------------------A......ALA.REA.VANG.
Q82IW7_STRAW/2-133GHA..R------------------------------------------------------D......LGRQAAD.SEDI.
Q82KT9_STRAW/12-140DAT..V------------------------------------------------------A......VRRALQR.PAHA.
Q82LY1_STRAW/212-325PDE..V------------------------------------------------------R......AEL.EKA.AARA.
Q82NY8_STRAW/196-327QEL..P------------------------------------------------------E......LLE..RA.ARQAK
Q82W90_NITEU/7-134EFE..R------------------------------------------------------A......VTV.VVE.AKIG.
Q830V8_ENTFA/4-144GHE..K------------------------------------------------------E......LTK.ELA.ETTLL
Q830X4_ENTFA/3-148GDA..E------------------------------------------------------Q......FAR.EAA.ESHF.
Q837V1_ENTFA/3-127SAR..N------------------------------------------------------E......AHR.AAR.AGFD.
Q839R8_ENTFA/4-131PDIDPE------------------------------------------------------E......MRK.NAK.ENQV.
Q840Q1_STRGR/46-174GHA..R------------------------------------------------------D......LGRRAAD.SDDI.
Q84S01_ORYSJ/99-233GHA..H------------------------------------------------------A......LAS.TVD.LSTC.
YEGS_VIBPA/3-130QDM..P------------------------------------------------------R......LVKEAVT.DGIE.
Q87TI4_VIBPA/240-363..A..E------------------------------------------------------S......LALQAKQ.SGVN.
YEGS_PSESM/6-125GDA..Q------------------------------------------------------R......LVNEALA.AGHR.
Q898U2_CLOTE/3-130..E..H------------------------------------------------------E......LSEAFED.IDET.
Q89ZQ4_BACTN/7-138GSV..E------------------------------------------------------R......LAKILAN.NGYR.
Q8A9E4_BACTN/3-128GHA..V------------------------------------------------------E......IAA.KAA.EEKA.
Q8CJN4_STRCO/135-258QDV..T------------------------------------------------------T......LAR..QA.VADG.
Y507_STAES/7-139ENK..G------------------------------------------------------D......IIKYCKS.IKNEN
Q8DT50_STRMU/7-131RAD..S------------------------------------------------------A......KNE.AAR.ASQAG
Q8DZ02_STRA5/3-133EEA..V------------------------------------------------------A......LAK.KAS.EDHI.
Q8E5W0_STRA3/6-135ARD..E------------------------------------------------------A......ARA...A.QAGF.
Q8E7Z2_STRA3/2-129EKK..Q------------------------------------------------------V......INI.LRS.FKES.
Q8ES48_OCEIH/3-126GDG..K------------------------------------------------------K......IIE...K.IYSK.
Q8ES76_OCEIH/3-131GDA..T------------------------------------------------------E......AAK.IAV.ERRY.
YEGS_ECOL6/6-132GDA..V------------------------------------------------------R......FVEEARK.LGVA.
Q8FMN3_COREF/5-141YSG..H------------------------------------------------------A......EEM.VRG.MTRAD
Q8G3W8_BIFLO/116-238GRV..C------------------------------------------------------A......LEA.....LEDG.
Q8H350_ORYSJ/132-250HRL..H------------------------------------------------------A......QEI.AHS.LDLRK
Q8K7G9_STRP3/3-133DAD..Q------------------------------------------------------A......FQL.AKQ.AAKDK
Q8KC59_CHLTE/8-129FAG..H------------------------------------------------------A......AEI.ARA.AAGE.
Q8L7L1_ARATH/120-252.QL..H------------------------------------------------------A......KEI.VRS.MDVSK
Q8LE70_ARATH/40-181TPD..K------------------------------------------------------V......LRRIYLN.LERLK
Q8MUB2_APLCA/403-531GPL..P------------------------------------------------------G......LYV.FRN.IPYY.
DGKD_HUMAN/321-446GPH..L------------------------------------------------------G......LRL.FQK.FDTF.
Q8NMJ5_CORGL/9-145GHA..E------------------------------------------------------E......MVA.GLT.VDDF.
Y688_STAAW/7-138ENE..G------------------------------------------------------D......IIKYCQE.IKTKN
YEGS_XANCP/5-130GDA..E------------------------------------------------------R......YVA..EA.IADG.
Q8R6L5_THETN/1-126GHG..K------------------------------------------------------I......LAR.KAA.LSGF.
Q9VZW0_DROME/216-357HSN..F------------------------------------------------------A......IE..FLS.TRCLD
CERK1_HUMAN/132-278AKE..T------------------------------------------------------L......YEI...N.IDKY.
Q8VZG1_ARATH/91-237PHE..F------------------------------------------------------VRYGLGCLEK.VAA.EGDEC
Q8XKR6_CLOPE/3-130DVI..N------------------------------------------------------A......LDI.VDS.TYEY.
Q8Y497_LISMO/4-132PAP..K------------------------------------------------------S......TTFIAKQ.AAEAG
Q8Y6D4_LISMO/4-133DDA..K------------------------------------------------------H......AAE.EAV.RNRF.
Q8Y8W8_LISMO/3-130GDA..T------------------------------------------------------E......FAS.WAA.EQGF.
Q8YT45_NOSS1/28-150.PK..H------------------------------------------------------L......SQV.IHK.YKDQ.
Q8YVU8_NOSS1/4-134GAD..K------------------------------------------------------L......AQE.AVE.RGVE.
Q92R72_RHIME/2-130MRD..T------------------------------------------------------L......ETA.CGR.GDLD.
Q95S15_DROME/5-150VKD..I------------------------------------------------------L......LSH...D.LGVY.
Q97L83_CLOAB/3-130......------------------------------------------------------S......IESAFDD.IDDT.
Y1045_STRPN/3-130LDA..T------------------------------------------------------H......FAE.EAS.REQY.
Q98FN7_RHILO/63-205DVV..E------------------------------------------------------T......LD..NAA.SRRA.
Q98I19_RHILO/35-169GDA..E------------------------------------------------------R......LAIDLAA.TGFD.
Q98NZ1_RHILO/168-300EVG..E------------------------------------------------------L......AQR.FVA.ENKSS
DAGK_STAAM/4-132GDA..T------------------------------------------------------.......LEA.ERA.MHEN.
Q9CEN8_LACLA/2-173GEE..G------------------------------------------------------A......LVRQILD.LKNP.
Q9CEU7_LACLA/3-134SPE..D------------------------------------------------------A......IRL.AKK.ASQD.
Q9CIE3_LACLA/3-135QDS..A------------------------------------------------------K......KEA.ARA.TEAG.
Q9F3M0_STRCO/2-143GHA..R------------------------------------------------------D......LGR.QAA.QGDD.
Q9FFN7_ARATH/342-471GPD..A------------------------------------------------------G......LDL.CSK.VKYF.
Q9FHH4_ARATH/90-236KPN..E------------------------------------------------------F......IRYGLGC.LEAFA
Q9FVC9_SOLLC/40-183APD..S------------------------------------------------------V......LRRLYLN.IERLK
YEGS_PSEAE/6-128GDA..R------------------------------------------------------R......IVEEALA.AGYA.
SPHK2_MOUSE/147-284RQN..H------------------------------------------------------A......REL.VQG.LSLSE
Q9KC00_BACHD/4-128GDI..E------------------------------------------------------S......I...CRE.REVD.
Q9KF21_BACHD/3-130SAT..E------------------------------------------------------A......ARL.AGE.RRHD.
SPHK2_HUMAN/182-319NHA..R------------------------------------------------------E......LVQ.GLS.LSEW.
Q9RJ98_STRCO/3-124SLA..H------------------------------------------------------A......REL.ARR.AGER.
Q9RS93_DEIRA/20-138PTD..S------------------------------------------------------R......EDL.QRA.IEAA.
Q9RU35_DEIRA/21-149GAG..A------------------------------------------------------L......AEV.QAL.PPGQ.
Q9RUM1_DEIRA/11-127VPM..Q------------------------------------------------------D......YV...RD.LSQF.
Q9VL10_DROME/56-181GHA..K------------------------------------------------------T......YVEELAT.LPDA.
Q9VYY8_DROME/190-333HPQ..Y------------------------------------------------------A......KEF.VRT.RRDLL
Q9ZC02_STRCO/213-325DVR..A------------------------------------------------------E......LEK...A.AGHA.

PF01513

ACOX_CUPNH/14-336MLA--RHLARRQGPDSGLPAVDYLDMPVTARVD...........................D------TLRAARCMADAG-
Q46144_9CLOT/3-316KVE--DNLS...TLGELTAEINVLDMEISGTLY...........................D------TMNAAEKMEELE-
Q97BD3_THEVO/2-346SEV--SIYTKEYDVIYTPSSPTTRQ...................................D------TINFVKSI..ES-
PPNK_AQUAE/3-259...--........................................................------..ELFKVLKPKD-
PPNK_HAEIN/10-277TLE--LP.....................................................F------EHLATLEEIGHR-
Q9I3E5_PSEAE/5-369ELL--ERMGFRHRLLGEWQGAVSSAA..................................D------TRLAIERLQEAG-
Q9HWN2_PSEAE/7-324AVL--RASQTRQARDGHWPFLEFLDMPLRQSVE...........................D------TRLAARRMVERG-
PPNK_METJA/303-560...--.......................................................R------ERVGGDKFDISA-
YEF1_YEAST/108-407STQ--FAVGDLCKDSNCSKNRVK.....................................Y------WSKEFVKKHDSF-
PPNK_METTH/3-261ELP--.......................................................Q------LREYGEDIRNMD-
PPNK_ARCFU/2-235...--.......................................................V------ELFNQPSEELEN-
Q97Y21_SULSO/3-315DII--SDIK.....DDVKFKLSTLDMRVENTAD...........................D------TINASKYMIESG-
UTR1_YEAST/129-428SKK--FAAGELCEDSKCRESRIK.....................................Y------WTKDFIREHDVF-
PPNK1_BACSU/2-248...--........................................................------....DMELDENE-
PPNK_MYCTU/6-284GSL--HLAPDDMRAMGVE..........................................I------EVVDADQHAADG-
Q52013_PSEPU/7-324AVL--KASQGPGARDQHWPALEILDLPLTQTVA...........................D------TRLATRCMVERG-
PPNK2_SYNY3/5-277D..--.......................................................N------PYPVFLASATEK-
Q9V1D1_PYRAB/4-378DIL--REFNFPYEVIRHREIKFREILGVKIPDTS........................AED------TKILAREMLKRG-
PPNK2_BACSU/7-253...--........................................................------..GFTVVNQHSD-
O59324_PYRHO/2-376DAL--KKFEFPYEVIKHREIGYRDIMGVKIPDTS........................AED------TKVLAKEIVKNG-
PPNK_HELPY/7-261...--.......................................................S------LDGAKDARLIEK-
PPNK_PORGI/3-259FLK--QDLDFHPAICG.............................................------....VIDTLPEH-
YDU2_SCHPO/164-495SNT--QLSEMESEEKSFNKDVYPNDEYTPFTPKNQFVIYLEDTLASLDVVESLSPKKNVRF------WTSELCTQCPNL-
PPNK_MYCGE/2-241...--........................................................------......QAVENG-
Q9HRC1_HALSA/3-357GVA--AAAGFTPTVVGHPTTPASTAA..................................D------TRAAVEAFIDHG-
PPNK_PYRHO/2-261HFP--H......................................................F------KEGDVIPLDEFD-
Q9HJA2_THEAC/8-352REV--SAFTSRYSVIYQAHWPSTRD...................................D------TLGFLRNV..GD-
PPNK1_SYNY3/3-276LLG--YSQPDRPICHT............................................R------IEHLTPPHFDES-
PPNK_SHIFL/7-272ELQ--LK.....................................................N------VKTGTLAEIGQL-
Q971Y1_SULTO/4-354IYF--NN.DFKFTVIETLNKEKTTRE..................................D------TIYVTNRFLELK-
PPNK_BORBU/4-265...--.......................................................D------VGRPLFSFPKEN-
PPNK_MYCPN/2-241...--........................................................------......EAVEKG-
Q97ZM3_SULSO/4-354IHF--TKSKLKYETIPIGEKKKTTRY..................................D------TIDSVREFVKRG-

PF00365

K6PL_HUMAN/16-326TII----------------------------------------------------------------GSARCKAFTTREG
K6PF_HUMAN/16-326TVI----------------------------------------------------------------GSARCKDFREREG
K6PF1_THET8/2-280TIL----------------------------------------------------------------LTARSQEFLTEEG
K6PF2_KLULA/176-488TNI----------------------------------------------------------------GTARCKEFREREG
K6PF1_KLULA/184-494TLI----------------------------------------------------------------GTARSKEFRERWG
K6PF1_SHIFL/3-278TFL----------------------------------------------------------------GSARFPEFRDENI
K6PF_LACLA/2-278TFL----------------------------------------------------------------YSARYPEFAQVEG
K6PP_HUMAN/25-335TII----------------------------------------------------------------GSARCQAFRTREG
K6PF_LACDE/2-277TFL----------------------------------------------------------------YSARYPEFAEEEG
K6PF_SPICI/3-279TVI----------------------------------------------------------------GSARLPEFKDPEV
K6PF_GEOSE/2-277TIL----------------------------------------------------------------YTARCPEFKTEEG
K6PF_HAEIN/3-279TFL----------------------------------------------------------------GSARFPEFKDPNI

PF00781

DGK3_CAEEL/427-552..............NILVC.GGDGTIGWVLESM...........D...K......M...TFPH..............GRP
CERK1_MOUSE/132-277.............DGIVCV.GGDGMFSEVLHGV...........I...G......R...TQQSAGIDPNHPRAVLVPSTL
Q7XCS9_ORYSJ/234-367............PDGIVCV.GGDGIVNEVLNGL...........L...C......R...DDQNV............AVSV
DGKG_HUMAN/434-558..............RVLAC.GGDGTVGWILDCI...........D...K......A...NFAK...............HP
DGKQ_HUMAN/588-715..............RVLVC.GGDGTVGWVLGAL...........E...E......T...RYRLAC...........PE.P
BMRU_BACSU/5-132............VDTVFIL.GGDGTIHQCINAI...........S...A......L...ER.................KP
DGKA_DICDI/334-467E........QTNRFRILVC.GGDGTVGWLFKQM...........T...K......H...LVPS...............TI
DGK1_DROME/552-676..............RVICC.GGDGTVGWVLEAM...........D...S......I...ELAS...............QP
SPHK1_HUMAN/16-153.............DALVVM.SGDGLMHEVVNGL...........M...E......R...PDWET............AIQK
LCBK1_ARATH/249-382............SDGIICV.GGDGIINEVLNGL...........L...T......R...SNPKE............GVSI
Q7QIP4_ANOGA/172-308.............RGIVVV.GGDGIFFEVLNGL...........F...E......R...EDWQTA...........IDEL
YEGS_PSEPK/6-128..............HIVAG.GGDGTLRDVAEAM...........G...L......A...ATQA.................
DGK2_DROME/812-938..............RVLAC.GGDGTVGWVLSVL...........D...Q......I...QPPLQ.............PAP
O05848_MYCTU/2-130............VDLVVVH.GGDGTVSAVVNGM...........L...G......R...PGTTPV...........RPVP
DGKZ_RAT/296-420..............RILAC.GGDGTVGWILSTL...........D...Q......L...RLKP...............PP
LCB4_SCHPO/107-265.............DGILSV.GGDGLFHEVINGL...........G...E......R...DDYLE............AFKL
DAGK_BACSU/3-131.............DLIIAA.GGDGTINEVVNGL...........A...P......L...D.................NRP
YTLR_BACSU/3-130E.........YKLKRLIVI.GGDGTMHEVVNGL...........K...D......V...DDIE.................
O44334_DROME/205-332...........PC.RILVA.GGDGTIGWVLNTI...........Y...T......L...NIKP...............QP
DAGK_MYCTU/13-145............TDAVMVT.GGDGVVSNALQVL...........A...G......T...DI...................
O65419_ARATH/379-515...........YD.GIVCV.SGDGILVEVVNGL...........L...E......R...ADWRN............ALKL
O65419_ARATH/909-1042...........YD.GIVCV.SGDGILVEVVNGL...........L...E......R...EDWKT............AIKL
O82359_ARATH/53-194............ADAVIAV.GGDGTLHEVVNGFFWEGKPVGYLSG...E......A...SRST.................
DGKA_MOUSE/372-495..............RILVC.GGDGTVGWVLETI...........D...K......A...NFAT...............VP
O88885_MOUSE/138-275.............DALAVM.SGDGLMHEVVNGL...........M...E......R...PDWET............AIQK
DGKE_HUMAN/219-350...........SA.RVLVC.GGDGTVGWVLDAV...........D...D......M...KIKGQE...........KYIP
P72262_RHOER/199-320.............RALGVC.GGDGTVVAVASAA...........A...R......H...SL...................
P72269_RHOER/199-326..............ALGVC.GGDGTVVTVATAA...........T...K......H...EL...................
LCB5_YEAST/270-410...........YD.TIACA.SGDGIPHEVINGL...........Y...Q......R...PDHVKA...........FNNI
DGK5_CAEEL/418-545............L.RILVC.GGDGTVGWVLSTL...........D...N......L...NWPA...............YP
Y510_MYCBO/72-200...........LP.GVDGS.GGASGTAPLLSAN...........P...V......V...ELMA..............PEP
LCB4_YEAST/228-368...........YD.TIACA.SGDGIPYEVINGL...........Y...R......R...PDRVDA...........FNKL
Q17860_CAEEL/548-676..............KILAC.GGDGTIGWVLQCL...........D...I......A...KQDAA............CFSP
Q18425_CAEEL/87-224.............NGVLIL.SGDGLVFEALNGI...........L...C......R...EDAFRI...........FPTL
DGK1_ARATH/361-490..............RVLVC.GGDGTAGWVLDAI...........E...K......Q...NFIS...............PP
Y036_SYNY3/126-267EQS.....DGEGDSFIIAS.GGDGTVSGVAAAL...........V...N......T...GI...................
Q7MUX7_PORGI/2-127.............DCVIAV.GGDGTVNEIAQSL...........R...Y......T...DVVL.................
Q7NFK6_GLOVI/25-155...........AQ.LVIAS.GGDGTLSAAAEAL...........V...G......T...GI...................
Q7NHQ5_GLOVI/4-128...........AE.IVIAS.GGDGTLSAVAGAV...........A...G......S...PA...................
Q7S9Y1_NEUCR/163-325...........YD.IAIPC.SGDGLPHEVFNGL...........S...K......R...PDARKA...........LAKL
Q7WU58_THESQ/26-155..............RIAAF.GGDGTVNEVVNGI...........F...L......N...GYDL..............REV
Q7XN57_ORYSJ/228-361............PDGIVCV.GGDGIVNEVFNGL...........L...S......R...SDRAE............AVSI
Q7XQT2_ORYSJ/45-188SNGDPIAFQIQSNLRLIVA.GGDGTASWLLGVV...........S...D......L...KLSH...............PP
Q7Z299_CAEEL/18-143............DVRILIA.GGDGTICSALDQI...........D...T......L...SR.................RI
AGK_DANRE/65-196.............DMLIIA.GGDGTLQEVITGL...........L...R......R...ADEEI............FSKT
Q816L3_BACCR/8-134............VDLIIVF.GGDGTVFECTNGL...........A...P......L...ET.................RP
Q81IN1_BACCR/4-126.............DVVIAA.GGDGTLNEVVNGL...........V...G......H...EFRP...............K.
Q825G8_STRAW/196-328............GGALGVC.GGDGSVDAAARAA...........A...R......H...GL...................
Q828H5_STRAW/4-131..............ALVAV.GGDGMAHLALQAV...........G...G......T...RT...................
Q82DG7_STRAW/133-259............ADLLGVA.GGDGTQALVAAVA...........A...E......H...DI...................
Q82IW7_STRAW/2-133.............ELVVAL.GGDGTVNEVVNGL...........L...H......R...GPDPE.............HLP
Q82KT9_STRAW/12-140............PDLVVVI.GGDGTVREAVQGL...........A...S......A...PGRA.................
Q82LY1_STRAW/212-325.............QVLGVC.GDDGTVNAAAEVA...........L...R......H...GL...................
Q82NY8_STRAW/196-327..........EAGGALGAC.GGDGTINAATEVA...........A...R......L...GV...................
Q82W90_NITEU/7-134..............WLIVV.GGDGTLQGVMSCL...........F...E......C...LPPD..............RWP
Q830V8_ENTFA/4-144PWSE..DLDVSTFPILVVL.GGDGTLHNVINSL...........L...P......Y...DS.................TI
Q830X4_ENTFA/3-148.............DSVFVM.GGDGTVNEGISGL...........A...E......Q...AYRP...............K.
Q837V1_ENTFA/3-127..............LLVAA.GGDGTINEVVNGI...........A...P......L...KRRP...............K.
Q839R8_ENTFA/4-131..............GVLVVIGGDGTIHHAVQNF...........K...D......T...IRDY...............Q.
Q840Q1_STRGR/46-174.............DLVVAL.GGDGTVNEVVNGL...........L...H......R...GPDV..............DRL
Q84S01_ORYSJ/99-233............PDGIICV.GGDGIVNEVLNGL...........L...G......R...DDLEE............AIQL
YEGS_VIBPA/3-130..............RIVVA.GGDGTVNEAASAL...........I...H......I...DHES...............RP
Q87TI4_VIBPA/240-363..............QVIVS.GGDGTVTEVASQL...........V...G......T...DI...................
YEGS_PSESM/6-125..............HIVAG.GGDGTLRDIAEAL...........A...L......A...ATKA.................
Q898U2_CLOTE/3-130............YDYILVA.GGDGTVDNVVNYM...........K...N......L...NIDL.................
Q89ZQ4_BACTN/7-138..............TIVIV.GGDGALNDAINGI...........M...L......S...DAEDK.............ENI
Q8A9E4_BACTN/3-128.............DVVVAI.GGDGTINEIARSL...........V...H......T...DT...................
Q8CJN4_STRCO/135-258............ADLLGAA.GGDGTQALVADVA...........A...R......H...HV...................
Y507_STAES/7-139Y........SSDVDVLFIL.GGDGTLNELVNGV...........M...Q......Y...QL.................NL
Q8DT50_STRMU/7-131...........FD.LVIAA.GGDGTINEVVSGI...........A...P......L...KRRP...............K.
Q8DZ02_STRA5/3-133.............DLVIPL.GGDGTINKICGGV...........Y...A......G...GA.................YP
Q8E5W0_STRA3/6-135.............DLIVAA.GGDGTINEVVNGI...........A...P......L...KRRP...............K.
Q8E7Z2_STRA3/2-129.............DHLMII.GGDGTLSKVMTYL...........P...Q......H...I....................
Q8ES48_OCEIH/3-126............VDLIIGG.GGDGTIFELVNAL...........A...P......L...DH.................RP
Q8ES76_OCEIH/3-131.............DLVIAA.GGDGTINEVINGL...........A...E......Q...EH.................RP
YEGS_ECOL6/6-132..............TVIAG.GGDGTINEVSTAL...........I...Q......C...EGDD...............IP
Q8FMN3_COREF/5-141...........AD.IIVPA.GGDGTVNEVINGLLGN.....AGED...I......T...DWRE...............VP
Q8G3W8_BIFLO/116-238............ADVVIAV.GGDGTVRTVASAV...........S...G......T...GH...................
Q8H350_ORYSJ/132-250...........YD.GIVCV.SGDGVLVEVVNGL...........L...Q......R...EDWNT............AIKI
Q8K7G9_STRP3/3-133...........ID.LVIPL.GGDGTLNKIISGI...........Y...E......G...GA..H.............CL.
Q8KC59_CHLTE/8-129............GSTLIAC.GGDGTLNEVVNAV...........A...G......Q...PV.................K.
Q8L7L1_ARATH/120-252...........YD.GIVCV.SGDGILVEVVNGL...........L...E......R...EDWKT............AIKL
Q8LE70_ARATH/40-181DDDS..ARQIGEKLKIIVA.GGDGTAGWLLGVV...........C...D......L...KLSH...............PP
Q8MUB2_APLCA/403-531..............KILVC.GGDGTVGWVLSCL...........D...N......V...GQDAE............CQSP
DGKD_HUMAN/321-446..............RILVC.GGDGSVGWVLSEI...........D...S......L...NLHKQ.............CQ.
Q8NMJ5_CORGL/9-145.............DVIIPA.GGDGTVNEVINGL...........L...GSAEGDFR...NLED...............LP
Y688_STAAW/7-138Y........AKDVDILFIL.GGDGTVNELINGV...........M...T......H...DL.................QL
YEGS_XANCP/5-130............VQTVVAA.GGDGTLSEVAAAL...........A...H......H...QDDAA.............TLP
Q8R6L5_THETN/1-126.............KVVVAV.GGDGTVLEVVNGI...........K...G......T...PA...................
Q9VZW0_DROME/216-357...........AWCCVVAV.GGDGLFHEIVNGL...........L...Q......R...QDWAHV...........LPHL
CERK1_HUMAN/132-278.............DGIVCV.GGDGMFSEVLHGL...........I...G......R...TQRSAGVDQN...HPRAVLVP
Q8VZG1_ARATH/91-237AK......ECRARLRIMVA.GGDGTVGWVLGCL...........G...E......L...NKDGK............SQIP
Q8XKR6_CLOPE/3-130...............ILIA.GGDGTIDTVVNAM...........K...K......R...GI.................EI
Q8Y497_LISMO/4-132...........FE.VVIAA.GGDGTVNEVVNGL...........M...Q......V...DTPP...............K.
Q8Y6D4_LISMO/4-133.............DLVVAA.GGDGTINEVINGI...........A...E......K...EYRP...............K.
Q8Y8W8_LISMO/3-130.............EAVIAM.GGDGTLNETINGL...........A...I......H...EK.................RP
Q8YT45_NOSS1/28-150............VDLVIVG.GGDGTLNAVVDAL...........V...E......T...QL...................
Q8YVU8_NOSS1/4-134..............TIIAS.GGDGTLSAAAVAV...........A...G......T...DI...................
Q92R72_RHIME/2-130..............AIVAG.GGDGTISAAAGVA...........W...K......T...GM...................
Q95S15_DROME/5-150.............DAVCCV.GGDGTVAEVINGL...........IFRQM......R...ELGLDEQRP....PYIPRPAL
Q97L83_CLOAB/3-130............YKYVLIA.GGDGTVDNVVNVM...........K...K......C...NL.................DI
Y1045_STRPN/3-130.............DAVVVF.GGDGTVNEVISGI...........D...E......R...DY.................IP
Q98FN7_RHILO/63-205............VDVVLAG.GGDGTISAAAARL...........M...G......K...KK...................
Q98I19_RHILO/35-169..............LVIAA.GGDGTASEVADGL...........L...Q......AFEESGRT..............TE.
Q98NZ1_RHILO/168-300S.........GHGSILVVG.GGDGTLGSAASAL...........A...G......T...DVVL.................
DAGK_STAAM/4-132............YDVLIAA.GGDGTLNEVVNGI...........A...E......K...P.................NRP
Q9CEN8_LACLA/2-173............DDHLVII.GGDGTISLVINEL...........P...E......E...E....................
Q9CEU7_LACLA/3-134...........QTDLVVAL.AGDGTINKICGGV...........F...E......G...GA.................KP
Q9CIE3_LACLA/3-135............FDLIIAA.GGDGTINEVVAGI...........S...P......F...EK.................RP
Q9F3M0_STRCO/2-143............IDLVVAL.GGDGTVNEVVNGL...........L...H......A...GPDPD.............HLP
Q9FFN7_ARATH/342-471..............RVLVC.GGDGTVAWVLDAI...........E...K......R...NFES...............PP
Q9FHH4_ARATH/90-236SRGDECAKEIREKMRIVVA.GGDGTVGWVLGCL...........G...E......L...NLQNR............LPVP
Q9FVC9_SOLLC/40-183GNGDHFAAEIEERMKIIVA.GGDGTAGWLLGVV...........S...D......L...KL.S..............QPP
YEGS_PSEAE/6-128..............TLVAG.GGDGTLREVAEAL...........A...R......G...RGEA.................
SPHK2_MOUSE/147-284...........WE.GIVTV.SGDGLLYEVLNGL...........L...D......R...PDWED............AVRM
Q9KC00_BACHD/4-128..............LIIVM.GGDGTVHECINGL...........A...V......S...PS.................PP
Q9KF21_BACHD/3-130..............LVIAA.GGDGTIYEVVNGL...........A...G......L...EK.................RP
SPHK2_HUMAN/182-319.............DGIVTV.SGDGLLHEVLNGL...........L...D......R...PDWEE............AVKM
Q9RJ98_STRCO/3-124............GRVVLAV.GGDGMAGGIGGAL...........S...G......T...G.TV.................
Q9RS93_DEIRA/20-138............QGTVFVA.GGDGTVRSAALLL...........A...G......R...RG..................L
Q9RU35_DEIRA/21-149..............PVLAA.GGDGTVGALLPAL...........V...G......T...GR...................
Q9RUM1_DEIRA/11-127.............DVLVGA.GGDGTVSSLAYAA...........R...G......Q...DVPLL.............AY.
Q9VL10_DROME/56-181...............IVVA.GGDGTSSEVVTGL...........M...R......R...RGNL...............C.
Q9VYY8_DROME/190-333..........TRYSGIVVA.SGDGLFYEVLNGL...........M..ER......M...DWRRA............CREL
Q9ZC02_STRCO/213-325.............RALGVC.GGDGTVNAAAEIA...........L...R......H...GL...................

PF01513

ACOX_CUPNH/14-336------------VAAIIVL-GGDGTHRAVVRECG.....AVPIAGLST.GTNNAYPEM..REPTIIGLATGLYATGRIPP
Q46144_9CLOT/3-316------------VDCIVIL-GGDGTSRAVAKIIK.....NIPIIAVST.GTNNVYPEM..IEGTVAGMAAAAVASKKFDI
Q97BD3_THEVO/2-346------------ADLLVFV-GGDGTARDILNSRN.....DLPVIGVPA.GVKMYSSVFAISPERAADAVNQVAK.GNYRI
PPNK_AQUAE/3-259------------YELFLVI-GGDGTFLSAARIASR...FGVPLVGVNE.GRFGFLTEI..KKEEIKKVLPLVLE.GRAKL
PPNK_HAEIN/10-277------------AQLAIVI-GGDGNMLGRARVLAK...YDIPLIGINR.GNLGFLTDI..DPKNAYSQLEACLERGEFFV
Q9I3E5_PSEAE/5-369------------VALILFA-GGDGTARDVAGVVRE....QQPVLGIPA.GVKIHSGVYAISPRAAGELARRLVEGGLVRL
Q9HWN2_PSEAE/7-324------------VALIAVL-GGDGTHKAVAAEVG.....DVPLLALST.GTNNAFPEL..REATGAGLAGGLCASNRVPP
PPNK_METJA/303-560------------ISHIIAI-GGDGTILRASRLVNG...ETIPIIAVNM.GKVGFLAEF..CKDEVFEIIDKVIY.GEYEI
YEF1_YEAST/108-407------------FDLMITL-GGDGTVLFASSIFTK...DVPPIVPFAL.GSLGFLTNF..EFQNFKETLKHILT.DEVRI
PPNK_METTH/3-261------------ADMILTI-GGDGTILRTRSLIED...KEIPILGINM.GTVGFLTEV..DPENVFSALEAVLR.GEYAV
PPNK_ARCFU/2-235------------FDFIVSV-GGDGTILRILQKLKR....CPPIFGINT.GRVGLLTHA..SPENFEVELKKAVE..KFEV
Q97Y21_SULSO/3-315------------VDVIVSA-GGDGTLRAVYKGAGD....KVPILGLSL.GTNNVLGAL..YEPTVLGMMLGFLLKENKAI
UTR1_YEAST/129-428------------FDLVVTL-GGDGTVLFVSSIFQR...HVPPVMSFSL.GSLGFLTNF..KFEHFREDLPRIMN.HKIKT
PPNK1_BACSU/2-248------------PEIVISV-GGDGTLLYAFHRYSDR.LDKTAFVGVHT.GHLGFYADW..VPHEIEKLVLAIAK.TPYHT
PPNK_MYCTU/6-284------------CELVLVL-GGDGTFLRAAELARN...ASIPVLGVNL.GRIGFLAEA..EAEAIDAVLEHVVA.QDYRV
Q52013_PSEPU/7-324------------VAMIAVL-GGDGTHKAVAAEAG.....DVPLLTLST.GTNNAFPEL..REATSAGLAGGLFASGLVPA
PPNK2_SYNY3/5-277------------IDLALVL-GGDGTTLAAARHLSP...EGIPILSVNVGGHLGFLTEPFDVFQDTQKVWDRLNQ.DRYAV
Q9V1D1_PYRAB/4-378------------VSLVVFA-GGDGTARDIVEVIDE....KVPVLGIPT.GVKMFSGIFATSPEDAARIVVEFLK.GNAKL
PPNK2_BACSU/7-253------------ANIIASI-GGDGTFLQAVRKTNF..RDDCLYVGITKKGKAHLYCDF..HSDEREKMVDAMTF.EQIEV
O59324_PYRHO/2-376------------AELLLFA-GGDGTARDVTEAVDK....DIPILGIPT.GVKMFSGVFATSPEDAARILVEFLK.GNAKL
PPNK_HELPY/7-261------------ADAFLCL-GGDGTILGALRMTHS...YNKPCFGVRI.GNLGFLSAV..ELNGLKDFLQDFKQ.DRIKL
PPNK_PORGI/3-259------------IDYVICM-GGDGTFLRTAHQIGV...SQIPVLGVNT.GRLGFLTDV..DCHEASELITRLLD.GDFTI
YDU2_SCHPO/164-495------------FDCVITV-GDDSAALRASWLFQD...VVPPVLSFST.AKAGFLSIL..PIAEYTKTLDLIFH.RGFTV
PPNK_MYCGE/2-241------------YEYVFVL-GGDGFFVSTLANYNC...DSCKVVGINT.GHIGFYTSF..NGDDLDENFISKLT..SFEF
Q9HRC1_HALSA/3-357------------VDVILFV-GGDGTATDVATAVTAH.DASVPVLGVPA.GVKVYSAVFAVQPAAAGRVAATFED.....T
PPNK_PYRHO/2-261------------VDFIVAI-GGDGTILRIEHMTKK....DIPILSINM.GTLGFLTEV..EPSDTFFALNRLIE.GEYYI
Q9HJA2_THEAC/8-352------------ADILVFA-GGDGTARDILSAGV.....RIPVIGVPA.GVKMYSSVFAISPSHAAQSLNAISK.PDIRT
PPNK1_SYNY3/3-276------------MPFAIVL-GGDGTVLSAFRQLAP...LGIPLLTINT.GHMGFLTEI..YLNQLPTAIEQLIN.GDYQI
PPNK_SHIFL/7-272------------ADLAVVV-GGDGNMLGAARTLAR...YDIKVIGINR.GNLGFLTDL..DPDNAQQQLADVLE.GHYIS
Q971Y1_SULTO/4-354------------CDIIVFA-GGDGTARDIYSVVDQ....KIPILGIPS.GVKMHSGVFANTPEAAAIILTKYVN.GEATL
PPNK_BORBU/4-265------------FLFLITL-GGDGTVLLAVNLLLENENIDIPIISINM.GNVGFLADI..KIEDFKKVIDRFFN.NSLVI
PPNK_MYCPN/2-241------------FDYLFVL-GGDGFFVSTVANYNC...HNCRVVGINT.GHLGFYTSF..NEKDLDDNFLQKLQ..QCHF
Q97ZM3_SULSO/4-354------------VDIIVFV-GGDGTARDVAEGLQG...AEIPILGVPA.GVKMHSGVFANTPEAAAILLTKFLH.DEAKT

PF00365

K6PL_HUMAN/16-326RRAAAYNLVQHGITNLCVI-GGDGSLTGANIFRSEWGSLLEELVAEGKISETTARTYSHLNIAGLVGSIDNDFCGTDMTI
K6PF_HUMAN/16-326RLRAAYNLVKRGITNLCVI-GGDGSLTGADTFRSEWSDLLSDLQKAGKITDEEATKSSYLNIVGLVGSIDNDFCGTDMTI
K6PF1_THET8/2-280RAKAYAKLQAAGIEGLVAI-GGDGTFRGALCLVEEHG......................MPVVGVPGTIDNDLYGTDYTI
K6PF2_KLULA/176-488RLLGALHLIEAGVDALIVC-GGDGSLTGADLFRSEWPSLIRELLDQGRINKVQFDRYQHLNICGTVGSIDNDMSTTDATI
K6PF1_KLULA/184-494RKQACSNLIDQGIDALVVI-GGDGSLTGADLFRSEWPSLVEELVKDGKFTEDEVALYQNLTIVGMVGSIDNDMSGTDSTI
K6PF1_SHIFL/3-278RAVAIENLKKRGIDALVVI-GGDGSYMGAMRLT.EMG......................FPCIGLPGTIDNDIKGTDYTI
K6PF_LACLA/2-278QLAGIEQLKKFGIEGVVVI-GGDGSYHGAMRLT.EHG......................FPAVGLPGTIDNDIVGTDFTI
K6PP_HUMAN/25-335RLKAACNLLQRGITNLCVI-GGDGSLTGANLFRKEWSGLLEELARNGQIDKEAVQKYAYLNVVGMVGSIDNDFCGTDMTI
K6PF_LACDE/2-277QLAGIEQLKKHGIDAVVVI-GGDGSYHGALQLT.RHG......................FNSIGLPGTIDNDIPYTDATI
K6PF_SPICI/3-279QKKAVDILKKQEIAALVVI-GGDGSYQGAQRLTELG.......................INCIALPGTIDNDITSSDYTI
K6PF_GEOSE/2-277QKKGIEQLKKHGIEGLVVI-GGDGSYQGAKKLT.EHG......................FPCVGVPGTIDNDIPGTDFTI
K6PF_HAEIN/3-279RAKCAEILRSHGIDALVVI-GGDGSYMGAKLLTEEHS......................FPCVGLPGTIDNDVAGTDYTI

PF00781

DGK3_CAEEL/427-552P...----------------------------------------------------------------------------
CERK1_MOUSE/132-277R...----------------------------------------------------------------------------
Q7XCS9_ORYSJ/234-367P...----------------------------------------------------------------------------
DGKG_HUMAN/434-558P...----------------------------------------------------------------------------
DGKQ_HUMAN/588-715S...----------------------------------------------------------------------------
BMRU_BACSU/5-132A...----------------------------------------------------------------------------
DGKA_DICDI/334-467P...----------------------------------------------------------------------------
DGK1_DROME/552-676A...----------------------------------------------------------------------------
SPHK1_HUMAN/16-153P...----------------------------------------------------------------------------
LCBK1_ARATH/249-382P...----------------------------------------------------------------------------
Q7QIP4_ANOGA/172-308P...----------------------------------------------------------------------------
YEGS_PSEPK/6-128S...----------------------------------------------------------------------------
DGK2_DROME/812-938A...----------------------------------------------------------------------------
O05848_MYCTU/2-130A...----------------------------------------------------------------------------
DGKZ_RAT/296-420P...----------------------------------------------------------------------------
LCB4_SCHPO/107-265P...----------------------------------------------------------------------------
DAGK_BACSU/3-131T...----------------------------------------------------------------------------
YTLR_BACSU/3-130....----------------------------------------------------------------------------
O44334_DROME/205-332S...----------------------------------------------------------------------------
DAGK_MYCTU/13-145P...----------------------------------------------------------------------------
O65419_ARATH/379-515P...----------------------------------------------------------------------------
O65419_ARATH/909-1042P...----------------------------------------------------------------------------
O82359_ARATH/53-194A...----------------------------------------------------------------------------
DGKA_MOUSE/372-495P...----------------------------------------------------------------------------
O88885_MOUSE/138-275P...----------------------------------------------------------------------------
DGKE_HUMAN/219-350Q...----------------------------------------------------------------------------
P72262_RHOER/199-320P...----------------------------------------------------------------------------
P72269_RHOER/199-326P...----------------------------------------------------------------------------
LCB5_YEAST/270-410A...----------------------------------------------------------------------------
DGK5_CAEEL/418-545P...----------------------------------------------------------------------------
Y510_MYCBO/72-200P...----------------------------------------------------------------------------
LCB4_YEAST/228-368A...----------------------------------------------------------------------------
Q17860_CAEEL/548-676P...----------------------------------------------------------------------------
Q18425_CAEEL/87-224P...----------------------------------------------------------------------------
DGK1_ARATH/361-490A...----------------------------------------------------------------------------
Y036_SYNY3/126-267P...----------------------------------------------------------------------------
Q7MUX7_PORGI/2-127....----------------------------------------------------------------------------
Q7NFK6_GLOVI/25-155P...----------------------------------------------------------------------------
Q7NHQ5_GLOVI/4-128A...----------------------------------------------------------------------------
Q7S9Y1_NEUCR/163-325A...----------------------------------------------------------------------------
Q7WU58_THESQ/26-155V...----------------------------------------------------------------------------
Q7XN57_ORYSJ/228-361P...----------------------------------------------------------------------------
Q7XQT2_ORYSJ/45-188P...----------------------------------------------------------------------------
Q7Z299_CAEEL/18-143P...----------------------------------------------------------------------------
AGK_DANRE/65-196P...----------------------------------------------------------------------------
Q816L3_BACCR/8-134T...----------------------------------------------------------------------------
Q81IN1_BACCR/4-126....----------------------------------------------------------------------------
Q825G8_STRAW/196-328A...----------------------------------------------------------------------------
Q828H5_STRAW/4-131P...----------------------------------------------------------------------------
Q82DG7_STRAW/133-259P...----------------------------------------------------------------------------
Q82IW7_STRAW/2-133R...----------------------------------------------------------------------------
Q82KT9_STRAW/12-140A...----------------------------------------------------------------------------
Q82LY1_STRAW/212-325P...----------------------------------------------------------------------------
Q82NY8_STRAW/196-327P...----------------------------------------------------------------------------
Q82W90_NITEU/7-134E...----------------------------------------------------------------------------
Q830V8_ENTFA/4-144P...----------------------------------------------------------------------------
Q830X4_ENTFA/3-148....----------------------------------------------------------------------------
Q837V1_ENTFA/3-127....----------------------------------------------------------------------------
Q839R8_ENTFA/4-131....----------------------------------------------------------------------------
Q840Q1_STRGR/46-174P..K----------------------------------------------------------------------------
Q84S01_ORYSJ/99-233P...----------------------------------------------------------------------------
YEGS_VIBPA/3-130E...----------------------------------------------------------------------------
Q87TI4_VIBPA/240-363Q...----------------------------------------------------------------------------
YEGS_PSESM/6-125S...----------------------------------------------------------------------------
Q898U2_CLOTE/3-130P...----------------------------------------------------------------------------
Q89ZQ4_BACTN/7-138A...----------------------------------------------------------------------------
Q8A9E4_BACTN/3-128A...----------------------------------------------------------------------------
Q8CJN4_STRCO/135-258P...----------------------------------------------------------------------------
Y507_STAES/7-139P...----------------------------------------------------------------------------
Q8DT50_STRMU/7-131....----------------------------------------------------------------------------
Q8DZ02_STRA5/3-133T...----------------------------------------------------------------------------
Q8E5W0_STRA3/6-135....----------------------------------------------------------------------------
Q8E7Z2_STRA3/2-129P...----------------------------------------------------------------------------
Q8ES48_OCEIH/3-126A...----------------------------------------------------------------------------
Q8ES76_OCEIH/3-131Q...----------------------------------------------------------------------------
YEGS_ECOL6/6-132A...----------------------------------------------------------------------------
Q8FMN3_COREF/5-141A...----------------------------------------------------------------------------
Q8G3W8_BIFLO/116-238A...----------------------------------------------------------------------------
Q8H350_ORYSJ/132-250P...----------------------------------------------------------------------------
Q8K7G9_STRP3/3-133....----------------------------------------------------------------------------
Q8KC59_CHLTE/8-129....----------------------------------------------------------------------------
Q8L7L1_ARATH/120-252P...----------------------------------------------------------------------------
Q8LE70_ARATH/40-181P...----------------------------------------------------------------------------
Q8MUB2_APLCA/403-531P...----------------------------------------------------------------------------
DGKD_HUMAN/321-446....----------------------------------------------------------------------------
Q8NMJ5_CORGL/9-145A...----------------------------------------------------------------------------
Y688_STAAW/7-138P...----------------------------------------------------------------------------
YEGS_XANCP/5-130S...----------------------------------------------------------------------------
Q8R6L5_THETN/1-126A...----------------------------------------------------------------------------
Q9VZW0_DROME/216-357A...----------------------------------------------------------------------------
CERK1_HUMAN/132-278SSLR----------------------------------------------------------------------------
Q8VZG1_ARATH/91-237P...----------------------------------------------------------------------------
Q8XKR6_CLOPE/3-130P...----------------------------------------------------------------------------
Q8Y497_LISMO/4-132....----------------------------------------------------------------------------
Q8Y6D4_LISMO/4-133....----------------------------------------------------------------------------
Q8Y8W8_LISMO/3-130D...----------------------------------------------------------------------------
Q8YT45_NOSS1/28-150P...----------------------------------------------------------------------------
Q8YVU8_NOSS1/4-134P...----------------------------------------------------------------------------
Q92R72_RHIME/2-130P...----------------------------------------------------------------------------
Q95S15_DROME/5-150P...----------------------------------------------------------------------------
Q97L83_CLOAB/3-130P...----------------------------------------------------------------------------
Y1045_STRPN/3-130K...----------------------------------------------------------------------------
Q98FN7_RHILO/63-205A...----------------------------------------------------------------------------
Q98I19_RHILO/35-169....----------------------------------------------------------------------------
Q98NZ1_RHILO/168-300....----------------------------------------------------------------------------
DAGK_STAAM/4-132K...----------------------------------------------------------------------------
Q9CEN8_LACLA/2-173A...----------------------------------------------------------------------------
Q9CEU7_LACLA/3-134I...----------------------------------------------------------------------------
Q9CIE3_LACLA/3-135Q...----------------------------------------------------------------------------
Q9F3M0_STRCO/2-143G...----------------------------------------------------------------------------
Q9FFN7_ARATH/342-471P...----------------------------------------------------------------------------
Q9FHH4_ARATH/90-236P...----------------------------------------------------------------------------
Q9FVC9_SOLLC/40-183P...----------------------------------------------------------------------------
YEGS_PSEAE/6-128S...----------------------------------------------------------------------------
SPHK2_MOUSE/147-284P...----------------------------------------------------------------------------
Q9KC00_BACHD/4-128P...----------------------------------------------------------------------------
Q9KF21_BACHD/3-130T...----------------------------------------------------------------------------
SPHK2_HUMAN/182-319P...----------------------------------------------------------------------------
Q9RJ98_STRCO/3-124....----------------------------------------------------------------------------
Q9RS93_DEIRA/20-138T...----------------------------------------------------------------------------
Q9RU35_DEIRA/21-149P...----------------------------------------------------------------------------
Q9RUM1_DEIRA/11-127....----------------------------------------------------------------------------
Q9VL10_DROME/56-181P...----------------------------------------------------------------------------
Q9VYY8_DROME/190-333P...----------------------------------------------------------------------------
Q9ZC02_STRCO/213-325P...----------------------------------------------------------------------------

PF01513

ACOX_CUPNH/14-336AQALASNKRLD...........................IVIRDGNG..........GFRRDIALVDAVISHEHFIGARAL
Q46144_9CLOT/3-316N.....................................EICFKDKRIEICRNEKL....IDIALIDAVISKNLYVGSKAI
Q97BD3_THEVO/2-346DKAE....VVDIDEELYRKGILSVKRYGQLKVPEAQ..YIVENSKAE...YDIAGAEDIAEYVIEH..MADETYIIGPGN
PPNK_AQUAE/3-259QERL....MID...........................VYLRSRNR...............LRYLGNYLNDAVISKSSIA
PPNK_HAEIN/10-277EERF....LLE...........................AKIERASE...............IVSTSNAVNEAVIHPAKIA
Q9I3E5_PSEAE/5-369ASGE....VRDLDEEALRAGRVAARWYGEMTVPEEG..HFMQHVKQAGMESEELVLVDLADWLAENW.EDGVRYVLGPGS
Q9HWN2_PSEAE/7-324E.....................................IGLRRNKRLLVREPRRGL...CEWALVDVAVSPQPFIGARAI
PPNK_METJA/303-560EKRS....KLS...........................CKIIKDNR...............VIKTPSALNEMVVITKNPA
YEF1_YEAST/108-407NLRM....RLQ...........................CKLYRRNKPEIDAATGRKICYIDFISEHHVLNEVTIDRGPAP
PPNK_METTH/3-261EKRT....LLS.............................VYHNDE..................LPSALNEVVLMTRRPA
PPNK_ARCFU/2-235ERFP....RVS...........................CSAMPDVL.....................ALNEIAVLSRKPA
Q97Y21_SULSO/3-315S.....................................NVVERIKTIKLFVNNEF....KNLALVDLTFMSGWYVGARAI
UTR1_YEAST/129-428NLRL....RLE...........................CTIYRRHRPEVDPNTGKKICVVEKLSTHHILNEVTIDRGPSP
PPNK1_BACSU/2-248VEYP....LLE...........................VIVTYHEN..............EREERYLALNECTIKSIEGS
PPNK_MYCTU/6-284EDRL....TLD...........................VVVRQGGR...............IVNRGWALNEVSLEKGPRL
Q52013_PSEPU/7-324S.....................................IGLRRNKRLLVRVPEQQL...AEWALVEVAVSPQRFIGARAL
PPNK2_SYNY3/5-277SQRM....MLA...........................ASLFEGDR..........RDPQMVGETYYCLNEMCIKPASID
Q9V1D1_PYRAB/4-378EERA....VMDLDEDAYRRDELKARKFYDAITPIVE..RLIQGSKEATPLDEEEEIEALAEALAEEIIENDGIYFLGAGS
PPNK2_BACSU/7-253RKYP....LIE...........................VTVDQASP...................FHCLNEVSIRSSIIK
O59324_PYRHO/2-376EERP....VMDLDENAYRRDRVKAKKFSEAITPIVE..MLVQGSKEATTIDESAELEALADAVAEEILSSDGIYFLGAGS
PPNK_HELPY/7-261EEHL....ALE...........................GRIGKTSF....................YAINEIVIAKKKAL
PPNK_PORGI/3-259ETRS....LLE...........................VTEDNGSSP..................SYALNEAAILKRETG
YDU2_SCHPO/164-495NLRM....RFQ...........................CSIMRYVG.........EHSTHICEGQYSVLNELLIDRGPNP
PPNK_MYCGE/2-241KKIN....LLE...........................VKTKNHSF....................LVLNELAVYTNTAY
Q9HRC1_HALSA/3-357TTRE....VSDIDEGAYRDGEVQTTLRGVVATPVTEGADALQPAKQAYAGTTGALAAGVADSV.....RDGVTYVLGPGG
PPNK_PYRHO/2-261DERI....KVR...........................TYIDGENR..................VPDALNEVAILTGIPG
Q9HJA2_THEAC/8-352ADAE....VMDIDEELYRRGVLSARSYGYLKVPILN..DIVMNSKAE...YDMGGVEDIAEYIIDH..MDDRYYVIGPGN
PPNK1_SYNY3/3-276ESRS....MMT...........................VRLMREEN...............LLWEALSLNEMVLHREPLT
PPNK_SHIFL/7-272EKRF....LLE...........................AQVCQQDC...............QKRISTAINEVVLHPGKVA
Q971Y1_SULTO/4-354TDAE....ILDVDEEEYRKGRYEVKLYGIAKTVTFG..NYLTPSKEE.IISNEEELEAIAEYVINNLIRDNEYYIFGSGS
PPNK_BORBU/4-265NKKF....LLH...........................VTVSQHGK...............DLISKYALNDIIIRSSVLN
PPNK_MYCPN/2-241QRIS....LLE...........................VSVNGQQH....................LVLNELAVYTNTAY
Q97ZM3_SULSO/4-354VKEE....ILDIDEEAYRKGTYFVKLYHIVLTISSN..NLLTPSKGE.MQYSEDELGEIADYIIDNM.DDNITYIMGPGS

PF00365

K6PL_HUMAN/16-326G-----------------------------------------------------------TDSALHRIMEVIDAITTTAQ
K6PF_HUMAN/16-326G-----------------------------------------------------------TDSALHRIMEIVDAITTTAQ
K6PF1_THET8/2-280G-----------------------------------------------------------FDTAVNTALEAIDRIRDTAA
K6PF2_KLULA/176-488G-----------------------------------------------------------AYSALDRICQAIDYIEATAN
K6PF1_KLULA/184-494G-----------------------------------------------------------AYSALERICEMVDYIDATAK
K6PF1_SHIFL/3-278G-----------------------------------------------------------FFTALSTVVEAIDRLRDTSS
K6PF_LACLA/2-278G-----------------------------------------------------------FDTAVSTVVDALDKIRDTSS
K6PP_HUMAN/25-335G-----------------------------------------------------------TDSALHRIIEVVDAIMTTAQ
K6PF_LACDE/2-277G-----------------------------------------------------------YDTACMTAMDAIDKIRDTAS
K6PF_SPICI/3-279G-----------------------------------------------------------FDTAINIVVEAIDRLRDTMQ
K6PF_GEOSE/2-277G-----------------------------------------------------------FDTALNTVIDAIDKIRDTAT
K6PF_HAEIN/3-279G-----------------------------------------------------------YQTALQTAVDAIDRLRDTSS

PF00781

DGK3_CAEEL/427-552-----------------------------------------------------VAVLPLGTGNDLARCLRW.GGGYEN..
CERK1_MOUSE/132-277-----------------------------------------------------IGIIPAGSTDCVCYSTVG.TNDAET..
Q7XCS9_ORYSJ/234-367-----------------------------------------------------IGIIPAGSDNSLVWTVLG.VKDPIS..
DGKG_HUMAN/434-558-----------------------------------------------------VAVLPLGTGNDLARCLRW.GGGYEG..
DGKQ_HUMAN/588-715-----------------------------------------------------VAILPLGTGNDLGRVLRW.GAGYSG..
BMRU_BACSU/5-132-----------------------------------------------------VGILPGGTCNDFSRVLGI.PQNLAK..
DGKA_DICDI/334-467-----------------------------------------------------IGIIPLGTGNDLARSLGW.GIGYDG..
DGK1_DROME/552-676-----------------------------------------------------IGVIPLGTGNDLARCLRW.GGGYEG..
SPHK1_HUMAN/16-153-----------------------------------------------------LCSLPAGSGNALAASLNH.YAGYEQ..
LCBK1_ARATH/249-382-----------------------------------------------------IGIVPAGSDNSLVWTVLG.VRDPIS..
Q7QIP4_ANOGA/172-308-----------------------------------------------------MGIIPCGSGNGLAKTVSF.LYEEPFE.
YEGS_PSEPK/6-128-----------------------------------------------------LALLPLGTANDFAKAAGI.PLEPAS..
DGK2_DROME/812-938-----------------------------------------------------VGVLPLGTGNDLARALGW.GGGYTD..
O05848_MYCTU/2-130-----------------------------------------------------VAVVPGGSANVLARALGI.SADPIA..
DGKZ_RAT/296-420-----------------------------------------------------VAILPLGTGNDLARTLNW.GGGYTD..
LCB4_SCHPO/107-265-----------------------------------------------------VCMIPGGSGNAFSYNATG.QLKPALTA
DAGK_BACSU/3-131-----------------------------------------------------LGVIPVGTTNDFARALGI.PREDIL..
YTLR_BACSU/3-130-----------------------------------------------------LSFVPAGAYNDFSR..GF.SIKKID..
O44334_DROME/205-332-----------------------------------------------------VAIMPLGTGNDLSRVLGW.GAEPPS..
DAGK_MYCTU/13-145-----------------------------------------------------LGIIPAGTGNDHAREFGL.PTKNPKA.
O65419_ARATH/379-515-----------------------------------------------------IGMVPAGTGNGMIKSLLD.TVGLRC..
O65419_ARATH/909-1042-----------------------------------------------------IGMVPAGRTRSL.DVATI.SQGTTK..
O82359_ARATH/53-194-----------------------------------------------------LGLIPLGTGSDFARTFGW.NNDPCE..
DGKA_MOUSE/372-495-----------------------------------------------------VAVLPLGTGNDLARCLRW.GRGYEG..
O88885_MOUSE/138-275-----------------------------------------------------LCSLPGGSGNALAASVNH.YAGYEQ..
DGKE_HUMAN/219-350-----------------------------------------------------VAVLPLGTGNDLSNTLGW.GTGYAG..
P72262_RHOER/199-320-----------------------------------------------------LAVFPGGTLNHFARDAGV.AEISDT..
P72269_RHOER/199-326-----------------------------------------------------LAVFPGGTLNHFARDVGA.VNVEETA.
LCB5_YEAST/270-410-----------------------------------------------------ITEIPCGSGNAMSVSCHW.TNNPSYS.
DGK5_CAEEL/418-545-----------------------------------------------------MAIMPLGTGNDLARCMGW.GGVFSD..
Y510_MYCBO/72-200-----------------------------------------------------EGVVPIGPGHQLAGLVHL.GEGCDV..
LCB4_YEAST/228-368-----------------------------------------------------VTQLPCGSGNAMSISCHW.TNNPSYA.
Q17860_CAEEL/548-676-----------------------------------------------------CGIVPLGTGNDLARVLRW.GGGYTG..
Q18425_CAEEL/87-224-----------------------------------------------------IGIVPSGSGNGLLCSVLS.KYGTKM..
DGK1_ARATH/361-490-----------------------------------------------------VAILPAGTGNDLSRVLNW.GGGLGS..
Y036_SYNY3/126-267-----------------------------------------------------LGIIPRGTANAFSVALGI.PTQIPGA.
Q7MUX7_PORGI/2-127-----------------------------------------------------.GIVPKGSGNGLARALKL.PLTVGK..
Q7NFK6_GLOVI/25-155-----------------------------------------------------FGVISRGTANAFANALGL.PLTLELA.
Q7NHQ5_GLOVI/4-128-----------------------------------------------------LGIIPRGTANSVALALQL.PQDLPS..
Q7S9Y1_NEUCR/163-325-----------------------------------------------------VCHIPCGSGNAMSCNLYG.THRPSLAA
Q7WU58_THESQ/26-155-----------------------------------------------------FGWIPFGSGKDWARTIGV.PLEIEE..
Q7XN57_ORYSJ/228-361-----------------------------------------------------VGIIPAGSDNSLVWTVLG.VKDPIS..
Q7XQT2_ORYSJ/45-188-----------------------------------------------------IATVPLGTGNNLPFSFGW.GKKNPT..
Q7Z299_CAEEL/18-143-----------------------------------------------------VAVLPLGTGNDLSRLLKW.GKKCDG..
AGK_DANRE/65-196-----------------------------------------------------IGFIPLGSSNSLSQSLHL.VSDNKV..
Q816L3_BACCR/8-134-----------------------------------------------------LAIIPGGTCNDFSRTLGV.PQNIAE..
Q81IN1_BACCR/4-126-----------------------------------------------------FGIIPVGTTNDFARAIGV.PRSIEE..
Q825G8_STRAW/196-328-----------------------------------------------------LAVFPGGTLNHFALDVGV.PDFDDTA.
Q828H5_STRAW/4-131-----------------------------------------------------LGLVAVGTGNDFARALGL.PVRDPA..
Q82DG7_STRAW/133-259-----------------------------------------------------FLVVSAGTRNHFALDLGL.DRDDPS..
Q82IW7_STRAW/2-133-----------------------------------------------------LAVVPGGSTNVFARALGL.PNDAVE..
Q82KT9_STRAW/12-140-----------------------------------------------------LTVVPGGTGNS.GYKMLW.GERPWT..
Q82LY1_STRAW/212-325-----------------------------------------------------LAVLPGGSPDHLAHDLGI.EGVRDL..
Q82NY8_STRAW/196-327-----------------------------------------------------LAVFPGGTFNHFAVDLGN.QTMEDVA.
Q82W90_NITEU/7-134-----------------------------------------------------ITIVPAGTTNMTALDLGM.NGQAEQ..
Q830V8_ENTFA/4-144-----------------------------------------------------LSYIPCGSGNDFARGVGL.SRNIDK..
Q830X4_ENTFA/3-148-----------------------------------------------------FGFFPLGTVNDLARALNL.PMDPEEAI
Q837V1_ENTFA/3-127-----------------------------------------------------MAIIPAGTTNDYARALKI.PRDNIV..
Q839R8_ENTFA/4-131-----------------------------------------------------IGIIPGGTVNNFARVLSI.PLKEED..
Q840Q1_STRGR/46-174-----------------------------------------------------LAVVPGGSTNVFARALGL.PND.AV..
Q84S01_ORYSJ/99-233-----------------------------------------------------IGIIPAGSENSLVWTVLG.IRDPVS..
YEGS_VIBPA/3-130-----------------------------------------------------LAIIPLGTANDFATANHI.PDSIAD..
Q87TI4_VIBPA/240-363-----------------------------------------------------LGIIPLGTANAL.CHVLY.GIGMKL..
YEGS_PSESM/6-125-----------------------------------------------------LTILPLGTANDFARAAGV.PLDVSK..
Q898U2_CLOTE/3-130-----------------------------------------------------IGILPVGTANDFAKFIEI.PGDIGA..
Q89ZQ4_BACTN/7-138-----------------------------------------------------LGMIPNGIGNDFAKYWGL.STEYKP..
Q8A9E4_BACTN/3-128-----------------------------------------------------LGIIPCGSGNGLARHLHI.PMEPKK..
Q8CJN4_STRCO/135-258-----------------------------------------------------FAVIPAGTRHHFALDLGL.DRDDPV..
Y507_STAES/7-139-----------------------------------------------------IGVIPGGTFNDFTKTLQL.HPNFKT..
Q8DT50_STRMU/7-131-----------------------------------------------------VAIIPTGTTNDFARALKI.PRGNPV..
Q8DZ02_STRA5/3-133-----------------------------------------------------IGLVPAGTVNNFSKALNI.PQERNL..
Q8E5W0_STRA3/6-135-----------------------------------------------------MAIIPTGTTNDFARALKI.PRGNPI..
Q8E7Z2_STRA3/2-129-----------------------------------------------------CAYYPVGSGNDFARALKI.PNLKET..
Q8ES48_OCEIH/3-126-----------------------------------------------------FAVLPGGTCNDFSRTIGM.NQNPLV..
Q8ES76_OCEIH/3-131-----------------------------------------------------LGIIPAGTTNDFARALHI.PRDIDK..
YEGS_ECOL6/6-132-----------------------------------------------------LGILPLGTANDFATSVGI.PEALDK..
Q8FMN3_COREF/5-141-----------------------------------------------------MAVLPTGSANVFARALGY.PSDTYA..
Q8G3W8_BIFLO/116-238-----------------------------------------------------LGIIPIGTGNLFARNMGV.PVDDID..
Q8H350_ORYSJ/132-250-----------------------------------------------------LGIIP..............AHKRPL..
Q8K7G9_STRP3/3-133-----------------------------------------------------IGLVPSGTVNNFAKAMHI.PLQITE..
Q8KC59_CHLTE/8-129-----------------------------------------------------VGVLPVGSANDFLKTF.....NPSA..
Q8L7L1_ARATH/120-252-----------------------------------------------------IGMVPAGSGNGMIKSLLE.PVGLPC..
Q8LE70_ARATH/40-181-----------------------------------------------------IATVPLGTGNNLPFAFGW.GKKNPG..
Q8MUB2_APLCA/403-531-----------------------------------------------------MAIVPLGTGNDLARVLRW.GPGYTG..
DGKD_HUMAN/321-446-----------------------------------------------------LGVLPLGTGNDLARVLGW.GSACDD..
Q8NMJ5_CORGL/9-145-----------------------------------------------------IAVLPTGSANVFARALGY.PTDPYA..
Y688_STAAW/7-138-----------------------------------------------------IGILPGGTFNDFTKTLNI.APNHKQ..
YEGS_XANCP/5-130-----------------------------------------------------LGLVPLGTANDFATAAMI.PLEPLG..
Q8R6L5_THETN/1-126-----------------------------------------------------LGVIPVGTGNDFARFFHI.PKKIEK..
Q9VZW0_DROME/216-357-----------------------------------------------------LGIIPCGSGNGLARSIAH.CYNEPYF.
CERK1_HUMAN/132-278-----------------------------------------------------IGIIPAGSTD...CVCYS.TVGTSD..
Q8VZG1_ARATH/91-237-----------------------------------------------------VGVIPLGTGNDLSRSFGW.GGSFPF..
Q8XKR6_CLOPE/3-130-----------------------------------------------------IGIIPVGTANDFAKHLGM.PQDAGA..
Q8Y497_LISMO/4-132-----------------------------------------------------LGVLPVGTTNDYARALNF.AKDP.L..
Q8Y6D4_LISMO/4-133-----------------------------------------------------VGIIPTGTTNDFARALHV.PRDVIK..
Q8Y8W8_LISMO/3-130-----------------------------------------------------FGFIPLGTVNDLARSVGI.PLKPEK..
Q8YT45_NOSS1/28-150-----------------------------------------------------LGILPLGTANDLARTLGI.SNSLPE..
Q8YVU8_NOSS1/4-134-----------------------------------------------------LGIISRGTANAFAVALGI.PDTIDAA.
Q92R72_RHIME/2-130-----------------------------------------------------LGIVPAGTMNLVARSLKL.PLDIWK..
Q95S15_DROME/5-150-----------------------------------------------------VGVIPAGSTDTIAYSMHG.TADVRT..
Q97L83_CLOAB/3-130-----------------------------------------------------IAILPVGTANDFAKFIGM.PADIEM..
Y1045_STRPN/3-130-----------------------------------------------------LGIIPGGTGNLITKLLEI.NQDIDG..
Q98FN7_RHILO/63-205-----------------------------------------------------LAILPAGTMNLFARGLGI.PQSLDAAL
Q98I19_RHILO/35-169-----------------------------------------------------LGLLPCGTGIDFARGLGL.PKAVDA..
Q98NZ1_RHILO/168-300-----------------------------------------------------.GVLPLGTLNHFAKDLGV.PLDLTA..
DAGK_STAAM/4-132-----------------------------------------------------LGVIPMGTVNDFGRALHI.PNDIMG..
Q9CEN8_LACLA/2-173-----------------------------------------------------FSYIPSGSGNDFARSLKL.KLDPIESF
Q9CEU7_LACLA/3-134-----------------------------------------------------LGIVPNGTVNNLSKSLHI.PQKLEE..
Q9CIE3_LACLA/3-135-----------------------------------------------------LAIVPTGTTNDFARALKI.PRGKPL..
Q9F3M0_STRCO/2-143-----------------------------------------------------LAVVPGGSTNVFARALGL.PNHAVEAT
Q9FFN7_ARATH/342-471-----------------------------------------------------VAILPLGTGNDLSRVLQW.GRGISV..
Q9FHH4_ARATH/90-236-----------------------------------------------------VSIMPLGTGNDLSRSFGW.GGSFPF..
Q9FVC9_SOLLC/40-183-----------------------------------------------------IATVPLGTGNNLPFAFGW.GKKNPG..
YEGS_PSEAE/6-128-----------------------------------------------------LAILPLGTANDFARAAGI.PLEPAA..
SPHK2_MOUSE/147-284-----------------------------------------------------IGVLPCGSGNALAGAVNH.HGGFEQ..
Q9KC00_BACHD/4-128-----------------------------------------------------LVVLPTGTCNDFARSLRI.PLSFVE..
Q9KF21_BACHD/3-130-----------------------------------------------------LGLIPAGTTNDFARALNI.PRDIEK..
SPHK2_HUMAN/182-319-----------------------------------------------------VGILPCGSGNALAGAVNQ.HGGFEP..
Q9RJ98_STRCO/3-124-----------------------------------------------------LGLVPAGRGNDFARALEL.PTGGPG..
Q9RS93_DEIRA/20-138-----------------------------------------------------LGIVPMGTANNIGRTLGI.EGEPLD..
Q9RU35_DEIRA/21-149-----------------------------------------------------LALVPLGSGNDFAGMLGLKPGQFAGA.
Q9RUM1_DEIRA/11-127-----------------------------------------------------....PAGTANLIAQNLDL.PRDPAE..
Q9VL10_DROME/56-181-----------------------------------------------------ITILPLG......RSVQS.ASKRIN..
Q9VYY8_DROME/190-333-----------------------------------------------------LGIIPCGSGNGLAKSVAH.HCNEPYE.
Q9ZC02_STRCO/213-325-----------------------------------------------------LAVLPGGTLNHFAYDLGV.EDVRDL..

PF01513

ACOX_CUPNH/14-336WKTDTLAAVYVSFADPEAIGLSSIAGLLEPVGRREEGGLAIELAAPGEGEFDLCAPIAPGLMCTVPVAGWQ-RLEHGRPH
Q46144_9CLOT/3-316WNVEDILKIIVSRAHPASIGFSAIVGCRMIVSKNDDFGAAVDLTS...NKQKITAPVAAGIITPIHMEDAE-IINLNATY
Q97BD3_THEVO/2-346TCKTIEEEMGIKSNVLGFDILRNK....KLIKEDASESEIYEACS...DKCM.LVISPVGGQNFLLGRGNK-QISDRILE
PPNK_AQUAE/3-259RIIR..TKVFINGEEVLEVFGDGV.............................ILSTPTGSTAYALSAGGP-IVYPESQN
PPNK_HAEIN/10-277HMID..FHVYINDKFAFSQRSDGL.............................IVSTPTGSTAYSLSAGGP-ILTPNLNA
Q9I3E5_PSEAE/5-369TLHGLARNLGLETTLLGVDVLENG....AVIARDVDEARLFELVD...GHPAYLLVTAIGGQGHVIGRGNQ-QISPRVLR
Q9HWN2_PSEAE/7-324SRAEDLAEVFVSFAEPHAIGLSALCGLWSPVSREEPHGAWMRLHP..DARESLLVPLAPGLLVGCGVSAAG-YLQPGVAH
PPNK_METJA/303-560KILE..FDVYVNDTLVENVRADGI.............................IVSTPTGSTAYSLSAGGP-IVEPNVDC
YEF1_YEAST/108-407CLSL..LELYGNDSLMTKVQGDGL.............................IVATPTGSTAYSLSAGGS-LISPSVNA
PPNK_METTH/3-261KMLH..IEISVDDEVVEELRADGI.............................IIATPSGSTAYSMSAGGP-IVDPRVEA
PPNK_ARCFU/2-235KMID..VALRVDGVEVDRIRCDGF.............................IVATQIGSTGYAFSAGGP-VVEPYLEC
Q97Y21_SULSO/3-315WDEYSLRYAFISKGELGDIGIPSIASLIRPITFQDDLGLMVKFGL...GKIKVAATLAPGLVKEVFIDGIS-ILKLGQEV
UTR1_YEAST/129-428FLSM..LELYGDGSLMTVAQADGL.............................IAATPTGSTAYSLSAGGS-LVCPTVNA
PPNK1_BACSU/2-248LV....ADVEIKGQLFETFRGDGL.............................CLSTPSGSTAYNKALGGA-IIHPSIRA
PPNK_MYCTU/6-284GVLG..VVVEIDGRPVSAFGCDGV.............................LVSTPTGSTAYAFSAGGP-VLWPDLEA
Q52013_PSEPU/7-324SRSEDLCEVFACFAEPHAIGLSALCGLWCPVSRQDLHGAWIRLNP..GAEQALLAPLAAGLLQACGITASG-PLTPGVAH
PPNK2_SYNY3/5-277RMPTAIIEVEVDGELIDQYQCDGL.............................LVATPTGSTCYTSSANGP-ILHPGMDA
Q9V1D1_PYRAB/4-378TIKRIKDKLGIEGTLLGVDIVEVKGGEVKLLVKDASEKDLLKFLD...RNPR.VVVTIIGGLNFLFGRGNQ-QFSPEVLR
PPNK2_BACSU/7-253TFV...MDVLIDDLHFETFRGDGM.............................IISTPTGSTAYNKSVAGA-VVDPLLPC
O59324_PYRHO/2-376TIKRIKDKIGIEGTLLGVDVVRVENGKAKLLVKDASEKDLLKFLD...KKPK.IVVTIIGGLNFLFGRGNQ-QFSPEVLK
PPNK_HELPY/7-261GVLD..IKAYAGHTPFNTYKGDGL.............................IIATPLGSTAYNLSAHGP-IVHALSQS
PPNK_PORGI/3-259SMIR..VNACLNDDYLAAYDADGL.............................VVATPSGSTAYSLSGNGP-IIMPACRN
YDU2_SCHPO/164-495FMIS..LDLYVENEYITTLQSDGV.............................CVSTPTGSTAYSVAAGGS-LCHPGIPA
PPNK_MYCGE/2-241P.....INIFIDDNHWESYRGSGL.............................LIGPRTGSTALAKSAKGA-VIFPNVDV
Q9HRC1_HALSA/3-357TLAEIADALGVSGSPLGVDVYRDG....ALVVRDGSASEITAALG...TDNV.VYVSPIGGQGFVFGRGND-QISPAIID
PPNK_PYRHO/2-261KIIH..MKYYVDGGLADEVRADGL.............................VVSTPTGSTGYAMSAGGP-FIDPRLDV
Q9HJA2_THEAC/8-352TCKTIETEMGINTNPLAFDIIRNR....KLIKEDAAEQDIYDACR...KGCR.LIISPIGGQNFLIGRGNK-QISSRVLE
PPNK1_SYNY3/3-276SMCH..FEIQVGYHASVDIAADGI.............................IVSTPTGSTAYSLSAGGP-VVTPDVPV
PPNK_SHIFL/7-272HMIE..FEVYIDEIFAFSQRSDGL.............................IISTPTGSTAYSLSAGGP-ILTPSLDA
Q971Y1_SULTO/4-354TVKYILKKLGYKTNFLAIDVTYGK....KLVKTSVNYYDLLNLTG...ELN..LILTPIGKQGFLIGRGNQ-EIGPEVLQ
PPNK_BORBU/4-265KMIY..VDLMVNSESFLSYKSDGI.............................IVSTPTGSTGYSFSAGGP-ILEADLEG
PPNK_MYCPN/2-241P.....INIFIDGEAWEFYRGSGL.............................LIGPRTGSTALAKSAKGA-VIFPGIDV
Q97ZM3_SULSO/4-354TVKYIERKLKIDTPFLGIDIIRGK....KLIKENVNYFDLINLTG...ELK..IVLTPIGKQGFLIGRGNL-ELGPIFLR

PF00365

K6PL_HUMAN/16-326SHQRTFVLEVMGRHCGYLALVSALASGAD------------------------WLFIPEAP.PEDGWENFM-CERLGETR
K6PF_HUMAN/16-326SHQRTFVLEVMGRHCGYLALVTSLSCGAD------------------------WVFIPECP.PDDDWEEHL-CRRLSETR
K6PF1_THET8/2-280SHERVFFIEVMGRHAGFIALDVGLAGGAE------------------------VIAVPEEP....VDPKAV-AEVLEASQ
K6PF2_KLULA/176-488SHSRAFVVEVMGRNCGWLALLAGISTSAD------------------------YILIPEKPASSREWQDQM-CDIISKHR
K6PF1_KLULA/184-494SHSRAFVVEVMGRHCGWLGLMSGIATAAD------------------------YIFIPERAAPHGKWQDEL-KRVCQRHR
K6PF1_SHIFL/3-278SHQRISVVEVMGRYCGDLTLAAAIAGGCE------------------------FVVVPEVE....FSREDL-VNEIKAGI
K6PF_LACLA/2-278SHNRTFVVEVMGRNAGDIALNAGIAAGAD------------------------DICIPEKE....FKFENV-VNNINKGY
K6PP_HUMAN/25-335SHQRTFVLEVMGRHCGYLALVSALACGAD------------------------WVFLPESP.PEEGWEEQM-CVKLSENR
K6PF_LACDE/2-277SHHRVFIVNVMGRNCGDIAMRVGVACGAD------------------------AIVIPERP....YDVEEI-ANRLKQAQ
K6PF_SPICI/3-279SHNRCSIVEVMGHACGDIALYAGIAGGAD------------------------IISINEAA....LSETEI-ADRVAMLH
K6PF_GEOSE/2-277SHERTYVIEVMGRHAGDIALWSGLAGGAE------------------------TILIPEAD....YDMNDV-IARLKRGH
K6PF_HAEIN/3-279SHQRISIVEIMGRHCSDLTISAGIAGGCE------------------------YIVASEIE....FNREEL-IQQIERSI

PF00781

DGK3_CAEEL/427-552..........................................ENLHKILE.QIE.KSS...LIDMDRW-------
CERK1_MOUSE/132-277..........................................SALHIIIG.DSL.AID...VSSVHYH-------
Q7XCS9_ORYSJ/234-367..........................................AAMSIVRG.GFT.PID...VFAVE.W-------
DGKG_HUMAN/434-558..........................................GSLTKILK.DIE.QSP...LVMLDRW-------
DGKQ_HUMAN/588-715..........................................EDPFSVLL.SVD.EAD...AVLMDRW-------
BMRU_BACSU/5-132..........................................AAEALMAG.KKTSVDV...CQMNDRY-------
DGKA_DICDI/334-467..........................................EKLIEILK.SIN.EAK...TIQMDTW-------
DGK1_DROME/552-676..........................................ENIPKLMD.KFR.RAS...TVMLDRW-------
SPHK1_HUMAN/16-153.........................V.T.............NEDLLTNCT.LLLCRRL...LSPMNLL-------
LCBK1_ARATH/249-382...........................................AALSIVK.GGL.TAT...DVFAVEW-------
Q7QIP4_ANOGA/172-308.........................T.KP...........VLASALMVVK.GKH........SMLDVV-------
YEGS_PSEPK/6-128..........................................ALALLNVA.PQP..ID...LGQAGDQ-------
DGK2_DROME/812-938..........................................EPIGKILR.EIG.MSQ...CVLMDRW-------
O05848_MYCTU/2-130............................................ATNQLI.QLL..DD...YGRHQQW-------
DGKZ_RAT/296-420..........................................EPVSKILS.HVE.EGN...VVQLDRW-------
LCB4_SCHPO/107-265LEIL................KGRPTS.FDLMTFE.QKGKKAYSFLTANYG.IIA..DC...DIGTENW-------
DAGK_BACSU/3-131.........................................KAADTVING.VAR.PID...IGQVNGQ-------
YTLR_BACSU/3-130.........................................LIQEIKKVK.RPL..TR...TFHLGSV-------
O44334_DROME/205-332.........................................VLDPVKILR.SIR.RAR...SVNLDRF-------
DAGK_MYCTU/13-145........................AA.DI...........VVDGWTETID.LGR.IQD...DNGIEKW-------
O65419_ARATH/379-515.........................C.A.............NSATISIIR.GHK.RSV...DVATIAQ-------
O65419_ARATH/909-1042..........................................FFSVLMLA.WGLVADI...DIESEKF-------
O82359_ARATH/53-194...........................................AVERIAR.GMRSRID...VGVIDKE-------
DGKA_MOUSE/372-495..........................................ENLRKILK.DIE.LSK...VVYLDRW-------
O88885_MOUSE/138-275.........................V.T.............NEDLLINCT.LLLCRRR...LSPMNLL-------
DGKE_HUMAN/219-350..........................................EIPVAQVL.RNVMEAD...GIKLDRW-------
P72262_RHOER/199-320..........................................ANAVETGH.AVL.VDQ...AVVHTDV-------
P72269_RHOER/199-326.........................Q.A............VESGQAAFVD.HAVVRTD...SGVTARF-------
LCB5_YEAST/270-410.........................T.L............CLIKSIETRI.DLMCCSQ...PSYAREH-------
DGK5_CAEEL/418-545..........................................EPISQLMQ.AILHETI...VTHLDRW-------
Y510_MYCBO/72-200..........................................RPVLSTLR.SAT.DGR...PPVIQLW-------
LCB4_YEAST/228-368.........................A.L............CLVKSIETRI.DLMCCSQ...PSYMNEW-------
Q17860_CAEEL/548-676.........................................EENPMDILK.DVI.EAD...TVKLDRW-------
Q18425_CAEEL/87-224.........................................NEKSVMERA.LEIATSP...TAKAESV-------
DGK1_ARATH/361-490.........................V.E.............RQGGLSTVL.QNIEHAA...VTVLDRW-------
Y036_SYNY3/126-267.........................C.QT...........INRGITKVVD.TAL.CND...IPMLLLA-------
Q7MUX7_PORGI/2-127..........................................ALEVIRAG.HVR.TID...CCEADSR-------
Q7NFK6_GLOVI/25-155.........................C.EA...........IIDGATRAVD.VAT.CNG...LPMVLLA-------
Q7NHQ5_GLOVI/4-128..........................................ACRVILQE.RTR.RID...IARCNGQ-------
Q7S9Y1_NEUCR/163-325LAIV...............KGVPTKL.DLCSVTL.QDGERLTSFLSQAYG.LIADLDI...TTEHLRW-------
Q7WU58_THESQ/26-155............................................AIKTLK.DGKEFVQ...DLGVGEY-------
Q7XN57_ORYSJ/228-361...........................................ASLLIVK.GGF.TAL...DILSVEW-------
Q7XQT2_ORYSJ/45-188.........................T.D.............QEAVKSFLG.QVK.KAR...EMNIDSW-------
Q7Z299_CAEEL/18-143.........................................DIDVIKLME.DIQ.EAE...VTLVDRW-------
AGK_DANRE/65-196..........................................QHITSATL.SIL.KGE...TVPLDVL-------
Q816L3_BACCR/8-134..........................................AAKLITEE.HIK.PVD...VAKANGQ-------
Q81IN1_BACCR/4-126................................................AA.DIICEGK...TVPLDLG-------
Q825G8_STRAW/196-328.........................V.A............VARGEAVAVD.LGV.AAP...KEGHDVL-------
Q828H5_STRAW/4-131.........................A.A.............GRVIAEALK.GAR..LR...DVDLGRV-------
Q82DG7_STRAW/133-259.........................T.C.............LDALADGVE.LRV...D...LGFAGEH-------
Q82IW7_STRAW/2-133...........................A.............TGALLDALR.EKR..ER...TVGLGLA-------
Q82KT9_STRAW/12-140..........................................ESLKAVLT.DSG.VGG...SARLRRH-------
Q82LY1_STRAW/212-325..........................................TRALRQGD.AVR........VDVGRF-------
Q82NY8_STRAW/196-327.........................R.A............VCDGD.AIVA.DVG.CAR...VPDGPEQ-------
Q82W90_NITEU/7-134...........................................ILSRIRQ.HLQRPGD...MKQVRRP-------
Q830V8_ENTFA/4-144...........................A.............LHQILRTRR.PKE..IQ...TIHYVEA-------
Q830X4_ENTFA/3-148QQ...................LDLEK.TSALD.....VGKINDDYFMNVV.AIG..TI...PESINDV-------
Q837V1_ENTFA/3-127............................................KAAEVI.KKN...Q...TVKMDIG-------
Q839R8_ENTFA/4-131..........................................AFETILAG.QTT.PVD...FGMVNQD-------
Q840Q1_STRGR/46-174..........................................EATGAILD.ALE..NR...TERTVGL-------
Q84S01_ORYSJ/99-233..........................................AATTLAKG.GIT.PID...VFSVKRT-------
YEGS_VIBPA/3-130..........................................ALTLAVEG.QALSVDC...VKANDRC-------
Q87TI4_VIBPA/240-363..........................................SPVEKACE.AIL.AGH...CQRIDTA-------
YEGS_PSESM/6-125............................................ALQLMD.VAP...R...AVDLGEV-------
Q898U2_CLOTE/3-130.........................A.C.............EQILDSEPK.EID...I...GKVNDKY-------
Q89ZQ4_BACTN/7-138..........................................AVDCIINH.RLK.KID...VGFCNFY-------
Q8A9E4_BACTN/3-128..........................................ALEVLNEG.CLD.TID...YGKINGT-------
Q8CJN4_STRCO/135-258.........................................AALEALTGG.VELRVDL...GYAADRV-------
Y507_STAES/7-139..........................................ASEQLLTS.HAESYDV...LKVNDLY-------
Q8DT50_STRMU/7-131..............................................EATK.LIG.KNQ...TIHMDIG-------
Q8DZ02_STRA5/3-133..........................................ALENLLNG.HVKSVDI...CKVNDDY-------
Q8E5W0_STRA3/6-135..........................................EATKLIGK.NQIVKMD...IGQAQED-------
Q8E7Z2_STRA3/2-129...........................L.............TAIQTERLK.EINCFIY...DKGLILN-------
Q8ES48_OCEIH/3-126............................................ALEQIL.QKQ..IK...TVDVGKY-------
Q8ES76_OCEIH/3-131...........................A.............VDVIIEGNR.MKL..DI...GRVNDDH-------
YEGS_ECOL6/6-132..........................................ALKLAIAG.NTI.AID...MAQVNKQ-------
Q8FMN3_COREF/5-141............................................AAEMLI.DLI.RGDLRRTISLGTW-------
Q8G3W8_BIFLO/116-238............................................AALTVA.TSH.GSR...LVDMGRL-------
Q8H350_ORYSJ/132-250...........................................DVTSVVQ.GKT.RFF...SVLMLTW-------
Q8K7G9_STRP3/3-133..........................................ALDTILTG.QIKQVDI...CKANQQY-------
Q8KC59_CHLTE/8-129.........................................KEHEVRIRG.FAGATSR...KVDLGKV-------
Q8L7L1_ARATH/120-252..........................................SATSATIS.IIR..GR...TRSLDVA-------
Q8LE70_ARATH/40-181.........................T.D.............RTAVESFLE.QVL.KAK...VMKIDNW-------
Q8MUB2_APLCA/403-531.........................................GEDPLNVLR.DVI.DAE...EIKLDRW-------
DGKD_HUMAN/321-446..........................................DTQLPQIL.EKLERAS...TKMLDRW-------
Q8NMJ5_CORGL/9-145.........................................AADALVELI.RKN.HTR...TITLGTW-------
Y688_STAAW/7-138..........................................ASEQMISA.QVG.KYD...VIKINNQ-------
YEGS_XANCP/5-130..............................................ALGL.IAERAAE...PIDLLRI-------
Q8R6L5_THETN/1-126..........................................AIDVLIMG.NVK.VID...AALINGI-------
Q9VZW0_DROME/216-357........................SK.PV...........LGAALTVISG.RSS.PMD...VVRVQLQ-------
CERK1_HUMAN/132-278.........................A.E.............TSALHIVVG.DSLAMDV...SSVHHNS-------
Q8VZG1_ARATH/91-237.........................A.W.............RSAVKRTLH.RAS.MGP...VARLDSW-------
Q8XKR6_CLOPE/3-130...........................C.............VEQILDSYA.VGV..DL...GKVNDNY-------
Q8Y497_LISMO/4-132..........................................EALRIIAK.QETIRVD...IGKANET-------
Q8Y6D4_LISMO/4-133.........................................ATKIIAAGQ.SVA.MDI...GKANETY-------
Q8Y8W8_LISMO/3-130..........................................AIQALEKA.IAV.PMD...VGRIGDQ-------
Q8YT45_NOSS1/28-150..........................................ACKTIAEG.ELR.RID...LGWVNGK-------
Q8YVU8_NOSS1/4-134.........................C.RT...........ILQGVTRNVD.VAY.CND...LPMILLV-------
Q92R72_RHIME/2-130..........................................VPEVLANG.RII.DAD...IGSADGR-------
Q95S15_DROME/5-150..........................................AAIHVILG.QHRGLDV...CSVSNGQ-------
Q97L83_CLOAB/3-130.........................A.C.............EQILNSEIR.KID...I...GKINDKY-------
Y1045_STRPN/3-130............................................AIDELDFDLTNKID...IGKANDN-------
Q98FN7_RHILO/63-205K......................SFA.DGE........IIAVDMATANGR.PFIHQFS...IGMHAKM-------
Q98I19_RHILO/35-169.........................T.L.............KRIAGAEGR.KVD.AGR...ICYIDDH-------
Q98NZ1_RHILO/168-300.........................................AIDTIATGK.PVA.VDV...AEVNGRV-------
DAGK_STAAM/4-132..........................................ALDVIIEG.HSTKVDI...GKMNNRY-------
Q9CEN8_LACLA/2-173EAARRGINHEIFIMNYQSKGLSGYALNNIGIGLDATIVKSANEGKLKQVL.NKLKLGS...FSYILTA-------
Q9CEU7_LACLA/3-134...........................A.............LNNLSQGEI.QKF..DI...AKVNNDY-------
Q9CIE3_LACLA/3-135.........................E.A............IEIIGKNQIL.NID.VGH...AVIRETQ-------
Q9F3M0_STRCO/2-143........................GA.LLD.........ALREGSERTVG.LGLASGT...PGSEDEA-------
Q9FFN7_ARATH/342-471.........................V.D.............GQGSLRTFL.QDIDHAA...VTMLDRW-------
Q9FHH4_ARATH/90-236.........................A.W.............KSAIKRTLH.RAS.VAP...ISRLDSW-------
Q9FVC9_SOLLC/40-183.........................T.D.............LNSVISFLK.QVM.NAK...EMKMDSW-------
YEGS_PSEAE/6-128............................................ALALLD.QTARPID...LGEVNGK-------
SPHK2_MOUSE/147-284.........................V.V.............GVDLLLNCS.LLLCRGG...SHPLDLL-------
Q9KC00_BACHD/4-128..........................................AGNLLESG.TWK.RVP...LIQANHR-------
Q9KF21_BACHD/3-130..........................................ACDILIEG.HTK.PVD...VGKAGDH-------
SPHK2_HUMAN/182-319.........................A.L.............GLDLLLNCS.LLLCRGG...GHPLDLL-------
Q9RJ98_STRCO/3-124............................................LAEVLL.HGE..PR...PVDTVEV-------
Q9RS93_DEIRA/20-138............................................VLEGYR.GAQ..VR...PFDLGRV-------
Q9RU35_DEIRA/21-149.........................L.G............RLSEPPRQVD.ALE..AE...VVRGDHA-------
Q9RUM1_DEIRA/11-127...............................................LAR.IAL.AGH...AVQVDLG-------
Q9VL10_DROME/56-181.........................I.F.............GVKDVDYVK.SLS.KAL...EPMLKDE-------
Q9VYY8_DROME/190-333........................PK.PI...........LHATLTCMAG.KST.PMD...VVRVELA-------
Q9ZC02_STRCO/213-325..........................................CGALERGE.GVR........VDVGRF-------

PF01513

ACOX_CUPNH/14-336.............................RVR......QRSGIVALDGERELAFGPDDEVTVTLHDHA.FRSIDV
Q46144_9CLOT/3-316EFIS..................................KVGGTIALDGEREIAFKAGERFVFKITRNG.PLHVDI
Q97BD3_THEVO/2-346.............RVGEENLIVVSSPS...........KAEHLKYVYIDTQIPLWSNGYVKVLVGYGR.YKLVKV
PPNK_AQUAE/3-259LLFVPICP.....HTLSNRPLVLPSKFEVKFKVVSE..NMEAFLTLDGQEGFHLKKGDEVIVKRSRYVCRMYSHP
PPNK_HAEIN/10-277IALVPMFP.....HTLTSRPLVVDGDSKISIRFAEH.NTSQLEVGCDSQITLPFTPDDVVHIQKSEHK.LRLLHL
Q9I3E5_PSEAE/5-369.............AIGLERMRVVATKRKLGTL......GGRPLLVDSGDPVLDDSFPDTIRVWAGYKE.ELLYPL
Q9HWN2_PSEAE/7-324APS...................................LSSGTLALDGEREIEFSATDRPSITLDPSG.PFSVDV
PPNK_METJA/303-560FIISPICP.....FKLSSRPLVISASNRIKLKLKL...EKPALLVIDGSVEYEINKDDELIFEKSDSY.AYFVKG
YEF1_YEAST/108-407IAVTPICP.....HTLSFRPIILPDSMELKVRVDMN.SRGTSWVNFDGKDRVELKQGDYVVITASPYS.VPTIES
PPNK_METTH/3-261FLIVPICP.....FKLSARPLVVSNKSVIRVKLLRK..GKKAIAVIDGQYEEEINHMDEVIFRKSERK.AHFVRL
PPNK_ARCFU/2-235FILIPIAP.....FRFGWKPYVVSMERKIEVI......AEKAIVVADGQKSVDF..DGEITIEKSEFPAVFFKNE
Q97Y21_SULSO/3-315HLP...................................SGSYVIAFDGEKEMVVNSKDEAMVRIDRDG.PLLVSI
UTR1_YEAST/129-428IALTPICP.....HALSFRPIILPESINLKVKVSMK.SRAPAWAAFDGKDRIELQKGDFITICASPYA.FPTVEA
PPNK1_BACSU/2-248IQLAEMASINNRVFRTVGSPLLLPSHHDCMIKPR....NEVDFQVTIDHLTLLHKDVKSIRCQVASEK.VRFARF
PPNK_MYCTU/6-284ILVVPNNA.....HALFGRPMVTSPEATIAIEIEAD..GHDALVFCDGRREMLIPAGSRLEVTRCVTS.VKWARL
Q52013_PSEPU/7-324RLS...................................LTSGTLALDGEREIEFAEHDTPTITLDHQG.PLSVDV
PPNK2_SYNY3/5-277IVITPICP.....LSLSSRPIVIPPGSSVNIWPLGD.FELNTKLWTDGSLATGVWPGQRVGVWMAHRA.AQFILL
Q9V1D1_PYRAB/4-378.............RIGKENVIVVATRSKI.........KDGFVRVYTGDKSVDSKFKGYIKVRVSPWM.ERLVKV
PPNK2_BACSU/7-253MQVSELASLNNNTYRTLGSPFVLSSDRKLTLRVVQD..GNEHPIIGLDNEALSTRNVKTIEIKLSNKK.IKTVKL
O59324_PYRHO/2-376.............KVGKEGVIVVATPSKV.........KDGFVRVYTGDEDVDEKFKGYIRVRVSPWM.EKLVKV
PPNK_HELPY/7-261YILTPLCD.....FSLTQRPLVLGAEFCLNFCA.....HEDALVVIDGQATYDLKANQPLYIQKSPTT.TKLLQK
PPNK_PORGI/3-259FVLTPIAP.....HSLNMRPLVVPDDTVIRLEVDSR..SRNYLLVLDGRTRTLP..........CDTS.ILLKRA
YDU2_SCHPO/164-495ILISAICP.....HSLSFRPIILPDSMTLRIVVPLD.ARSNAWCAFDGHHRIELGLGDYISISASSFPFPSVIRS
PPNK_MYCGE/2-241VQIIELNPLLHPNQITIQSPIILPMQTKVEFRIKKAFKAEQFPNFYADGIKLDLKNEDTSISFQLVLSRSMFHAS
Q9HRC1_HALSA/3-357................RSEVRVVASPQKLD........QTGVLRVDTGSEDTDASLRGWQRVRTGRFE.KRLVNV
PPNK_PYRHO/2-261ILIAPLLP.....LPKTSVPMVIPGSSRIDIRMLT...DREIILAIDGQYYEHLPPNVEITVVKSPRK.TKFIRF
Q9HJA2_THEAC/8-352.............LLDAEDIIVVASPS...........KAETIRALYVDSDVNPWKNGYVRVLSGYGK.YKIVPV
PPNK1_SYNY3/3-276FQLAPICP.....HSLASRALVFSDLEPVTIFPAT...PNRMVLVVDGNGGCYVLPEDRVHLSKSPYP.AKFIRL
PPNK_SHIFL/7-272ITLVPMFP.....HTLSARPLVINSSSTIRLRFSHR..RNDLEISCDSQIALPIQEGEDVLIRRCDYH.LNLIHP
Q971Y1_SULTO/4-354.............KIRRDKIIIVSTRSKLN........TIECLRIDTGNPLLDRKFQGIYKVIVGYEE.FVAIKT
PPNK_BORBU/4-265FXLTPISP.....HSVYNRSFVFSKLSKLSISFSKEYFIAAASIFLDGINFGSFGVDVVFEFKISSQS.LNFVSF
PPNK_MYCPN/2-241LQIIEMNPLLHPNQVTIQSPIILPKETQVEFVVKKAFNPQQFPTFYCDGRKLELPNADTTLALKLVQSTPMFNIS
Q97ZM3_SULSO/4-354.............KVKKDDLIVVSTFSKLY........TINCLRIDTGDENLDKLFSGVYNVIVGYNK.FYAIKT

PF00365

K6PL_HUMAN/16-326SRGSRLNIIIIAEGAIDRNGKPISSSYVKDLVVQRLGFDTRVTVLGHVQRGGTPSAFDRILSSKMGMEAVMALLE
K6PF_HUMAN/16-326TRGSRLNIIIVAEGAIDKNGKPITSEDIKNLVVKRLGYDTRVTVLGHVQRGGTPSAFDRILGSRMGVEAVMALLE
K6PF1_THET8/2-280RRGKKSSIVVVAEGAYP..GGA..AGLLAAIREH.LQVEARVTVLGHIQRGGSPTAKDRILASRLGAAAVEALVG
K6PF2_KLULA/176-488SRGKRTTIVIVAEGAISADLTPISSKDVHKVLVDRLGLDCRITTLGHVQRGGTAVAYDRILATLQGVEAVNAVLE
K6PF1_KLULA/184-494EKGRRNNTVIVAEGALDDQLNPITAEQVKDVLVE.LGLDTKITTLGHVQRGGTAVAHDRWLATLQGVDAVKAILN
K6PF1_SHIFL/3-278AKGKKHAIVAITEHMCD....V..DELAHFIEKET.GRETRATVLGHIQRGGSPVPYDRILASRMGAYAIDLLLA
K6PF_LACLA/2-278EKGKNHHIIVLAEGVMT....G..EEFATKLKEAGYKGDLRVSVLGHIQRGGSPTARDRVLASRMGARAVELLRD
K6PP_HUMAN/25-335ARKKRLNIIIVAEGAIDTQNKPITSEKIKELVVTQLGYDTRVTILGHVQRGGTPSAFDRILASRMGVEAVIALLE
K6PF_LACDE/2-277ESGKDHGLVVVAEGVMT....A..DQFMAELKKYG.DFDVRANVLGHMQRGGTPTVSDRVLASKLGSEAVHLLLE
K6PF_SPICI/3-279QAQKRSVIVVVSEMIYP....DVHKLAKLVESKSG..YITRATVLGHTQRGGNPTAMDRYRAFQMAQFAVEQIIA
K6PF_GEOSE/2-277ERGKKHSIIIVAEGVGS....G..VDFGRQIQEAT.GFETRVTVLGHVQRGGSPTAFDRVLASRLGARAVELLLE
K6PF_HAEIN/3-279IRGKRHAIIAITELLT.....DVHSLAKEIEARVG..HETRATVLGHIQRGGSPCAFDRILASRMGAYAVDLLLQ

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window