Sequence alignment for CL0252

PF07290

YQIJ_ECOLI/4-205FADYNTPYLFAISFVLLIGLLEIFALICGHMLSGALDAHLDHYDSITTGHISQALHYLNIGRLPALVVLCLLAGFFGLIG
Q89LS4_BRAJA/9-213MAPEVRPFAIAAAMIVIVGSLEVVTMLVGASLSEMLGTSIDFS.HPSDNGVLNAISWINVGGVPLLIFLLLALGAFSITG
Q8Z3N3_SALTI/4-205FAEYNSPYLFAIAFVFFIGVLEMISLIFGHFLSGALDAHLDHYDALSSGPAGQALHYLNIGRVPALVVLCLLAGYFGLFG

PF01957

A9CFM6_AGRT5/13-153-------SWWIVGFVLLAAEL...IAPGV---------------------------FLIWIGLAALVIGVVSLFFWEA..
Q9Y9Y8_AERPE/348-492-------ILIIGGAILVFIELY..TPGFG---------------------------IIGGTGIAMLVFGVILLPIRGEGF
Q52729_RHIET/326-464-------GLILLGVGLTVAEAH..SPSFG---------------------------AFGIGGGVAVILGATILFDTDIPG
Q8ZYJ1_PYRAE/276-427-------ALIIMGAVLIMAEILMGMAAHG---------------------------AVAGVGAVLLIIGFLSAYPANFFS
Q9HJ87_THEAC/279-427-------LLLLMGSVLIILEA...KMGHG---------------------------FALLSGVVVGLIGTFLLASPYYSS
O28493_ARCFU/290-429-------LLIVLGVIFLFAELM..TPTYG---------------------------VLGAASVVSVVLGLLILFNEPLMP
Q8PVD3_METMA/290-434-------FLILVGAGLLILELN..SPGFG---------------------------IFGLAGLISLVIGSLFLVPLGEKN
Q8U0Q2_PYRFU/295-442-------LLIIVGMLFFVAEAL..TPTFG---------------------------LFTVAGLISFILGGILLFGGGNVE
Q9HTX9_PSEAE/12-149-------DWLAFGTVLLLLEI...FGAGG---------------------------YLLRVGLTAACVGALGALL.....
Q8P6T7_XANCP/7-144-------AWAVLALLLIAAET...LAPGA---------------------------FLLWMGIAAAAVCVLVLAV.....
Q9KD63_BACHD/294-444-------ILFIAGFLLILIEVF..MPGFG---------------------------LFGILGIAGMIGGMLLASFSTAWM
Q8YE00_BRUME/13-153-------NWLVFGLILLILEI...LAPGF---------------------------FFIWFGLAALVIGALAFLLSST..
Q9CME2_PASMU/11-149-------HWLILGFVLLIAEL...VIPGV---------------------------FLLWWGLAAIVIAGVMALI.....
Q92UL2_RHIME/331-469-------GLILLGAGLLVAEAH..APSFG---------------------------VLGLGGTVALVLGAAILFDTDMPG
Q8KE94_CHLTE/294-434-------LLILLAILFFGLEIF..VVSSG---------------------------ALAIAGLVALFIGSVMVFNQPELG
Q8RCN5_THETN/296-434-------LLVILGLVLLASEAF..VVSHG---------------------------ILAVGGIISFVLGSLMLFSGNQMG
Q9I667_PSEAE/298-439-------ALIALGLAFMVGEAF..VASFG---------------------------VLGIGGIVSFVVGALILIDTEVPG
Q98H58_RHILO/13-153-------NWMVLGFVLLVMEI...IAPGI---------------------------FMLWIGIAALIIGAVSLLIWDA..
P71767_MYCTU/6-144-------IWLIAALVLVGAEALTGDMFLL---------------------------MLGGGALAASVSSWLLAWPM....
Q98JI0_RHILO/328-465-------ALMLLGIAFLVIEAL..NPTV.---------------------------VLGVSGVAAFLFGAAMLLRVEGPG
Q8Y187_RALSO/320-464-------ALLALGLGCMVAEAF..LPTFG---------------------------ALGVGGIIAFILGAVMLIDTQTPG
Q8TS89_METAC/290-434-------FLIIVGIGLLILELN..SPGFG---------------------------IFGLAGIICLVIGSIFLVPLGSEN
Q97BG4_THEVO/281-429-------LLLILGSVLILLEA...KMGHG---------------------------FALLSGVVIGLVGTFMLASPYYSS
Q9F508_ECOLX/2-140-------FWFTLFLLCIALEIITGTGWLL---------------------------VISLGALSSAIVDFFLPIS.....
Q8NQA4_CORGL/8-145-------IWFIGALVLAGLELAVGEFTLL---------------------------MLGGAALATAGVALIGVPV.....
Q97K68_CLOAB/7-143-------IWIIIAIFMVVIDFGTSGFLFV---------------------------WFSAGAVVAIIAGLLGAP......
Q9CBM4_MYCLE/6-143-------VWLIFALVLACAEALTGDMFLL---------------------------MLGGGALASAVSGWLTDWPI....
O07404_MYCAV/6-144-------LWLIFALVLAGAEALTGHLFLV---------------------------MLGGGALAAALTSWLTDFPV....
O67682_AQUAE/286-425-------LLIVLGILFFVLELL..TPTFG---------------------------ALALGGAISILLGSLFLVEEGSPY

PF07290

YQIJ_ECOLI/4-205ILLQHACIMVWQS-PLSNLFVVPVSLLFTIIAVHYTGKIVAPWIPRDHS-SAI---TEEEYIGSMALITGHQA---TSGN
Q89LS4_BRAJA/9-213FLIQDVARMV.AG-PMPATVASIGAVAVSVPLVRAASRGIARVIPKDES-YVV---GLGDLVGRVGEVVIGPL---DQGP
Q8Z3N3_SALTI/4-205ILIQHGGIMLWQA-PLSNLLLVPLSIVLSVFAVHYSEKILAPWLPRDES-SAL---REEEFIGGMAIITGHAA---VAGT

PF01957

A9CFM6_AGRT5/13-153..............AFWAWQLQLVLFAALSVVFALLGRRYFGRNHATSD.EPFLNQREASLVGRTATLQ..EP...IVEG
Q9Y9Y8_AERPE/348-492AVGESYA.......KTLLYTTYALGATMGGLTAFVVYKV....VKAKRA.P..Q..TLWKLKGAVGEAV.DDI...PEGG
Q52729_RHIET/326-464...LEVS.......RPLLGAIAVATLAFSLVVARLAFTS....RFRQVA.TGA.....EEMIGISGKV...ES...WTGL
Q8ZYJ1_PYRAE/276-427GELIHIKD.....WWLIQLGLYIDIAIFLGFLSFVIYKIIILYKQRPPS.EFL.....TSLKGVEGVAI.DDI...GPES
Q9HJ87_THEAC/279-427NPGYSPSP.....FTTFDLLTSILIVIVAGFLAFYIRRIVRTFKFRGKW.TGA.....ESLIGKMGYA...VE...GIDE
O28493_ARCFU/290-429ESFYDAF.......PKFVAGMGIGLGGIMTFMIIKIAQI....RKKKSS.V.......GEVVGEKGEV...LE...FSNG
Q8PVD3_METMA/290-434IYTPEFT.......RLLVLAIVTPTVVIGLFLVYAVYKVAEIRKKKPVI.........GTIIGDTARTI.DAV...SPEK
Q8U0Q2_PYRFU/295-442...YLVSKDVFSQLRLIIIILGVIIALFFAFGMAAVIRA....HRRKAA.TGK.....EEMIGSEGTV...VE...ELNP
Q9HTX9_PSEAE/12-149..............PGLAWPWQVGLFVLLSGLVAALHRRRRRKAGSVEE.TPGLQRRGDDLFGRTFPLH..RA...IVGG
Q8P6T7_XANCP/7-144..............PGTSVLLQIVAFVVLSFVAIQVYRTWFRGKGRQSD.RPLLNRRAEQLIGRSVLLD..QA...IVDG
Q9KD63_BACHD/294-444LVSLGIS.......AVVTTVVAIITFRYFGSRGP.WKKMILTESTSSEK.GYITNETRQELVGLIGQS...LT...PLRP
Q8YE00_BRUME/13-153..............AGFGWQLQTVIFLVLAIVFTLAGRRFFGSKSNDTG.EPLLNRRGEQLVGQRATLT..EP...IVNG
Q9CME2_PASMU/11-149..............PSLSLTVLAISYAILAIILSVSWWKYQHGQDKSDQLHSSLNQRDHAMLGTRGTVQ..EI...AANG
Q92UL2_RHIME/331-469...LQVS.......WPALSGIAIASLAFSLLVARLALVS....RRHKVA.TGA.....EEMIGISGKV...DS...WAGA
Q8KE94_CHLTE/294-434...LVIN.......WWVFLPLFLSFSAGVLLLVFVVFRS....TRRKAI.SGR.....EGLVGETGTVE.RAI...GEGK
Q8RCN5_THETN/296-434...LTIN.......KGVVFATAFFMAAFVSFLLAAVIRA....QKRKVV.TGI.....EGMIGEFGTA...VT...DIAP
Q9I667_PSEAE/298-439...YGIP.......PGLVVALALLSAALIVGLLGMALRT....RRQAVV.SGT.....AGLVGSLATVAAVDS...EQPC
Q98H58_RHILO/13-153..............AIWTWQVQVLAFLALSLVSAYVGKKLMGGRDQPTD.QPLLNRRGAQMVGRMATLA..EP...IKDG
P71767_MYCTU/6-144..............WADGAVFLLVSVLLLVLVRPAVRRRLTQTKGVQLG.I.......EALEGKKAVVL..GR...VARD
Q98JI0_RHILO/328-465...FAMS.......WAVIGPAAALTLGLALLTGTYVWAA....RKNPPR.VGG.....DAMRGLPVEI...LD...WQGG
Q8Y187_RALSO/320-464...YGVP.......IPVIVGLAFVSLTVILALSSLAVRA....RRRPKV.SGG.....DTLIGMTGEVVDVDTPEADADS
Q8TS89_METAC/290-434IYTPEFR.......RLMILTIVTPTIVFGIFLVFAIYKVAETRKKKPVI.........GAIIGDTARTI.DPI...GPKN
Q97BG4_THEVO/281-429NPGYSPSP.....FTTFDLLTSILIVIVAGFLAFYIRRIVRTIKFRGRW.TGA.....ESLIGRSAKA...VS...NINS
Q9F508_ECOLX/2-140..............QEANICFFASISILTSIIKFVYDK.....KHKKLD.TPLVNTGHTRFKGKEFTLS..DD...IVNG
Q8NQA4_CORGL/8-145..............WAEFVTFAVASAALLMFIRPAIRKRLLKPKVLDSS.P.......RALVGHRAEVL..ED...VGAT
Q97K68_CLOAB/7-143..............ITVQIVLFAIISIALLSVGYPLSKKLLNRTVRKTP.LME.....EKYIGREVKAE..AD...MEVG
Q9CBM4_MYCLE/6-143..............WVDGTVFLIVSVLLLTLVRPAV.RRLTPALGTQLG.I.......KALEGKAALVL..DR...VARN
O07404_MYCAV/6-144..............WLNGTVFLVVSVLLLVVVRPPLRRRLTPAAMPQLG.I.......EALEGKTALVL..ER...VARD
O67682_AQUAE/286-425GEIP..........KQLIISVSIFSAIFFLGVGYLGLKA....QKRKKL.TGI.....EGMIGEEGEAI..VD...FKNG

PF07290

YQIJ_ECOLI/4-205PCEGKLTDQFGQIHYLLLEPE.EGKI-FTKGDKVLIICR....LSATRYLAENNPW
Q89LS4_BRAJA/9-213PGRVSVADVHGNRHFVWAVAAPASGP-LEQGTMVLLVDRAGTRFVAVKADDELKPS
Q8Z3N3_SALTI/4-205PCEGKFTDKFGQIHYLLLEPE.KGKE-FKKGDKVLIVCR....LSATRYLAERTFY

PF01957

A9CFM6_AGRT5/13-153RGRIRLDDTW------WPVNGED....LPAGTRVRIASARGRTLTIEPID------
Q9Y9Y8_AERPE/348-492TGFILVEGEY------WKAKAITP...VARGDKVVVVDKEGPYLVVKKAE------
Q52729_RHIET/326-464TGYVIAHGER------WKAVSAEP...LVAGDPVRVTGRNGLALEVTSRP------
Q8ZYJ1_PYRAE/276-427PGFVKVFGEY------WRAVSDTP...VRKGCRIRVVETIGDMLKVEPLQ------
Q9HJ87_THEAC/279-427KGWVSVDGIE------WQARSSNGS.RIPKGSRVKIVGRDGLILIVEKQE------
O28493_ARCFU/290-429RGFARVRGEI------WKVVSDEE...LEKGDEVEVIAREGLTLRVRKIG------
Q8PVD3_METMA/290-434AGFVRYKGEY------WKARSEEE...IEVDQEVEIIGKEREVLVIKRKV------
Q8U0Q2_PYRFU/295-442EGMIKVRGEL------WKARSKDGE.KIEKGEKVKVVGMEGLTLIVVRKK------
Q9HTX9_PSEAE/12-149LGELRVEDAS------WLVSGPD....LPRGALVRVTGQDGALLHVEPAA------
Q8P6T7_XANCP/7-144RGRAKVDDAF------WVVSGPD....LPAGALVRIVAVDGMTLQVQPNT------
Q9KD63_BACHD/294-444SGSGLFGEER------LDVVSEGG..YIEQGRKIKVVSTSGSRIVVRETD------
Q8YE00_BRUME/13-153HGRIHINDTT------WRVKGPD....LPAGTEIRIVAFDPVSLEIEVGL------
Q9CME2_PASMU/11-149IGRGHFGDTT------WRIQGTD....LQVGDLVEVHQVDGITLKVKKVN------
Q92UL2_RHIME/331-469DGYVIAHGER------WRAVSSES...LGPGEDVMVVGREGLTLKVARNA------
Q8KE94_CHLTE/294-434DGKVFVHGEL------WDASANGL...IPAGSQVTVTGIEGMRLMVKQNS------
Q8RCN5_THETN/296-434KGTVLVEGER------WQAVSKEP...IKKGEKVVIIGVEGLTLKVQKVK------
Q9I667_PSEAE/298-439AGWVLLQGER------WRVLAARP...LAVGQPVWVLARKGLLLEVALAD------
Q98H58_RHILO/13-153RGRIKLGDTL------WRVSGPD....LPAGTQVRVTSAADTDLELTVER------
P71767_MYCTU/6-144GGQVKLDGQV------WTARPLNDGDVFEPGDSVTVVQIDGATAVVFKDV------
Q98JI0_RHILO/328-465EGHVLALGER------WRAKAAEP...IVAGDSVEVTDISDLVLTVRRRD------
Q8Y187_RALSO/320-464DGWAHIRGER------WRVRCDAG...ITRGDRVRVIARHGLTLMVEPVA------
Q8TS89_METAC/290-434PGFVRYKGEY------WQAKAEEE...IGAEEEVEITGKEMEVLVVKRKI------
Q97BG4_THEVO/281-429HGWVSVDGIE------WQAKSNDGK.PINKGEPVKIVDRSGLVLIVERTN------
Q9F508_ECOLX/2-140KGQLLIGDTF------WPVETLHDE.NYPAGTRVIVTDMQGITLKVMTIE------
Q8NQA4_CORGL/8-145SGQVRLDGSI------WSARSMDPTHTFAEGEIVSVIDIQGTTAIVWKEA------
Q97K68_CLOAB/7-143NSKLKVDGIY------WTVKNVGE..AIKKGDCFIITGIQGNKLLIRKKG------
Q9CBM4_MYCLE/6-143EGQVKLDGQV------WTARTLSDDDVYEAGESVIVVHIDGATAMVFRNG------
O07404_MYCAV/6-144RGQVKLDGQV------WTARPLDENDVYEPGEPVTVMQIDGATAVVFKSS------
O67682_AQUAE/286-425RGKVFVHGEI------WDAVSEDD...IKKGDTVKVVGAKGLKLIVKKSS------

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window