Sequence alignment for CL0243

PF08800

Q89YW2_BACTN/54-177EAKRYKATHFDYC----------TFSGLFRK...RNEKELIMHSGLMCLDFDHVD...------------NIGRLKQQL-
Q8A2C0_BACTN/50-185DKNDYIER.VPKI----------LPAAAFVR..KNGVMAMAEYNGIVMLQVNGLSGRM------------EADEVKECV-
Q8A9V6_BACTN/54-177DAQTIKDS.MACV----------IPAGICKN..GHAKNNLTSLSLALCIDIDHT..DE------------QTKDIFVRA-
Q64Q18_BACFR/51-194EAENVKRQ.LDYF----------TVTANYHE..CRLAHSIAAYNDTSTIDIDKLR.EE------------ELERIRALI-
Q8A059_BACTN/50-185ESCSFAGK.LPKV----------IPAAVFGR..VNGVKRMKVYNGIVELTVGPLAGKV------------EVEMVKKKA-
Q89ZT4_BACTN/53-190SQYEHIDK.LPYI----------YSAVECTR.TKEGERKMKQYNGLVQLEVNRLAGPS------------EMEYVKRQA-
Q8A723_BACTN/63-205DIRMAKTSLLPYV----------TPCGTFIR...RNSKFFASPSGLVVVDIDNLDSYQ------------KAVEMRRTL-
Q8A429_BACTN/50-185AKLDDAKK.LTKV----------IPAAAFRK..TANGIQMTAYNGIIQIEVNHLANLM------------EVNRVKQEA-
Q8AAR0_BACTN/55-175AAQKLKSQ.LPCF----------TPAGTFDG..AHAIRNFQLPSHIIGLDYDHV..PN------------RLEIIRLCA-
Q89Z67_BACTN/5-140DRCMFADK.LPEI----------IPAAEFRK..VNGQKQMKAYNGIVELTVGPLSNKS------------EIALVKQKA-
Q64NA7_BACFR/24-162GHIMAVDK.LPRI----------YFSVEMGR..KEEVSVMKAYHGLILLNVRGLAGFD------------EAVRLRDKL-
Q8A698_BACTN/63-188EAKMVKDA.MPVV----------IIEGICRPHCSHAAANLEKMSRLAMYDLDHL..NE------------RTSAVKALF-
Q5LBN5_BACFN/54-177EGKRLKGA.LNAV----------VVAGKCRG..GHAANQVTELNGLALFDFDHC..LE------------MLAGMKEKA-
Q89YJ7_BACTN/32-167KAANEKKKELPAI----------AFSASYRG..RRTKVNLVKYLGHIVIDIDHLS.KE------------ELARILPII-

PF03090

Q56299_THIK1/42-167TATRVRPR-----------------EYAIRY--PYMQVNRPGFVSWLIFDLDHA..KA...............MIWEDA-
O30683_RHOER/28-164DGSFRMPR-----------------SDALLK--RFIQANPREYVSQIVVDIDHA..DA............ELRAFSMHE-
Q9FB48_CORST/95-244PKLYRVDT-----------------AAMRRC--QYVVLAHKQRSSVVVIDIDHP..GTPGGQVTDIHPVVHEKLSIMAA-
Q45286_BIFLN/38-173SRLHRRSR-----------------ADALKC--KHIEANPAALVNTIVVDIDDA..NA............KAMALWEHE-
Q9RLE8_PLESH/25-159FGVRIAGK-----------------ERALLA--KYIQFNQPHAMYWLCFDVDRA..GA..............AIDWADL-
Q46060_CORGT/75-225PKLYRAGS-----------------KALTRC--QYVALTHAQHAAVIVLDIDVPSHQA.GGKIEHVNPQVYAILEKWAR-
Q9X539_CORGT/68-217PRMYRVDS-----------------DALEKC--EYVQLTNKQYASVLVVDIDLP..GTAGGHPVNLNDEVKEKFSQLIS-
Q9XBN1_RHORH/15-151EGVYRMRR-----------------PAALER--RYIEANPQTLSNLLVVDVDHP..DS............ALRALSAAG-
P97024_BRELN/26-161RAFYRTSR-----------------HNALDV--RYIEANPQSLSNLLVVDIDHP..DA.............AHAACGTE-
Q51630_ECOLX/24-158FGLRISGK-----------------GRALLA--RYIQQNQPHAQFWLVFDVDRE..GA..............AIDWSDL-
Q9X743_HALEL/44-174DGLRIRDV-----------------QRALSA--RYIQPNGPTHRYWLVYDVDRS..GA..............ALDWNDR-
Q9ZEX6_9PROT/31-170AGLQIRSL-----------------KTALQR--AYIQHNHPGMIWAMVYDVDRA..CV.........NPTDWWPIWESV-
Q50999_9ZZZZ/28-166APMLVRSY-----------------AAAIKR--RYIQVNPSHLRVFMLFDLDYE..GA..............GLAWEDN-
O50474_PSESX/58-191TATRVRPR-----------------EYALRY--PYMQVNRPGMVSWLVFDLDHA..NA...............LAWDDA-
Q52148_9ZZZZ/53-189EGIYRQSR-----------------ASALGR--RYIEANPTALANLLVVDVDHP..DA............ALRALSARG-

PF01896

CC111_HUMAN/113-234FDLEFNKPANPGA..........DGKKMVALLIEYVCKALQELYGVNCSAED.V--LN..............LDSSTDE.
Q6BRU1_DEBHA/140-384FDIDLTDYDDIRTC........CSGTDICKKCWKFIQVASKIIDQALREDFG.F--KH..............LIWVFSG.
Q7Q633_ANOGA/117-350FDIDMTDYDDIRTC........CNEANVCQLCWKFMSIACRVLDEALREDFG.F--EH..............LLWVFSG.
YL207_MIMIV/130-315LDFCQPKEHGKRY...........YTEITIRNVVKLYNSIIKKYLNVEHSSF.V--TYVS.........EKERPVLRNGE
PRIS_AERPE/96-277FDIDVDSLEGCGE.............VLGDSCLSRGYKQAVRLVEALYRDFG.V--PS...............TLYFTG.
PRI1_SCHPO/130-363FDIDMTDYDDVRTC........CSKTNICEKCWPFITIAVQVLDICFHEDFG.F--KH..............ILWVYSG.
O24984_HELPY/74-180IVFDYNGRNPERF..........................YHKAQLLLREEGF.M--NF..............TAYNTKT.
PRIS_ARCFU/95-273FDIDADHLPVKAQ..............SFEKALEMAKREIKKLTAVLRADFG.I--RD..............MKIYFSG.
VF184_IIV6/68-265VDIDLKKEVNGYPNYGSNDFYNDEDIINVVKIFQNAVSENVNRHAKKLTNKN.L--RCVVLEKDIFIERINESEDKYIV.
O89045_RAT/110-337FDIDMTDYDDVRRC........CSSADICSKCWTLMTMAMRIIDRALKEDFG.F--KH..............RLWVYSG.
O92381_NPVBM/75-223VDADYKNYVDEHD.................LMLKIYIGATAFLLFYTEENVS..--.................RVMYTG.
PRI1_YEAST/110-344FDIDMDDYDAFRTC........CSGAQVCSKCWKFISLAMKITNTALREDFG.Y--KD..............FIWVFSG.
D5_FOWPN/70-218FDVDMDGRLDDKY..........QATHNFVNIITKFVADYAYNDCKMISNHR.D--KDKMITDM..KSNFSITESTDKE.
PRI1_CAEEL/105-345FDIDLTDYDPVRNC........CKDATVCPKCWKFMVLAVKILDFQLEDMFD.F--KA..............RMWVFSG.
Y963_MYCBO/136-257FDLDPGEGVMMAQ......................LAEVARA.VRDLLADIG.L--VT...............FPVTSG.
P90220_NPVCF/74-220IDADFKDYENKTD.................LMLKVNVGATALMLFFADKEDA.V--Q................RVMFSG.
P95226_MYCTU/141-261VDLDPMPGVAWQR......................VVEVALV.VREVLEDYG.L--TA...............WPKTSG.
VG63_ICHVA/354-534FDIDRKFSGLLDPMGAI.DNICEIFVAFLHRAVEKFFNFNRVDKNRIGEVAV.F--VR..............RAALPGK.
Q07183_ASF/77-214FDIDFPVNKSYSNDNVD.DNVDDNVYNILDMIINVIMDVFYETYSLPYNINL.T--RE..............QILLTDSI
PRI1_DROME/126-364FDIDMTDYDEVRTC........CSGAGVCLKCWKFMVLAARVLDVALREDFG.F--EH..............IIWIFSG.
PRI1_PLAFK/129-377FDIDMNDYDDIRTC........CTDKKVCKLCWKFLTVAIVLLDTALREDFS.F--EH..............ILWVYSG.
Q2UQ78_ASPOR/191-422FDIDLTDYDDIRSC........CEKANICGKCWTFVTMAMKVVDTALRDDFG.F--QH..............ILWVYSG.
Q30YF6_DESDG/146-260LAADFDEADWRED...........................ARAFMQSCRELA.I--PA..............ALEISRS.
Q3IV37_RHOS4/113-247IDHDGLQDGTCLSR........EDLLERLYACAPSLRQVKILALPSSSSHIC.R--TD..............TGEDLTG.
Q3J300_RHOS4/693-814FDLDPDEGLDFAH......................VRTAAAE.LRGLLTDLG.L--PS...............VPMLSG.
Q3JIW1_BURP1/809-930FDLDPDPSLDWRA......................VIEAAQL.TRALLDELG.L--VS...............FCKTSG.
Q3M8I3_ANAVT/68-194VTVNMTSGNKRKA.................ENITAVRALFIDCDNELPNEFH.L--TP..............TVVVNSS.
Q48H05_PSE14/694-815LDLDPDPALPWRS......................MIEATQM.VLAVLEELG.L--EA...............FLKTSG.
B3ENE3_CHLPB/152-266LVIDFDDAEWRDD...........................AQAFMETSGSLT.I--PA..............SFEISRS.
Q4HD22_CAMCO/94-218VDVDYVGKQQLKN..............................LLKQFGNGV.Q--LR..............PTYLVSS.
Q4QB95_LEIMA/176-317MDIDAQVPQEYWTMS.....KIRVYQRKVLDDVLTPLKEEIEKIGEEIETQV.V--LQ..............SPNLK...
Q4RJB1_TETNG/113-248FDLEFHKPSNEEA..........DGQVMVSGLIQYVCNKLMDVYGVMCETSD.V--LN..............LDSSTEE.
Q54MM7_DICDI/132-357FDIDVDDYNPIRVC........CSSTSLCEKCWGFLAVSAEFIDNYLRECFG.F--QQ..............IMYVFSG.
Q55SM0_CRYNB/116-353FDIDMTDYDEIRTC........CTDKTICKRCWGFIAAAVKVLDHSLRETFG.F--KH..............LLWVYSG.
Q58HZ4_FLDV/61-240LDFDIKEHRKIYD.........KDNLKKLHKQISRYLKEHLGAEDRNLIGVF.L--HK..............PFKLLEDG
Q5AJZ0_CANAL/124-362FDIDLTDYDDIRTC........CQGTDICCKCWKFIQVGSKIIEAALREDFG.F--EH..............LVWVFSG.
Q5CQA3_CRYPI/92-326FDIDMNDYDDIRTC........CQEKTICEKCWLYVTVAIRLIDTSLRQDFG.F--KH..............ILWLYSG.
Q5D505_9EURO/192-423FDIDLTDYDDIRSC........CEKANICAKCWSFVTMAIKVIDTALRDDFG.F--EH..............ILWVYSG.
Q5NVZ6_9ARCH/97-336FDLDADHLPGVKN............MTYGEMLDNVKVEIIRLIDEFLIDDLG.F--REK............DMDIVFSG.
YL794_MIMIV/91-220FDIDVAYNEYPNIP........DNIQDQIEIIIKHTFNKYFIDIDCDNLDYV.W--................SHCNNPI.
Q5Z031_NOCFA/140-262IDLDPMPDCPWSR......................VQRVAGV.VQEVLGELG.A--VG...............WPKTSG.
Q5Z219_NOCFA/139-260FDLDPGPGVGLPE......................CAEVALA.VRDMIEDIG.M--HA...............FPVTSG.
A8XA78_CAEBR/105-345FDIDLTDYDNIRNC........CKEATVCPKCWKFMVLAVKILDFLLDDMFG.F--NA..............RMWVFSG.
Q64S40_BACFR/156-274LCADFDDKNCTHG.......................YKEDVLAFIAVCRDWE.I--PY..............SIERSRS.
LEF1_NPVOP/74-220IDADFKDCADKAE.................LMLKVNVGATAFMLFFEGKEDA.V--Q................RIMFSG.
Q6CF04_YARLI/130-366FDIDMDDYDKFRTC........CSGASVCNKCWRYVQVAVKMVNSALKEDFG.Y--KH..............IMWVFSG.
Q6CVI9_KLULA/134-371FDIDMDDYDSYRTC........CSGAQVCPKCWHFIKLAMKVINSSLENDFG.F--DE..............FIWVFSG.
Q6FKQ9_CANGA/110-346FDIDMDDYDTFRTC........CSGAQVCYKCWRFISLAMEIINVALKEDFG.Y--ND..............FVWVFSG.
Q6MJT8_BDEBA/62-177IDIDSKDLEASLT........................VTIAIVKEFIEKGLT.F--DK.............DFSVAFSG.
Q6NVT9_XENTR/110-335FDIDMTDYDDVRRC........CSSADICPKCWTLMTIAVRILDRALAEDFG.F--QH..............RLWVYSG.
Q6R7G2_OSHVF/509-680FDIDLSPTPMRND..........LNITKLCKDIVDLTNMVLDKLAPVVSSKN.V--TH...............YLFHSEM
PRIM_OSHVF/83-231FDMDFKSKDEFGFGCD...IPPNQVVVMFMEELQLFVNKLIGHDSGKFNAKE.V--LIT...........QCKRLDRPD.
Q6UIX7_9CAUD/107-235IDVDVEGDAFQSV.........AAVLDALESASPWLRDVHRVARPSSSSYVG.A--RG......................
Q6VTX2_NPVCD/72-223IDADFKDCANKAE.................LELKINVGATALLLFFADKEDA.V--Q................RVMFSG.
Q6ZE74_SYNY3/161-274LDLDADGRYHNSE.........................SLAGIREALEELAI.V--SS..............QLVQSSD.
Q75ER1_ASHGO/138-372FDIDMDDYDDFRTC........CSGAQVCDKCWKFIFLAMKVMNTSLIEDFG.L--EQ..............FIWVFSG.
Q7AFI8_ECO57/139-253LAVDFDEAEWQKD...........................ASAFMRSCDELG.V--PA..............ALEISRS.
Q7UJ06_RHOBA/82-191FDIDREGDIDSAT........................QDARRLAMMLVERYR.I--DES............ELLLFFSG.
Q7ZA55_COPCI/108-343FDIDMTDYDLVRTC........CSDAAICKRCWTFISAAVKVLDRSIREHFG.Y--EK..............LLWVYSG.
Q7ZUR8_DANRE/110-336FDIDMTDYDDVRRC........CSAADICSKCWTLMTIAIRILDRALREDFG.F--HH..............LLWVYSG.
Q81EV1_BACCR/73-211FDLDHAEDPSVSQ........................KDAIKLVEFFTKEMD.I--RES............DMWIYFSG.
Q82MG4_STRAW/134-256LDLDPQPGTDYAD......................AVRAAHE.LRAVLHEYGDL--RG...............WPKTSG.
Q8MWR9_EUPCR/124-358FDIDMTDYDDVRTC........CEGANVCLKCWRFMSIATKIIDKAMREDFG.Y--KH..............LLWVFSG.
Q8QNM0_ESV1K/68-356FDVDMLDTDVLGV..........EASSRIFSVIQSVIKSYYAGDQNDDRFRC.V--VC.............DTTVKKVPS
Q8SRD5_ENCCU/108-260FDVDLTDYP..REC........CSEKLVCNRCLVLIKAAVEILNYSLREEFG.F--KD..............VGFVFSG.
PRIS_PYRAE/87-245FDIDGDHLDTEAC.........RESKIVSLRCLEDAREEANKLIDVLIQELD.L--KP..............TRIVFSG.
Q92M95_RHIME/697-818FDLDPDPSVDFET......................VKAAALR.LRDELAEIG.L--KT...............VPMVTG.
PRIS_THEVO/95-267FDLDSDHLPGAEK............MTYEEMLNSIKEQTKRLVNKFLVSDLG.I--SEK............DIRIYFSG.
Q98518_PBCV1/74-236LDILTTRENAKKM...........TTGVFTDEIKNVFYTICVATAMMFDITK.T--TV...............TMCISNI
Q98DP8_RHILO/666-787FDLDPDEGVDVKA......................VREAALD.IRGKLDELS.L--PN...............FVKTSG.
Q9FJ26_ARATH/118-354FDIDITDYDDVRYC........CSGADVCSKCWPLMTVAIKVIDTSLREDFG.F--KH..............ILWVFSG.
PRIS_THEAC/85-256FDLDSDHLPGSEK............LSQKEMLIQIRDQTERLVSDFLIADFG.I--PKS............SIKIYFSG.
Q9ZC15_STRCO/150-270FDLDPAQD.DFEA......................VRAAARL.LAGLLDELK.L--PS...............APMTTG.

PF03121

PRIM_VZVO/1002-1075-IAIKRDWVLFQL---------------I........CGTKGFTCLRYPHRGG.--RTA...........PRTFVSLRV-
UL52_ALHV1/761-835-VFHPTNHCIVQV---------------RP.......DRGNNFKCLRYNHRGS.--SKS...........VRVFLILHL-
Q2VSI4_9GAMA/762-836-TFSPSNHCIVQV---------------RP.......ERGNNFKCLKFNHRGS.--TKT...........VRVFLTLHL-
Q99CY5_BHV4/763-837-KFLPTQGNIVQV---------------KP.......LKGSNFRCLTFNHRGK.--VPT...........VRIFLVFHI-
P88944_HHV8/764-838-AFTQQGENIIQL---------------RP.......RQGRHFLCINHNHKNK.--SKT...........VRVFLTLHS-
Q9WRP6_9GAMA/750-824-SFMHSGDNIIQV---------------KP.......QKGNNFFCINHKHRNH.--TQT...........VRVFLTLHS-
UL52_EHV2/804-878-KFIHTSHNIIQV---------------KP.......QRGNNFVCISSNHRNK.--TQS...........VRIFIVLYT-
Q80BM5_SHV2/758-831-SFAASTGNIIKI---------------I........SLSGNFSCLNFKHKLK.--TQS...........VRIFLSLHL-
UL52_EBVB9/765-838-TFEQTGPNLVQV---------------CH.......ARGRNFACLRHTHRAS.--SKN...........VRVFLVLYY-
Q993F9_9GAMA/764-837-TFEQTAANIVRV---------------CH.......PRGKNFKCLRYQHRNI.--ASS...........VRIFLVLHH-
UL52_HHV7J/781-857-TFLKIDHKNIQL---------------KKL....QNGKLSDFSCLTRNHKGN.--REN...........VLVYLEFKV-
UL52_HHV6Z/780-856-TFLKIDSKNLQI---------------KKT....QFGRVSDFSCLNRQHRGN.--RDN...........VLVYIQLKA-
UL70_MUHVS/882-959-VFTAVGRTCVAV---------------KRG....LYGRARDFSCLARETYTR.--QET...........VQVFLDIRG-
Q9DWD4_RCMVM/853-931-VFRAVRRDLLAV---------------KRD....DGGRGRDFRCLTTEHHFRW--RET...........VNVFLDLRA-
Q6RXG2_HCMV/857-934-LFQPHGACCVAV---------------KRR....DGARTRDFRCLNYTHRNP.--QET...........VQVFIDLRT-
UL52_EHV1B/999-1078-VVTKPDWILMQI---------------NRSG...NAYRSQGFSCLRAKHLRSA--RGL...........ARTFLSISA-
Q85229_SUHVK/871-942-VVAKPDWVLFQL---------------C.........GSARFSCLRARHARSP--P.............ARTFVALSV-
Q6X264_9ALPH/992-1072-VAAKDDWLLAQL---------------LPAR..ARGAAAQGFGCLRAAHGRAA--QNK...........ARSLVSLSV-
Q9E210_9ALPH/987-1065-IVVKRDWVLLQL---------------THCL...KTSGRQGFTCLRYPH.RGG--RTA...........PRNFISLRV-
PRIM_HHV2H/971-1049-AVIKDDWVLLQL---------------IPG....RGALNQSLSCLRFKHGRAS--RAT...........ARTFLALSV-
Q2QBC3_CHV16/959-1037-AVVQDDRALLQL---------------VPS....RGGLQQGLSCLRFRHGRSS--RAT...........ARTFLALSV-
Q9DGY9_MEHV1/991-1070-CVVRTDRILIHL---------------IPNT...TASRGRGFTCMRYKHTRSS--RTS...........ARSYLALNV-
PRIM_GAHVM/987-1066-CVVKSDWILLQL---------------IPNK...TIGYRHGFTCVRFKHARAR--RAS...........ARSYLALNV-
Q9YZA1_ILTV/984-1063-CVIRPDWILLQL---------------MANK...TLGRAHGFTCVRFKHTRTT--RMS...........SRSYLSLNI-
PRIM_PSHV1/1206-1288-IRVYEGRICAAL---------------RRGGAGYMSGRRSNFTCLKYQHRGAS--MQT...........VIASVVVAV-
Q98518_PBCV1/299-367-VIRTEHVYMF..---------------..........RHTSKYCANVEREHTS--SN..............AYFMVTK-
CC111_DANRE/373-436-YFACEQLLVYDI---------------E.........K..FRWCHNVKRFHKS--NN..............IIIVVDL-
Q5RFF3_PONAB/169-232-YFFPEELLVYDI---------------C.........K..YRWCENIGRAHKS--NN..............IMILVDL-
Q5CUI0_CRYPI/422-484-YFKEKELIIISV---------------S.........KL.NKLCFNIEREHIS--NG..............IKLIIDF-
Q69RL2_ORYSJ/445-506-WFSHYGLMIYSM---------------S.........R..SRYCEHIGREHKS--NH..............VMYIVEF-
Q9FLY1_ARATH/446-522-WFSEDGLIVYSM---------------L.........R..NRYCERIGREHKS--NHGTICSQPIYDIRVSMMYIVDL-
Q4CZS9_TRYCC/520-581-RQRGGRYLFFLL---------------D.........G..SRYCSNVGRQHLS--NN..............VYITVDL-
Q57Z42_TRYB2/507-568-RRCGDRYLLFML---------------K.........G..SRYCGNIGRQHRS--NN..............VYISVDL-
Q6XM41_9PHYC/473-542-QVEQDTMVIVAR---------------V........SGPGASYCMNKNREHGS--NH..............IYFWITP-
Q8QNM0_ESV1K/447-517-DVAVSNRYLVNV---------------A.........GVGSTFCMNKGSEHTS--NS..............VYFIITA-
YR008_MIMIV/300-362-GSSKEGYYNFNY---------------..........DNRTEKCPLSGVTHDS--NG..............FYVIEKS-
VG63_ICHVA/592-651-RLTP........---------------W.........MTRDRFCLVHNRIH.H--KAG.............VSVIVTN-
PRIM_ASFB7/285-359-CFLRVHKNLVLF---------------K.........RTSPSYCEICKRMHDK--DNT.............LILRVTG-

PF08800

Q89YW2_BACTN/54-177--------LNHEYFDTELLFVSPSGNGLKWIIPVDLKGWE.............---------------------------
Q8A2C0_BACTN/50-185--------KELPQT..YLAFIGSSGKSVKIWVRFTYPDNR.LPD........N---------------------------
Q8A9V6_BACTN/54-177--------CLLEYV..LGAFISISGRGVKLFIRIDIDGVNDY...........---------------------------
Q64Q18_BACFR/51-194--------EADEAT..LACFLTAKQHGFKILAYLTDLEAEAWRNSFFKTATIT---------------------------
Q8A059_BACTN/50-185--------AELPQT..MFAYMGSSGNSVKIWTLFTRPDGT.LPQ........T---------------------------
Q89ZT4_BACTN/53-190--------ALLPQT..FAAFCGSSGRSVKIWVRFALPDDRGLPE........K---------------------------
Q8A723_BACTN/63-205--------FDDPFLHPVLAFISPSNRGVKTFVPYSNLYTDDQSR........N---------------------------
Q8A429_BACTN/50-185--------EELSQT..YLAFMGSSGHSVKIWVRFTRPDKS.LPK........N---------------------------
Q8AAR0_BACTN/55-175--------.ADPHT..VAALESPTD.GVKIFAYVEGIE.GRH...........---------------------------
Q89Z67_BACTN/5-140--------SEQPQT..RCAFMGSSGKTVKIWTTFTRPDNS.LPK........T---------------------------
Q64NA7_BACFR/24-162--------AGLPQT..MITFVGSSGRSVKILVPFLRPDGS.LPA........T---------------------------
Q8A698_BACTN/63-188--------RALPYV..AYTQTSISDRGLKVVVFLDARTPEEY...........---------------------------
Q5LBN5_BACFN/54-177--------GALPYV..VGAFVSISGEGLKLIVRIDAENAGQY...........---------------------------
Q89YJ7_BACTN/32-167--------KRCDYT..RIAFISPKGMGVKIIVRACHPDET.LPE........T---------------------------

PF03090

Q56299_THIK1/42-167--------GLPAPN--LIVRNRQSGHSHLYYAIP.PVCTTET.---------A---------------------------
O30683_RHOER/28-164--------VGLVPN--MFAYSTRPGHGQATFLLRSPVSLSEA.---------S---------------------------
Q9FB48_CORST/95-244--------GNLGPS--WIGVNPTNGKCQLIWLID.PVYADSR.---------A---------------------------
Q45286_BIFLN/38-173--------GMR.PN--WIAENPANGHAHAGWVLTFPVPRTDL.---------A---------------------------
Q9RLE8_PLESH/25-159--------GAPAPT--LTIKNPDNGHAHLLYALNIAVRTAPD.---------G---------------------------
Q46060_CORGT/75-225--------LEKAPA--WIGVNPLSGKCQLIWLID.PVYAAAG.---------K---------------------------
Q9X539_CORGT/68-217--------RHLGPA--WVGINPVNGKCQALWLID.PIYADVG.---------G---------------------------
Q9XBN1_RHORH/15-151--------NHPMPN--AVIENSSNGHAHLHWWLREPFTRTEY.---------A---------------------------
P97024_BRELN/26-161--------KPWQPN--AVVENPANGHAHAVWALAEPVTRTEY.---------A---------------------------
Q51630_ECOLX/24-158--------NAPAPN--ITIKNPVNGHAHLLYALNIAVRTAPD.---------A---------------------------
Q9X743_HALEL/44-174--------GARATI--SRPRTPTTAR.HLIYGLDVACRTAPD.---------A---------------------------
Q9ZEX6_9PROT/31-170--------GLPPPN--IAVMNHRTKRGHLIYLLEAGVCRTEL.---------A---------------------------
Q50999_9ZZZZ/28-166--------NLPMPA--WAAINRENGGAHLAYALSAPVLTAEYG---------G---------------------------
O50474_PSESX/58-191--------GLPAPN--LMVRNRKSGHSQLFYAVP.SVCTTEN.---------A---------------------------
Q52148_9ZZZZ/53-189--------SHPLPN--AIVGNRANGHAHAVWALNAPVPRTEY.---------A---------------------------

PF01896

CC111_HUMAN/113-234........KFSQHL--IFQLHDVAFKDNIHVGNFLRKI..........................................
Q6BRU1_DEBHA/140-384........RRGAHC--WV.....SDNNARTLDEITRKSIVEYLDVLGSKQSKIGKKSLNL................KRPF
Q7Q633_ANOGA/117-350........RRGIHC--WV.....SDKAARHLDTAARSAIAMYLNLLISGGEGTASRVIIH.................DEM
YL207_MIMIV/130-315.......YHDGLHI--TYPYICTQPSLQFVMREEFIKLAKKYKIFQKIPLTNNLE.........................
PRIS_AERPE/96-277........NRGFHV--LA.....DCGWCRRLGREERREIARYFTLEGLRLELIIPRPGRRGVRPAPP...SPDDPGLRGW
PRI1_SCHPO/130-363........RRGIHA--WI.....CDEIACSLDDRSRRMIASYLQVVVGNPQGGVRLINNL................KRPL
O24984_HELPY/74-180........PGHLHL--YVHKGHTELGEGERLVKTL.............................................
PRIS_ARCFU/95-273........GRGYHV--HV.....HDEEFLSLGSAERREIVDYLRLNSPKIVVEDRFANSNAAKRVLNYLRKKLEEDERLT
VF184_IIV6/68-265........KKGIHL--HFPHLFLPKKDIKNS.................................................
O89045_RAT/110-337........RRGVHC--WV.....CDESVRKLSSAVRSGIVEYLSLIKGGHDVKKKVHLN..................EKV
O92381_NPVBM/75-223........NRGFHL--WL.....KFTDKFKITSAQNVRVHRYKAFEKPAKL.............................
PRI1_YEAST/110-344........RRGAHC--WV.....SDKRARALTDVQRRNVLDYVNVIRDRNTDKRLALKR...................PY
D5_FOWPN/70-218........KTSFHL--IFFNCYTTLDTLINM.................................................
PRI1_CAEEL/105-345........RRGVHC--WV.....GDKKARMLNNYQRSAIATRLNLFKKNGQCEVTEGRAKMTKV.........PPIVRDA
Y963_MYCBO/136-257........SKGLHL--YT.....PLDEPVSSRGATVL...........................................
P90220_NPVCF/74-220........NRGFHM--WL.....KFCGKFRVDAPKSLREHWFGMLNKPCKL.............................
P95226_MYCTU/141-261........SRGFHV--YA.....RIAPCWSFPQVRLA...........................................
VG63_ICHVA/354-534........FSARFT--WFPAYELCFQNIREAADF..............................................
Q07183_ASF/77-214GLNKKRELKYSFHI--ILYTYSVLNNNE....................................................
PRI1_DROME/126-364........RRGIHC--WV.....CDYQARHLDGRGRYAVAEYLNIITYASFAGGNSPRCSM...............GDRP
PRI1_PLAFK/129-377........RRGIHC--WV.....ADESCRYYTTDARAALADYLNILSGSDTKKKKVSIWG.................KDK
Q2UQ78_ASPOR/191-422........RRGAHA--WV.....CDPRARSLPDDRRRAIAGYLDLLRGGAQSGKRVNLK..................RPL
Q30YF6_DESDG/146-260........GNGAHA--WI.....FFAEPVPAREARQLGAALISHTC..................................
Q3IV37_RHOS4/113-247........ARGLHL--YI.....PVKDARDIPRIGKVLTDLLWLG...................................
Q3J300_RHOS4/693-814........GKGVHV--IV.....PLKPKAEWESVKLF...........................................
Q3JIW1_BURP1/809-930........GKGLHV--VV.....PLARHAGWDDVKAF...........................................
Q3M8I3_ANAVT/68-194........NNKGHA--YWLLDKASNDVAN...................................................
Q48H05_PSE14/694-815........GKGMHI--IV.....PLARQADWDTVKAF...........................................
B3ENE3_CHLPB/152-266........GNGAHI--WI.....FFADAIPARDARQLGAALISRTC..................................
Q4HD22_CAMCO/94-218........GKGVHL--YY.....FLQEPVQLYRNREEVLAEL......................................
Q4QB95_LEIMA/176-317........KASFHV--HTRLKDAAFAD.....................................................
Q4RJB1_TETNG/113-248........KFSRHL--IFNLKNAVFKDNVHVGRFIHAI..........................................
Q54MM7_DICDI/132-357........RRGLHI--WV.....SDRAAQHLTRENRASILNHIRVELSQNQIPI..........................
Q55SM0_CRYNB/116-353........RRGIHC--WI.....SDQSALDLTDDQRRALVTFLEVIKGGKEQSKKVNVRGPT.............GDAAL
Q58HZ4_FLDV/61-240......TIKQSFHL--HYPRIMMNVIEMQRLIQELKPECEIILGKDYLDPNSCRVCWF.....................I
Q5AJZ0_CANAL/124-362........RRGAHC--WV.....SDKRARELDETSRKAIIDYLDVLSSKNQNGSLNIKK...................PF
Q5CQA3_CRYPI/92-326........RRGVHC--WV.....CDTKARLLPSEARTAIIDYLTLVTGNENRKKKVNLKTSNN...........QNGIKS
Q5D505_9EURO/192-423........RRGAHA--WV.....CDARARNLPDDRRRAIAGYLDIVRGNTMSGKRVNMK..................RPL
Q5NVZ6_9ARCH/97-336........GRGYHV--HV.....RDERVRTLKSPERREIVDYLLGTGLEPDRMFIRTNQRIDTGT.......TSVAGVWL
YL794_MIMIV/91-220........KLSMHL--TVK..NILFDNWISMSKFF.............................................
Q5Z031_NOCFA/140-262........GKGLHV--YV.....RIAPQWSFTELRRA...........................................
Q5Z219_NOCFA/139-260........SKGIHL--YV.....PLDRVLSPGGASTV...........................................
A8XA78_CAEBR/105-345........RRGVHC--WV.....GDKKARMLTNNHRSAVATRLNLFKKNGQFEATEGKAKNTRV.........PPIVRDA
Q64S40_BACFR/156-274........GNGAHI--WT.....FFKEPIPSYKARKLGNTILTKAM..................................
LEF1_NPVOP/74-220........NRGFHL--WL.....KFCGKFKMDAPKSLREHWFNVFKQPAKL.............................
Q6CF04_YARLI/130-366........RRGAHA--WV.....SDKKARDLNDRQRSTVVSYIAAFGDATDKSAAGNSSL................RRPL
Q6CVI9_KLULA/134-371........RRGAHC--WI.....SDKRARVMTDSHRKNMLDYMNVVRDRNIEKRLNLVR...................PL
Q6FKQ9_CANGA/110-346........RRGAHC--WV.....SDKRARALNDIQRRNVLDYLNVVRDRNYDKPLSLKR...................PY
Q6MJT8_BDEBA/62-177........SKGFHI--LL.....NTKAIFGFIPDSDLFPPKQ......................................
Q6NVT9_XENTR/110-335........RRGVHC--WV.....CDDSARKLSQAERSAVAEYLSVVKGGEETIKKVQLS..................DPI
Q6R7G2_OSHVF/509-680PDPDQPKEKYGIHH--HVRLPDNVVMTTEVVGCIVNVLGQIRYLYPDTIGLFA...........................
PRIM_OSHVF/83-231........KHSFHL--VY.....PKIVFRNITQMRAF...........................................
Q6UIX7_9CAUD/107-235........LRGVHV--YC.....GVTNGADIPALAKRMQIEQW.....................................
Q6VTX2_NPVCD/72-223........NRGFHM--WL.....KFCGRFRMDSPKNVREHWFEVFKKPNKL.............................
Q6ZE74_SYNY3/161-274........SGGWHL--FM.....FFDRPVKTFPLACLLTETL......................................
Q75ER1_ASHGO/138-372........RRGAHC--WI.....SDPRARSLSDMQRKSVLDYMNVVRDRNLEKRISFTR...................PY
Q7AFI8_ECO57/139-253........RQGAHV--WI.....FFASRVSAREARRLGTAIISYTC..................................
Q7UJ06_RHOBA/82-191........SKGFHI--GLPTSLFDVEPSIEFGSV..............................................
Q7ZA55_COPCI/108-343........RRGIHL--WI.....SDVEAMELSDAQRKAIVGWMNVVNVGSRETSKKLNVRT..............ASKVL
Q7ZUR8_DANRE/110-336........RRGVHC--WV.....CDDAARKLSVAARSAVAEYLSLVKGGEETLRKVVLS..................DPI
Q81EV1_BACCR/73-211........SKGFHI--LISSDALGIEPRNDLHKI..............................................
Q82MG4_STRAW/134-256........GRGLHV--FV.....PIERRWTFTQVRRA...........................................
Q8MWR9_EUPCR/124-358........RRGVHC--WV.....CDPSTRKLTNEARSAIANYLTVHVGNEMGSTTAKID..................FVA
Q8QNM0_ESV1K/68-356SDGEIALTKNGYHV--IYPNLRINLSQALQLRYSVVNELEKTLGPRADGMNAWSDVIDRAPYTSGLKM.CGSFKRVKCTD
Q8SRD5_ENCCU/108-260........RRGVHC--WV.....FDDEALELSDLERGEIVKYYDSVAKKKKYPE..........................
PRIS_PYRAE/87-245........NRGFHI--HV.....SSEEVMKLGSRERRELVNYLKAVGFDPSRFIA.........................
Q92M95_RHIME/697-818........GKGVHV--IV.....PLRPHAEWEEAKGF...........................................
PRIS_THEVO/95-267........SRGYHV--HV.....SSEDVYPLGSDARREITDYVSGNSLSISVIDKALKTGEKRPGG.....WIKDVISKL
Q98518_PBCV1/74-236PKKKDDGVKVGVHL--TFDNIFVTSPTALHV.................................................
Q98DP8_RHILO/666-787........GKGYHV--LV.....PLKPSADWEAVKTF...........................................
Q9FJ26_ARATH/118-354........RRGVHC--WV.....CDAKARRLTNEQRSAVAEYFRVYKGNENNAKKVDLMG................HSLH
PRIS_THEAC/85-256........NRGYHV--HI.....SDDRVYRLGSDARREITDYITGNSLDETVVRRAIDMLGIASG......GWPAVVSKE
Q9ZC15_STRCO/150-270........SRGLHV--VV.....PLDGRQDFDDVREF...........................................

PF03121

PRIM_VZVO/1002-1075--------DHHNRL--CISLAQQCF........A----------------------------------------------
UL52_ALHV1/761-835--------KEETKL--IVTFMSQCF........A----------------------------------------------
Q2VSI4_9GAMA/762-836--------KPERKL--IVTFMSQCF........A----------------------------------------------
Q99CY5_BHV4/763-837--------IKEHEV--IITFMSQCF........A----------------------------------------------
P88944_HHV8/764-838--------IRVSEV--TVTLMSQCF........A----------------------------------------------
Q9WRP6_9GAMA/750-824--------TKESEV--TVTFMSQCF........A----------------------------------------------
UL52_EHV2/804-878--------NKKDEV--TITLMSQCF........A----------------------------------------------
Q80BM5_SHV2/758-831--------TPDNCV--TLTLMSQCF........A----------------------------------------------
UL52_EBVB9/765-838--------TS.QAI--TVTFMSQCF........A----------------------------------------------
Q993F9_9GAMA/764-837--------TS.GVT--TVTFMSQCF........S----------------------------------------------
UL52_HHV7J/781-857--------DN.NRI--LIILWSKCF........T----------------------------------------------
UL52_HHV6Z/780-856--------DG.NRL--ILILWSTCF........A----------------------------------------------
UL70_MUHVS/882-959--------DQRRNV--WATLWSRCF........T----------------------------------------------
Q9DWD4_RCMVM/853-931--------DRGGNV--WATLWSRCF........A----------------------------------------------
Q6RXG2_HCMV/857-934--------EHSYAL--WASLWSRCF........T----------------------------------------------
UL52_EHV1B/999-1078--------DVHGRL--CASISQQCF........A----------------------------------------------
Q85229_SUHVK/871-942--------DAHDRL--CISLSQQCF........A----------------------------------------------
Q6X264_9ALPH/992-1072--------DSHDRL--CASLIQQCF........A----------------------------------------------
Q9E210_9ALPH/987-1065--------DHHNRL--SVSLSQQCF........A----------------------------------------------
PRIM_HHV2H/971-1049--------GTNNRL--CASLCQQCF........A----------------------------------------------
Q2QBC3_CHV16/959-1037--------GARNGL--CVSLCQQCF........A----------------------------------------------
Q9DGY9_MEHV1/991-1070--------DAHGRL--CVCVIQQCF........A----------------------------------------------
PRIM_GAHVM/987-1066--------DAHGRL--CVCVIQQCF........A----------------------------------------------
Q9YZA1_ILTV/984-1063--------DAHGRL--CACVIQQCF........A----------------------------------------------
PRIM_PSHV1/1206-1288--------NSQGLP--YAALQTRCF........A----------------------------------------------
Q98518_PBCV1/299-367--------SG....--...MKQCCY........S----------------------------------------------
CC111_DANRE/373-436--------KE....--.EVWYQKCH........D----------------------------------------------
Q5RFF3_PONAB/169-232--------KN....--.EVWYQKCH........D----------------------------------------------
Q5CUI0_CRYPI/422-484--------YN....--.KRFYQKCF........D----------------------------------------------
Q69RL2_ORYSJ/445-506--------QR....--.AAYYQKCY........D----------------------------------------------
Q9FLY1_ARATH/446-522--------RR....--.GIYYQKCY........D----------------------------------------------
Q4CZS9_TRYCC/520-581--------QQ....--.RVWVQKCF........D----------------------------------------------
Q57Z42_TRYB2/507-568--------HC....--.GMWVQKCF........D----------------------------------------------
Q6XM41_9PHYC/473-542--------EG....--...IYQKCF........S----------------------------------------------
Q8QNM0_ESV1K/447-517--------SQ....--...CFQRCF........S----------------------------------------------
YR008_MIMIV/300-362--------SG....--...CFLKCY........S----------------------------------------------
VG63_ICHVA/592-651--------RR....--...IYPKCFHPDPPAHVI----------------------------------------------
PRIM_ASFB7/285-359--------NK....--...VYQHCR.......HD----------------------------------------------

PF08800

Q89YW2_BACTN/54-177-----------.......H....SRYFKAVTNC-----------------------------------------------
Q8A2C0_BACTN/50-185-----------REQAEVFH....AHAYRLAVKY-----------------------------------------------
Q8A9V6_BACTN/54-177-----------............PAIYEATAKL-----------------------------------------------
Q64Q18_BACFR/51-194-----------YDRLEQYH....AGIYELTRKH-----------------------------------------------
Q8A059_BACTN/50-185-----------QEEAEIFQ....AHAYRLAVKC-----------------------------------------------
Q89ZT4_BACTN/53-190-----------EAEAELFH....AHAYWLAVKC-----------------------------------------------
Q8A723_BACTN/63-205-----------VRESMSWAMEYVEMTYGSEMNN-----------------------------------------------
Q8A429_BACTN/50-185-----------REEAEIFQ....AHAYRKAVSL-----------------------------------------------
Q8AAR0_BACTN/55-175-----------............REGQLLVSRY-----------------------------------------------
Q89Z67_BACTN/5-140-----------REEAELFH....AHAYRLAVKC-----------------------------------------------
Q64NA7_BACFR/24-162-----------VEEARLFH....AHAYQWAVNF-----------------------------------------------
Q8A698_BACTN/63-188-----------............PLAYAICQQT-----------------------------------------------
Q5LBN5_BACFN/54-177-----------............AVAYPVVARE-----------------------------------------------
Q89YJ7_BACTN/32-167-----------LQEIEDFH....HAAYTRLVSF-----------------------------------------------

PF03090

Q56299_THIK1/42-167-----------RSKPIAYM----KTVYGGL...-----------------------------------------------
O30683_RHOER/28-164-----------RRKPINLL----ARCQQGLTVA-----------------------------------------------
Q9FB48_CORST/95-244-----------DSSNIRLM----KVVTTMLGEH-----------------------------------------------
Q45286_BIFLN/38-173-----------RLKPLKLL----HATTEGLRRS-----------------------------------------------
Q9RLE8_PLESH/25-159-----------RGRLLKYA----AAIENALRKK-----------------------------------------------
Q46060_CORGT/75-225-----------TSPNMRLL----AATTEEMTRV-----------------------------------------------
Q9X539_CORGT/68-217-----------QSPHMALL----AAATHTLGQW-----------------------------------------------
Q9XBN1_RHORH/15-151-----------RRKPLAYA----AAVTEGLRRA-----------------------------------------------
P97024_BRELN/26-161-----------RRKPLAYA----AAVTEGLRRS-----------------------------------------------
Q51630_ECOLX/24-158-----------SVKALKYA----AAIERALCEK-----------------------------------------------
Q9X743_HALEL/44-174-----------KTRPAS.A----TAVDCALRAL-----------------------------------------------
Q9ZEX6_9PROT/31-170-----------HLKPLRYI----ASIERVYTAV-----------------------------------------------
Q50999_9ZZZZ/28-166-----------RQKALRYL----AALEAAYKAK-----------------------------------------------
O50474_PSESX/58-191-----------RAKPIQYM----KAIYAAFAAR-----------------------------------------------
Q52148_9ZZZZ/53-189-----------RRKPLAYM----AACAEGLRRA-----------------------------------------------

PF01896

CC111_HUMAN/113-234...........LQPALDLL----GSED.....................................................
Q6BRU1_DEBHA/140-384HPHVERSFNILKQEFVNII----LEEQDPWFTSADSSSDSKAWEKVEELLAFMPDISLQEELRQKWKEQRT.....LSTS
Q7Q633_ANOGA/117-350HHSVRRAYRIVAPLFEEIC----LVDQNMFGKPEGVRKLLALVQDASVRAELEKRFKAVANDSKGV..............
YL207_MIMIV/130-315.SVFDEGVIYKTGWLLYGS----RKNENSYPYYVSHCFLSIRN.....................................
PRIS_AERPE/96-277IARAALERGVDLSAVHEAI----EDLLDDVRVA...............................................
PRI1_SCHPO/130-363HPHLTRSLNILKSAFVKIV----LEDQDPWASKEGAENLLKLLPDKDLASALRKKWEVDPERSSKN..............
O24984_HELPY/74-180...........SMKLAQGL----PKEWKVF..................................................
PRIS_ARCFU/95-273SKLKIKPADLKKEKLTKKV----IRAVEKFDYS...............................................
VF184_IIV6/68-265...........FMPVVKTM----IDQENVFQDFINSMDNQIMP.....................................
O89045_RAT/110-337HPFVRKSINIIKKYFEEYA----LVDQDILENKENWDKILALVPETVHDELQKGFQRFHSSPQR................
O92381_NPVBM/75-223.....DSDCIQPGSFAHCV----REAVRLYIPHMQDSNL.........................................
PRI1_YEAST/110-344HPHLARSLEQLKPFFVSIM----LEEQNPWEDDQHAIQTLLPALYDKQLIDSLKKYWLDNPRRSSKEK............
D5_FOWPN/70-218...........RKKLIVLT----KESNNRLVKA...............................................
PRI1_CAEEL/105-345FNVALKDGVFEKMIYDQGW----LDKEDFITEYKFMSEVGRDDLRSLSETYKTPQERWNMIRGLFD..............
Y963_MYCBO/136-257...........AKRVAQRL----EQAMPALVTSTMTK...........................................
P90220_NPVCF/74-220.....NSGEIKPGSFIYCV----RQAVEMYIDGADDK...........................................
P95226_MYCTU/141-261...........AQTVAREV----ERRLPDAATSRWW............................................
VG63_ICHVA/354-534...........TGVFQELL----MEEDSFFVYTVTND...........................................
Q07183_ASF/77-214...........AKAFTSKV----LENLPKHIYP...............................................
PRI1_DROME/126-364HHSLKRALKIVEPMFEEIV----LEDQNLFGTPKGVTKLLNMVHDDAARGELESYMQKNLEDGAHSRL............
PRI1_PLAFK/129-377YPMFERAFDICYKYFDVLM----EEQDFFKKGSPHVQKLIDYLPYASGKVTDPLKAMKLNELKEYINNNNFNSREIFEKF
Q2UQ78_ASPOR/191-422HPHMSRSLEILKPYFAQTT----LVDQDTFVSSEQAQRLLALLPDKALNDALRKKWESSPDRSSTN..............
Q30YF6_DESDG/146-260...........DRTRQLSL----TSYDRLFPNQ...............................................
Q3IV37_RHOS4/113-247...........DQGYVRIA----SNGARLLRSP...............................................
Q3J300_RHOS4/693-814...........SRALATHL----AQEAPDRYTATMAK...........................................
Q3JIW1_BURP1/809-930...........AHAVARHM----AATLPERFTATMGP...........................................
Q3M8I3_ANAVT/68-194...........FTQHQQQL----IKHYGS...................................................
Q48H05_PSE14/694-815...........AKAIAEFV----SRQLPERFTATMGP...........................................
B3ENE3_CHLPB/152-266...........ERTRQLSM----SSYDRLFPSQ...............................................
Q4HD22_CAMCO/94-218...........KEAFIRRL----WNDTSSIRP................................................
Q4QB95_LEIMA/176-317...........FYSLHGFL----FRFQDRLPNV...............................................
Q4RJB1_TETNG/113-248...........LQPILNTL----KAGRSHPGAA...............................................
Q54MM7_DICDI/132-357..LKRSFDQILLPHFEKCI----IEEQQIFTNEKQRKNFLSLLPISYKRQDRKITLTPSEDIEKKLKE............
Q55SM0_CRYNB/116-353HPFLSEALDTLKPLFSSLC----IYDQDCFKGEKGWEALLAILPTDRAVIGPLRAKWEKNSDSSSE..............
Q58HZ4_FLDV/61-240YGACKPGDDSYQIKYVFDS----SGKSDDFHKLL..............................................
Q5AJZ0_CANAL/124-362HPHVERSFEIVKKEFLNVI----LQEQDPWNTTSEETKAWKQVDELLAFIPNKALQIELKNKWKGQTFGS........TS
Q5CQA3_CRYPI/92-326HPFIDRCFNICMQYFDQIL----ENQQIFDHNSIHIEKVLNHLSEDTKVYQTVQNWIQKTSDFT................
Q5D505_9EURO/192-423HPHVSRSLEILKTYFRQTT----LDDQDTFLDPKQVERLLSLLPNKPLTDALRKKWDSAPGRSSAK..............
Q5NVZ6_9ARCH/97-336IRGFDSVPGGWDRRVARHI----VEKLDQIGRLPDKDAKEALRAFSLESKDVKRILHVARDPASL...............
YL794_MIMIV/91-220...........YGKFVYEW----NKHNEWINGN...............................................
Q5Z031_NOCFA/140-262...........ALAFAKEV----ERRAPDDVTTTWWR...........................................
Q5Z219_NOCFA/139-260...........AKQVATNL----EKLRPDLVTATMAK...........................................
A8XA78_CAEBR/105-345YNIAMKDGTFGEMVLEQGW----LENDDFLKDELLLTDKGKKELIENLEGYDTPEKRWHALRAMFD..............
Q64S40_BACFR/156-274...........KLNGRITF----DSYDRFFPNQ...............................................
LEF1_NPVOP/74-220.....VSGDIRPGSFADCV----RRAVHMYIGDARED...........................................
Q6CF04_YARLI/130-366HPHLQRCLDIATTVFNEVV----LQTQDPWANEEGSKFLLAFIPDEKLRRALAEKWKKNGDSASSA..............
Q6CVI9_KLULA/134-371HPHLSRSLEILKPHFVEII----LREQDTWRDDELAIKSLATSCHDKQLSEQLKKLWTNKPGRSSEEKW.........KD
Q6FKQ9_CANGA/110-346HPHLSRSLQILKGHFVDII----LEEQDPWRDDQHAIKTLLPAFTEKPVIEALRKYWTENPNRSSKAKW..........G
Q6MJT8_BDEBA/62-177...........QKDLVKKI----FSELVPSMSE...............................................
Q6NVT9_XENTR/110-335HPFIGKSLKMVERYFEKYA----LVDQDILENKQCWDKVVALVPEVARENLLREFSKARSSVE.................
Q6R7G2_OSHVF/509-680....GKKNYDVYDSCIYSI----KENDGSISTT...............................................
PRIM_OSHVF/83-231...........VLSFGHYL----FEEKHMMSLA...............................................
Q6UIX7_9CAUD/107-235...........AAGHGHVK----ISRSGALLVR...............................................
Q6VTX2_NPVCD/72-223.....AKGDIRPGNFAFSV----QQAVNMYMDQMPSGSD.........................................
Q6ZE74_SYNY3/161-274...........TSAGFSIE----PGHLEVFPNR...............................................
Q75ER1_ASHGO/138-372HPHLARSLNILKPYFVDFI----LREQDPWQDDSAAVRLLLPAIQDAQLADQLKKYWKENPGRSSEEK............
Q7AFI8_ECO57/139-253...........SRTRQLRL----GSYDRLFPNQ...............................................
Q7UJ06_RHOBA/82-191...........VRKLAEGL----TASVRVV..................................................
Q7ZA55_COPCI/108-343PPPLQDALEELVPIFSDLI----LGDQDSLASENGWETLLEFVPIPQVAERLRRKWSNDPDRSSDE..............
Q7ZUR8_DANRE/110-336HPFISRSLSVVEHYFPQYA----IVDQDILGNKESVDKVLALLPEDIKKDLIEYYQNHKEPMK.................
Q81EV1_BACCR/73-211...........FKHMAGYL----VHRLGLTS.................................................
Q82MG4_STRAW/134-256...........AIAAGREL----ERRMPDQVTTAWWK...........................................
Q8MWR9_EUPCR/124-358HPAISRAKDIIKEEFTDIM----MRGQNILSKEEQRKKLIEMLPEEEVRNHLKTNWDRYTDYEDQEN.............
Q8QNM0_ESV1K/68-356CKKADPTFKDKKKALLAEM----AKLRRKIFPREPGFDYTDLSDIHSDEFKDAVFGDKYGKYLDL...............
Q8SRD5_ENCCU/108-260..EYRRILRKYSSLLGDKD----LEDSELFEKM...............................................
PRIS_PYRAE/87-245.KLGRRKVVLYEEEAVGNL----LRIKQGVEDAR..............................................
Q92M95_RHIME/697-818...........AKALARSI----AERDPDNFVATMSK...........................................
PRIS_THEVO/95-267YELGINAEKISQKQIERAI----DQVKSHNATM...............................................
Q98518_PBCV1/74-236...........REKVLETL----VCEHNPFDNT...............................................
Q98DP8_RHILO/666-787...........AHDFAKAL----EQGAPDRYTATLSK...........................................
Q9FJ26_ARATH/118-354PFLARSYVDFIKSFFEGEL----QATQSIFSSKEKYEKILGMITDEDIQADLRGKWENSARSSLSEE.............
PRIS_THEAC/85-256LGEASPANQRRESDLRKAI----KRARENHSVL...............................................
Q9ZC15_STRCO/150-270...........ARAVADVL----AAAHPDRLTTAARK...........................................

PF03121

PRIM_VZVO/1002-1075-----------------------TK........-----------------------------------------------
UL52_ALHV1/761-835-----------------------NK........-----------------------------------------------
Q2VSI4_9GAMA/762-836-----------------------NK........-----------------------------------------------
Q99CY5_BHV4/763-837-----------------------NK........-----------------------------------------------
P88944_HHV8/764-838-----------------------SK........-----------------------------------------------
Q9WRP6_9GAMA/750-824-----------------------AK........-----------------------------------------------
UL52_EHV2/804-878-----------------------HK........-----------------------------------------------
Q80BM5_SHV2/758-831-----------------------SK........-----------------------------------------------
UL52_EBVB9/765-838-----------------------GR........-----------------------------------------------
Q993F9_9GAMA/764-837-----------------------GR........-----------------------------------------------
UL52_HHV7J/781-857-----------------------TK........-----------------------------------------------
UL52_HHV6Z/780-856-----------------------TK........-----------------------------------------------
UL70_MUHVS/882-959-----------------------RR........-----------------------------------------------
Q9DWD4_RCMVM/853-931-----------------------NK........-----------------------------------------------
Q6RXG2_HCMV/857-934-----------------------KK........-----------------------------------------------
UL52_EHV1B/999-1078-----------------------TK........-----------------------------------------------
Q85229_SUHVK/871-942-----------------------TK........-----------------------------------------------
Q6X264_9ALPH/992-1072-----------------------TK........-----------------------------------------------
Q9E210_9ALPH/987-1065-----------------------TK........-----------------------------------------------
PRIM_HHV2H/971-1049-----------------------TK........-----------------------------------------------
Q2QBC3_CHV16/959-1037-----------------------SK........-----------------------------------------------
Q9DGY9_MEHV1/991-1070-----------------------TK........-----------------------------------------------
PRIM_GAHVM/987-1066-----------------------AK........-----------------------------------------------
Q9YZA1_ILTV/984-1063-----------------------AK........-----------------------------------------------
PRIM_PSHV1/1206-1288-----------------------TK........-----------------------------------------------
Q98518_PBCV1/299-367-----------------------RKEEDV.GRK-----------------------------------------------
CC111_DANRE/373-436-----------------------PE........-----------------------------------------------
Q5RFF3_PONAB/169-232-----------------------PV........-----------------------------------------------
Q5CUI0_CRYPI/422-484-----------------------PD........-----------------------------------------------
Q69RL2_ORYSJ/445-506-----------------------PD........-----------------------------------------------
Q9FLY1_ARATH/446-522-----------------------PD........-----------------------------------------------
Q4CZS9_TRYCC/520-581-----------------------PD........-----------------------------------------------
Q57Z42_TRYB2/507-568-----------------------PE........-----------------------------------------------
Q6XM41_9PHYC/473-542-----------------------RKDAL..GSL-----------------------------------------------
Q8QNM0_ESV1K/447-517-----------------------KKSDIRSGGT-----------------------------------------------
YR008_MIMIV/300-362-----------------------KK........-----------------------------------------------
VG63_ICHVA/592-651-----------------------PE........-----------------------------------------------
PRIM_ASFB7/285-359-----------------------NKHSLLMGSL-----------------------------------------------

PF08800

Q89YW2_BACTN/54-177---------------------------------------IKATG...LPLVDM------SGSDVARS-------------
Q8A2C0_BACTN/50-185---------------------------------------YQPQL...PFDIEL------REPSLEQY-------------
Q8A9V6_BACTN/54-177---------------------------------------VSTVL...GVENDG------KCKDITHP-------------
Q64Q18_BACFR/51-194---------------------------------------YEKLL...QTEVDT------SGKDLSRG-------------
Q8A059_BACTN/50-185---------------------------------------YQPQI...PFDIQL------KEPVLEQY-------------
Q89ZT4_BACTN/53-190---------------------------------------YQPML...PYDINL------QAPVLTQK-------------
Q8A723_BACTN/63-205---------------------------------------SIETV...QKAVDT------SGKDIVRA-------------
Q8A429_BACTN/50-185---------------------------------------YQPIL...SYSIEL------KNPALEQF-------------
Q8AAR0_BACTN/55-175---------------------------------------YDQLT...GLTSDP------ACKDESRL-------------
Q89Z67_BACTN/5-140---------------------------------------YQPQI...PFDILP------KEPTLEQY-------------
Q64NA7_BACFR/24-162---------------------------------------YRGQLLPEHRDITL------ENPVPEQS-------------
Q8A698_BACTN/63-188---------------------------------------LERIA...GHPCDE------QCARITQP-------------
Q5LBN5_BACFN/54-177---------------------------------------LERVL...GHPCDM------SCRDLGRA-------------
Q89YJ7_BACTN/32-167---------------------------------------YTELC...RIEIDT------SGQDVART-------------

PF03090

Q56299_THIK1/42-167---------------------------------------.....---DFHSGP------VAKTPGHP.......WWLTHE
O30683_RHOER/28-164---------------------------------------LSGDP---HY.SGP------LARNPTHP.......MANTRW
Q9FB48_CORST/95-244---------------------------------------LGGDA---AF.AHR------LSRSPFYGGDDPTAYRWHVQH
Q45286_BIFLN/38-173---------------------------------------CDGDM---GY.SGL------LMKNPEHP.......AWASDI
Q9RLE8_PLESH/25-159---------------------------------------LGADA---GY.SGL------ICKNPNHL.......HWQITV
Q46060_CORGT/75-225---------------------------------------FGADQ---AF.SHR------LSRWPLHVSDDPTAYKWHCQH
Q9X539_CORGT/68-217---------------------------------------LGHDS---HF.AHR------FSRSPFYTGDSPTAYRWYRQN
Q9XBN1_RHORH/15-151---------------------------------------VEGDI---GY.SGL------MTKNPTHS.......GWDTHW
P97024_BRELN/26-161---------------------------------------VDGGK---GY.SGL------ITKNPTHE.......QWEASW
Q51630_ECOLX/24-158---------------------------------------LGADV---NY.SGL------ICKNPFHL.......EWQVME
Q9X743_HALEL/44-174---------------------------------------LDADQ---LC..GL------ICKNPLHP.......HWRVTE
Q9ZEX6_9PROT/31-170---------------------------------------LGADP---GY.AGL------ICKNPFND.......RWQVWE
Q50999_9ZZZZ/28-166---------------------------------------LRGDV---GF.VSL------ITKNPEHP.......HWLTLR
O50474_PSESX/58-191---------------------------------------LDADV---DYHGGP------VAKTPGHP.......WWETTE
Q52148_9ZZZZ/53-189---------------------------------------VDGDR---SY.SGL------MTKNPGHI.......AWETEW

PF01896

CC111_HUMAN/113-234........................................DDSA---PETTGH.......GFPHFS--------------
Q6BRU1_DEBHA/140-384KSKWEDINTIAKKTLKHQNQVNQLNEAKKDIIVYYMYPRLDIEV---SKQLIH......LLKSPFC--------------
Q7Q633_ANOGA/117-350.WKEFVAYFDELRMSGNSNRYRRFKFIVEEVTLAFTYPRLDINV---TKGFNH......LLKSPFC--------------
YL207_MIMIV/130-315.........................ELHDYIIPGD.....NLKS---RENIRH......FINTHSC--------------
PRIS_AERPE/96-277.......................................IDVKV---TQDISR......LARIVGS--------------
PRI1_SCHPO/130-363..KWSDIDTVLASGSIASISPSVIAIAKQDIVLTYLYPRLDVEV---SRHLNH......LLKSPFC--------------
O24984_HELPY/74-180........................................PSNE---WPKEFN......ILALPYE--------------
PRIS_ARCFU/95-273..................................ALSIYIDAPV---TADVKR......LIRLPGS--------------
VF184_IIV6/68-265.........................SSLIDDISSK.....YWLM---YGSSKE......GLNKPYK--------------
O89045_RAT/110-337....WEYLRKVASAPQNTKNDKCGPWLEWEIMLQYCFPRLDINV---SKGVNH......LLKSPFS--------------
O92381_NPVBM/75-223.............................DALTLQYWPDVDRDI---FCNVNK......QIRAPYS--------------
PRI1_YEAST/110-344WNDIDQIATSLFKGPKQDSHIIKLRECKEDLVLMTLYPKLDVEV---TKQTIH......LLKAPFC--------------
D5_FOWPN/70-218..................................I.....DTSV---YRHKPS.......LRIVGT--------------
PRI1_CAEEL/105-345..DDYRKSLSPKDGLLDFKMQGRDRNYLLYFVLQRCYPRLDVNV---STGTNH......LLKSPFC--------------
Y963_MYCBO/136-257...............................SLRAGKVFVDWSQ---NSGSKT......TIAPYSL--------------
P90220_NPVCF/74-220...............................SILHYWPDVDRDV---FCNASK......QIRAPFS--------------
P95226_MYCTU/141-261...............................KEEREGVFVDFNQ---NAKDRT......VASAYSV--------------
VG63_ICHVA/354-534...............................GVSTRVCAIDAQP---FCRNKS.......CRLPNS--------------
Q07183_ASF/77-214......................................FVDPQV---NKSIQN.......FRIIGS--------------
PRI1_DROME/126-364VWESFIKYANSMRTSTTSAWSRKLKNIVAEIQLGLLYPRLDINV---TRGFNH......LLKAPFC--------------
PRI1_PLAFK/129-377SSIYNFLTPSNYFKRKNVSGNINMPSFVKEIVFHFTYPRLDINV---SKEINH......LLKSPFC--------------
Q2UQ78_ASPOR/191-422..KWADIDSLAKTGKSSTLKTSTLREAKQDIVLEYTYPRLDSEV---SKKMIH......LLKSPFV--------------
Q30YF6_DESDG/146-260........................................DTMP---KGGFGN......LIALPLQ--------------
Q3IV37_RHOS4/113-247..................................I.....DSTV---WQPSRL......VFAAGAI--------------
Q3J300_RHOS4/693-814...............................AGRKGRIFIDWLR---NDRGST......AIAPYSL--------------
Q3JIW1_BURP1/809-930...............................RNRKGKIFVDYLR---NNRGAS......TIAAYSV--------------
Q3M8I3_ANAVT/68-194........................................DPAV---KDLPR.......IMRLPGF--------------
Q48H05_PSE14/694-815...............................KNRVGKIFIDYLR---NSRGGS......TVTAYSV--------------
B3ENE3_CHLPB/152-266........................................DTVP---KGGFGN......LIALPLQ--------------
Q4HD22_CAMCO/94-218........................................DSPD---ITGIYQ......GFRCVGS--------------
Q4QB95_LEIMA/176-317........................................DLQI---YRPNG.......MLRMFSC--------------
Q4RJB1_TETNG/113-248........................................DNGD---TRAPDS......CGGVPGT--------------
Q54MM7_DICDI/132-357IQDENLSNSEIWFAVKSYLEDNNLKEHLYNLVFHYTMPRIDEPV---TIGLDH......LLKSPFC--------------
Q55SM0_CRYNB/116-353.EKWRELMSEIAKHKKEEAIMTKFTKAVEDVVLQYTYPRIDAEV---SKHRNH......LLKSPFC--------------
Q58HZ4_FLDV/61-240..................................K.....DTLY---PRCFGETKNSCALIRFYLT--------------
Q5AJZ0_CANAL/124-362KEKWDDISTVASNVLKSNSQVAQLTEAKKDIIIYYMYPRLDVQV---SRQVIH......LLKSPFC--------------
Q5CQA3_CRYPI/92-326....CLEFWDFLSNTLQKSSDKSHLTLLKEIVFAYSYPRLDINV---SKDLGH......LLKAPFC--------------
Q5D505_9EURO/192-423..KWSDIDALARAGESNTLSSAALGEAKQDIVLEYTYPRLDSEV---SKKMIH......LLKSPFV--------------
Q5NVZ6_9ARCH/97-336..QKIREKGLIELSGNLEGFFRSILAGTIDQFKVSLAGKTDEPV---TADIKR......LIRLPGS--------------
YL794_MIMIV/91-220.....................................DLIDKQI---VKKRTS.......LRMVGS--------------
Q5Z031_NOCFA/140-262..............................RDRDPKLLFVDYNQ---NARDHT......IAAAYSV--------------
Q5Z219_NOCFA/139-260...............................AVRRGKVFLDWSQ---NNPAKT......TIAPYSL--------------
A8XA78_CAEBR/105-345..EDYRRKLGSENEFKDYHPQGRDRFALHTFVLQKCYPRLDVNV---STGTNH......LLKSPFC--------------
Q64S40_BACFR/156-274........................................DRLP---EGGFGN......LIALPLQ--------------
LEF1_NPVOP/74-220...............................LVLRYWPDVDRDV---FCNANK......QIRAPFS--------------
Q6CF04_YARLI/130-366.DKWSDIDKVASSGVSANLDTKRLVEAKQNVILTVFMPKLDGAV---SRGTGH......LLKSPFC--------------
Q6CVI9_KLULA/134-371MDVIASQLISSFPKQRQHDYLQRLRESKEDIIIQTLYPKLDVEV---TKQTIH......LLKAPFC--------------
Q6FKQ9_CANGA/110-346DIDTIASNLNITNKRQKEIMNNRLREAKEDLVLTTLYPKLDVEV---TKQTIH......LLKAPFC--------------
Q6MJT8_BDEBA/62-177......................................YLDDSI---FGTHR.......MMRAEYS--------------
Q6NVT9_XENTR/110-335.....RWDKLSSCLEATVKDLRRHSNIPKEIMLQFCYPRLDVNV---SKGLNH......LLKSPFS--------------
Q6R7G2_OSHVF/509-680.....................................NLANPNS---VKMKYH......GLRLPGQ--------------
PRIM_OSHVF/83-231.........................................FQK---KGKNRS......LGRAVFD--------------
Q6UIX7_9CAUD/107-235.....................................QLADALV---YQPSRL......MFESSPV--------------
Q6VTX2_NPVCD/72-223............................VCDLIVRYWPDVDRDV---FCNPNK......QIRAPFS--------------
Q6ZE74_SYNY3/161-274.......................................KQWKA---EGSIYN......RIRLPLQ--------------
Q75ER1_ASHGO/138-372WKDIDLLASGMTKQAKRPDYVARLREAKEDLILAILYPKLDVEV---TKQTIH......LLKAPFC--------------
Q7AFI8_ECO57/139-253........................................DTMP---KGGFGN......LIALPLQ--------------
Q7UJ06_RHOBA/82-191.......................................IDPSV---YGKVQP.......LRAPNS--------------
Q7ZA55_COPCI/108-343..KWADLKAEAREFDKNSPQRTQLMHAMEDIILHYTYPRIDAEV---SKHRNH......LLKAPFC--------------
Q7ZUR8_DANRE/110-336....RWDRLRQLVDHKKSSSKKGGQYYDKEIMLQYCYPRLDVNV---SKGVNH......LLKSPFS--------------
Q81EV1_BACCR/73-211.......................................LDLVV---YTEKR.......MIRLPNS--------------
Q82MG4_STRAW/134-256...............................EERGEKIFVDYNQ---TARDRT......IASAYSV--------------
Q8MWR9_EUPCR/124-358SVKLWNIFTEIAGDKGGKLRKSYRTDYVTSAMITFLYPRIDANV---SKGINH......LLKSPFC--------------
Q8QNM0_ESV1K/68-356..TGFNSCKMCLNTGKVMEKRTYMPCLVLDGGGDVDVSLLDVLR---EDYFEV......MKYTSIR--------------
Q8SRD5_ENCCU/108-260....................................YLRIDKEV---TQKTKH......LIKMPFS--------------
PRIS_PYRAE/87-245..................................AMKVEIDEVV---TQDIHR......LIRAPGS--------------
Q92M95_RHIME/697-818...............................AKRKGKIFIDWLR---NDRGAT......AIAPYST--------------
PRIS_THEVO/95-267.......................................VDAPV---TYDIHR......LIRMPQS--------------
Q98518_PBCV1/74-236...................................WDSIVDVSV---FKGSGM........RLPWS--------------
Q98DP8_RHILO/666-787...............................KARTGKIFVDYLR---NGRGST......TVAPYSS--------------
Q9FJ26_ARATH/118-354ATSLLRWEQLKKALQSKRNKALSLRTCVEEIVFTFTYPRIDLEV---SKQMNH......LLKAPFC--------------
PRIS_THEAC/85-256.......................................IDSPV---TYDIHR......IIRMPNT--------------
Q9ZC15_STRCO/150-270...............................KDRGDRLYLDIQR---NAYAQT......AVAPLTV--------------

PF03121

PRIM_VZVO/1002-1075-----------------------------------------------.CDSNR---------------------------
UL52_ALHV1/761-835-----------------------------------------------.CQSNK---------------------------
Q2VSI4_9GAMA/762-836-----------------------------------------------.CQSNK---------------------------
Q99CY5_BHV4/763-837-----------------------------------------------.CNSNK---------------------------
P88944_HHV8/764-838-----------------------------------------------.CNNNV---------------------------
Q9WRP6_9GAMA/750-824-----------------------------------------------.CNHNS---------------------------
UL52_EHV2/804-878-----------------------------------------------.CNSNK---------------------------
Q80BM5_SHV2/758-831-----------------------------------------------.CNSNK---------------------------
UL52_EBVB9/765-838-----------------------------------------------.CGANQ---------------------------
Q993F9_9GAMA/764-837-----------------------------------------------.CGSNR---------------------------
UL52_HHV7J/781-857-----------------------------------------------.CKSNS---------------------------
UL52_HHV6Z/780-856-----------------------------------------------.CQSNS---------------------------
UL70_MUHVS/882-959-----------------------------------------------.CNSNA---------------------------
Q9DWD4_RCMVM/853-931-----------------------------------------------.CQSNA---------------------------
Q6RXG2_HCMV/857-934-----------------------------------------------.CHSNA---------------------------
UL52_EHV1B/999-1078-----------------------------------------------.CGNNK---------------------------
Q85229_SUHVK/871-942-----------------------------------------------.CGSNA---------------------------
Q6X264_9ALPH/992-1072-----------------------------------------------.CGSNR---------------------------
Q9E210_9ALPH/987-1065-----------------------------------------------.CDSNR---------------------------
PRIM_HHV2H/971-1049-----------------------------------------------.CDNNR---------------------------
Q2QBC3_CHV16/959-1037-----------------------------------------------.CDSNR---------------------------
Q9DGY9_MEHV1/991-1070-----------------------------------------------.CGNNK---------------------------
PRIM_GAHVM/987-1066-----------------------------------------------.CGNNK---------------------------
Q9YZA1_ILTV/984-1063-----------------------------------------------.CGNNK---------------------------
PRIM_PSHV1/1206-1288-----------------------------------------------.CGSNE---------------------------
Q98518_PBCV1/299-367-----------------------------------------------YCLCSQ---------------------------
CC111_DANRE/373-436-----------------------------------------------.CRRQN---------------------------
Q5RFF3_PONAB/169-232-----------------------------------------------.CKAEN---------------------------
Q5CUI0_CRYPI/422-484-----------------------------------------------.CI..N---------------------------
Q69RL2_ORYSJ/445-506-----------------------------------------------.CQ..G---------------------------
Q9FLY1_ARATH/446-522-----------------------------------------------.CRG.V---------------------------
Q4CZS9_TRYCC/520-581-----------------------------------------------.CA..L---------------------------
Q57Z42_TRYB2/507-568-----------------------------------------------.CA..G---------------------------
Q6XM41_9PHYC/473-542-----------------------------------------------PCK..A---------------------------
Q8QNM0_ESV1K/447-517-----------------------------------------------TCA..D---------------------------
YR008_MIMIV/300-362-----------------------------------------------.CHGKS---------------------------
VG63_ICHVA/592-651-----------------------------------------------.....G---------------------------
PRIM_ASFB7/285-359-----------------------------------------------SGTTNF---------------------------

PF08800

Q89YW2_BACTN/54-177--------C-------FLPYDPQAYI-------------------------------
Q8A2C0_BACTN/50-185--------C-------RLTFDPELYF-------------------------------
Q8A9V6_BACTN/54-177--------C-------FGSYDPDAYY-------------------------------
Q64Q18_BACFR/51-194--------V-------FASYDPKAFY-------------------------------
Q8A059_BACTN/50-185--------S-------RLSHDPEPFY-------------------------------
Q89ZT4_BACTN/53-190--------C-------RMTLDESPYY-------------------------------
Q8A723_BACTN/63-205--------C-------FLSHDPQALF-------------------------------
Q8A429_BACTN/50-185--------C-------RQTYDPELYY-------------------------------
Q8AAR0_BACTN/55-175--------C-------YFTYSPDGYV-------------------------------
Q89Z67_BACTN/5-140--------S-------RLSYDPDIMY-------------------------------
Q64NA7_BACFR/24-162--------C-------RYSFDPGLFF-------------------------------
Q8A698_BACTN/63-188--------C-------SCVWDADAYY-------------------------------
Q5LBN5_BACFN/54-177--------C-------YASYDPEAYY-------------------------------
Q89YJ7_BACTN/32-167--------C-------LFSYDPEIYF-------------------------------

PF03090

Q56299_THIK1/42-167LHAHV...Y-------ELGELADYVD-------------------------------
O30683_RHOER/28-164CHPTP...Y-------ELRDLARALG-------------------------------
Q9FB48_CORST/95-244........H-------RVDRLSHLRD-------------------------------
Q45286_BIFLN/38-173IEWDT...Y-------DLEQLVQSLQ-------------------------------
Q9RLE8_PLESH/25-159WQPEL...Y-------TLDWLADYLD-------------------------------
Q46060_CORGT/75-225........D-------RVDRLADLME-------------------------------
Q9X539_CORGT/68-217........H-------AVRRVGDLLK-------------------------------
Q9XBN1_RHORH/15-151IHTEP...R-------SLAELEAELG-------------------------------
P97024_BRELN/26-161LTDHL...Y-------NLDELTEHLT-------------------------------
Q51630_ECOLX/24-158WREEA...Y-------TLDELADYLD-------------------------------
Q9X743_HALEL/44-174WSHG....C-------TIGDLDSWLD-------------------------------
Q9ZEX6_9PROT/31-170IHGNP...Y-------TLAELAAYVD-------------------------------
Q50999_9ZZZZ/28-166GVPDAIRGY-------DLEYLADFVD-------------------------------
O50474_PSESX/58-191FHSHI...Y-------ELGELASAVE-------------------------------
Q52148_9ZZZZ/53-189LHSDL...Y-------TLSHIEAELG-------------------------------

PF01896

CC111_HUMAN/113-234--------E.......APARQGFSFN............................KMF
Q6BRU1_DEBHA/140-384--------I.......HPGTGNVCVP............................FNP
Q7Q633_ANOGA/117-350--------V.......HPKTGKVCIP............................FNP
YL207_MIMIV/130-315--------R.......RFFSLNDLTPLA........................EGVDP
PRIS_AERPE/96-277--------L.......NGKAGLLVARLGLEG.................FHPGDWLSP
PRI1_SCHPO/130-363--------V.......HPGTSRVCVP............................IDI
O24984_HELPY/74-180--------V.......FAKERGSSWA............................KHL
PRIS_ARCFU/95-273--------L.......HGKTGLRVTE............................VED
VF184_IIV6/68-265--------ISK...ILDHNQQEISISKCFKSETCIDGSPITDTNVEFELPMLLSINP
O89045_RAT/110-337--------V.......HPKTGRISVP............................IDF
O92381_NPVBM/75-223--------Y.......NYKGTKFSRC............................ITK
PRI1_YEAST/110-344--------I.......HPATGNVCVP............................IDE
D5_FOWPN/70-218--------K.......KDSINIHVHKKTKQNIH.............FKNYLFTYVDY
PRI1_CAEEL/105-345--------I.......HPKTGNVAVP............................LNV
Y963_MYCBO/136-257--------R.......GRTHPTVAAP............................RTW
P90220_NPVCF/74-220--------Y.......NYKGGEYSRC............................LTQ
P95226_MYCTU/141-261--------R.......ATPDARVSTP............................LHW
VG63_ICHVA/354-534--------TKMEAGEFRGAFEYIKSYNALVKSNRGYSKMNIGISRSPVAFDRPSLGP
Q07183_ASF/77-214--------H.......KKGSMRVKMF............................NEE
PRI1_DROME/126-364--------I.......HPATGKVCVP............................FSV
PRI1_PLAFK/129-377--------I.......HNSTGRVCVP............................LDI
Q2UQ78_ASPOR/191-422--------I.......HPGTGRVCVP............................IDA
Q30YF6_DESDG/146-260--------K.......QPRELGRSIF............................VDE
Q3IV37_RHOS4/113-247--------C......ANGLEQRRGAP............................VIV
Q3J300_RHOS4/693-814--------R.......ARPGAPVATP............................VDW
Q3JIW1_BURP1/809-930--------R.......ARPGLGVSVP............................IAW
Q3M8I3_ANAVT/68-194--------N.......HMKGEPTLVTFIQTGKPYE.........SMASITDGLVSND
Q48H05_PSE14/694-815--------R.......ARPGLPVSVP............................IAL
B3ENE3_CHLPB/152-266--------K.......PARDKGFSVF............................VDD
Q4HD22_CAMCO/94-218--------Q.......SKLGVDFPVKAYKLSENRY..........TLEDIKASIPSC
Q4QB95_LEIMA/176-317--------M.......KENRTSAIIVFDESKWNIGFP......GGKVSDEQAALHSI
Q4RJB1_TETNG/113-248--------CGSPQAKRRKPEEHDLRF............................LLV
Q54MM7_DICDI/132-357--------I.......HPDTKKLCVP............................LDI
Q55SM0_CRYNB/116-353--------V.......HPGTGRVCVP............................INP
Q58HZ4_FLDV/61-240--------V.......MPQDKEPYLIGFK.....................NIKPKLI
Q5AJZ0_CANAL/124-362--------I.......HPGTGNVCVP............................FDP
Q5CQA3_CRYPI/92-326--------I.......HHSTGRLCIP............................IDT
Q5D505_9EURO/192-423--------I.......HPGTGRVCVP............................IDP
Q5NVZ6_9ARCH/97-336--------I.......HGGSSFRVTP............................LTR
YL794_MIMIV/91-220--------S.......KINGNKLVFKDD........................YCLKD
Q5Z031_NOCFA/140-262--------R.......GVPQATVSTP............................VRW
Q5Z219_NOCFA/139-260--------R.......GRAEPNAAAP............................RTW
A8XA78_CAEBR/105-345--------I.......HPKTGNVAVP............................LNV
Q64S40_BACFR/156-274--------G.......RARKAGNSVF............................VDE
LEF1_NPVOP/74-220--------Y.......NYKGGDYSRC............................LTQ
Q6CF04_YARLI/130-366--------I.......HPKTSNVCVPM..........................DVDS
Q6CVI9_KLULA/134-371--------I.......HPSTGNVCVP............................ITE
Q6FKQ9_CANGA/110-346--------I.......HPATGNVCVP............................IVD
Q6MJT8_BDEBA/62-177--------I.......NNKSGLYKTP............................LTL
Q6NVT9_XENTR/110-335--------V.......HPKTGRISVP............................IDT
Q6R7G2_OSHVF/509-680--------V.......KADGKKKLICVYRSD..................GLPCDAEI
PRIM_OSHVF/83-231--------M.......SPYTRDRLFRLMGQSKMG...........EPYENTLRPVKI
Q6UIX7_9CAUD/107-235--------L.......HDVTRDIPPDQ.........................AFVER
Q6VTX2_NPVCD/72-223--------Y.......NYKGGEFSRC............................LTQ
Q6ZE74_SYNY3/161-274--------S.......GTGSLMLTND............................GEL
Q75ER1_ASHGO/138-372--------I.......HPATGNVCVP............................ITE
Q7AFI8_ECO57/139-253--------K.......RPRELGGSVF............................VDM
Q7UJ06_RHOBA/82-191--------R.......HGKTGRHKRI............................LTF
Q7ZA55_COPCI/108-343--------V.......HPKTGRVCVP............................VDP
Q7ZUR8_DANRE/110-336--------V.......HPKTGRISVP............................IDL
Q81EV1_BACCR/73-211--------M.......HQKTNLFKTEISVNELNKLTLEEIKDLAKSPRHADDLPYTA
Q82MG4_STRAW/134-256--------R.......PRPHAPVSAP............................LRW
Q8MWR9_EUPCR/124-358--------V.......HPKTGKICVP............................FDP
Q8QNM0_ESV1K/68-356--------C.......QDGEKETRGFTIPKGVPRAPTEENGANMRSFSSKSLTHLGS
Q8SRD5_ENCCU/108-260--------V.......HPSTEMISVP............................IDV
PRIS_PYRAE/87-245--------L.......NGKTGLVALP............................ISL
Q92M95_RHIME/697-818--------R.......ARSGGPVATP............................VGW
PRIS_THEVO/95-267--------L.......HGKSGMMVKE............................VDL
Q98518_PBCV1/74-236--------AK....HDDPKRVYIPVVDYILDSENTGVVEEPLDNEEIVKSVSSVRNI
Q98DP8_RHILO/666-787--------R.......AKKGATVSMP............................VTW
Q9FJ26_ARATH/118-354--------V.......HPKTGRVCVP............................IDP
PRIS_THEAC/85-256--------L.......HGKSGLIVKE............................VEI
Q9ZC15_STRCO/150-270--------R.......ARPGAPVATP............................ISW

PF03121

PRIM_VZVO/1002-1075----------------MHTIFTLEVP-------------------------------
UL52_ALHV1/761-835----------------AMAHFSVFVD-------------------------------
Q2VSI4_9GAMA/762-836----------------PVAHFSVLMD-------------------------------
Q99CY5_BHV4/763-837----------------SIAHFSVIMA-------------------------------
P88944_HHV8/764-838----------------PTAHFSFVVP-------------------------------
Q9WRP6_9GAMA/750-824----------------PTAHFSFMVP-------------------------------
UL52_EHV2/804-878----------------PRAHFSIPLQ-------------------------------
Q80BM5_SHV2/758-831----------------CIAHMSVRVP-------------------------------
UL52_EBVB9/765-838----------------PTAHFSISVP-------------------------------
Q993F9_9GAMA/764-837----------------PVAHFSTNVT-------------------------------
UL52_HHV7J/781-857----------------KQVHSSVVLD-------------------------------
UL52_HHV6Z/780-856----------------KQVHCSIALE-------------------------------
UL70_MUHVS/882-959----------------KQTHLSLKIS-------------------------------
Q9DWD4_RCMVM/853-931----------------RRTHLTVKIS-------------------------------
Q6RXG2_HCMV/857-934----------------KNVHISIKIR-------------------------------
UL52_EHV1B/999-1078----------------MCTIFTLEVD-------------------------------
Q85229_SUHVK/871-942----------------TRTIFTAEVG-------------------------------
Q6X264_9ALPH/992-1072----------------LGTVFTVDLS-------------------------------
Q9E210_9ALPH/987-1065----------------MHTIFTLQLP-------------------------------
PRIM_HHV2H/971-1049----------------LHTLFTVDAG-------------------------------
Q2QBC3_CHV16/959-1037----------------LRTLFTVDAG-------------------------------
Q9DGY9_MEHV1/991-1070----------------LRTLFTVDVD-------------------------------
PRIM_GAHVM/987-1066----------------LRTLFTVDID-------------------------------
Q9YZA1_ILTV/984-1063----------------LRTLFTVDVD-------------------------------
PRIM_PSHV1/1206-1288----------------LQTQFTVTLS-------------------------------
Q98518_PBCV1/299-367----------------FRGDVIKLPK-------------------------------
CC111_DANRE/373-436----------------YRSSSFPLPQ-------------------------------
Q5RFF3_PONAB/169-232----------------FKSDCFPLPA-------------------------------
Q5CUI0_CRYPI/422-484----------------FKSRSFTVPE-------------------------------
Q69RL2_ORYSJ/445-506----------------YRSPLRPVPW-------------------------------
Q9FLY1_ARATH/446-522----------------YTILTHCLGK-------------------------------
Q4CZS9_TRYCC/520-581----------------YRCAPRAIPD-------------------------------
Q57Z42_TRYB2/507-568----------------YRGPPQPLPP-------------------------------
Q6XM41_9PHYC/473-542----------------YRSGCYKISR-------------------------------
Q8QNM0_ESV1K/447-517----------------YRSGGFAVPS-------------------------------
YR008_MIMIV/300-362----------------MHLGYVDETD-------------------------------
VG63_ICHVA/592-651----------------GFLDVVEVAG-------------------------------
PRIM_ASFB7/285-359----------------VETYVDQVMT-------------------------------

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window