Sequence alignment for CL0267

PF00411

RS11_SHIFL/19-128GVAHIHASF....NNTIVTITDRQGNALGWATAGGSGFRGSR.KSTPFAAQVAAERCADAVKEYGIKN---------LEV
RR11_MARPO/20-129GVIHIQASF....NNTIVTVTDIRGQVVSWSSAGACGFKGTK.KSTPFAAQTAAENAIRILIDQGMKQ---------AEV
RR11_EPIVI/28-135GVIHVQTSF....NNTIVAVTDIKGRVVSWSSAGTCGFKGTR.RGTSFAAQIAATNAIRIV..QGMQR---------AEV
RR11_EUGGR/19-128GIVHIKTTY....NNVLVSVSDPKGNVIAWSSSGACGFKSSK.KATPLATKTTTAIAVKKAIEQGLQK---------VEI
RT11_PROWI/18-127GIVHIQSTT....NNTLITLTDLEGNTQFFVSAGTLGFKNSR.KSTVYASGAAAEALASKAFNEGYRT---------IIV
RR11_PEA/28-137GVIYIQASF....NNTIVTVTDVRGRVISWSSAGSCGFKGTR.RGTPFAAQTAAGNAIQTVVEQGMQR---------AEV
RS11_HALMA/10-127GIAHVHASF....NNTIITITDQTGAETLAKSSGGTVVKQNRDEASPYAAMQMAEVVAEKALDRGVEG---------VDV
RT11_MARPO/15-124CITYIQSTF....GNTIITLTDYNGNTKTWSSSGSVGFKGSR.RSTNYAAQATAENAARVAIQLGFKF---------VEV
RR11_MAIZE/36-142GIIHVQASF....NNTIITVTDPQGRVVFWSSAGTCGFKSSR.KASPYAGQRTAVDAIRTV...GLQR---------AEV
RS11_GEOSE/19-128GIAHIRSTF....NNTIVTITDVHGNALAWASAGSLGFKGSR.KSTPFAAQMAAEAAAKASMEHGMKT---------VEV
RT11_ACACA/55-172NKKRYYLFFSKKRNNVFLTITDVIGRVVVSQSAGSCKITTKKKKRSPDTLKTVSASVAKIARAKNIKY---------LFK
RS11_SULAC/10-128GNARIYASQ....NNTIITITDITGAEIISKASGGMVVKADREKPSPYAAMLAANKAANDAFDKGISA---------IHI
RS141_MAIZE/27-145GVAHIFASF....NDTFIHVTDLSGRETLVRITGGMKVKADRDESSPYAAMLAAQDVAQRCKELGITA---------LHI

PF00861

RL5_YEAST/26-173GKTDYYQRK------------RLVTQHKAKYNTPKYRLVVRFTNKDIICQIISSTITGDVVLAAAYSH---------ELP
RL5A_XENLA/26-173GKTDYYARK------------RLVIQDKNKYNTPKYRMIVRVTNRDIICQIAYARIEGDMIVCAAYAH---------ELP
RL18_HALMA/10-130PMRRRREAR------------TDYHQRLRLLKSGKPRLVARKSNKHVRAQLVTLGPNGDDTLASAHSS---------DLA
RL5_STYCL/26-173GKTDYFARK------------RLVVQDKNKYNTPKYRMIVRFTNKDIVCQIAYARIEGDVVICAAYAH---------ELP
RL18_MYCPN/5-116TEQRRLRHK------------RIVKKIRATNHDNRVVLMVIKSLNHISVQAWDFSQNIVLASSSSLAL---------KLK
RL18_MICLU/5-119GKFNARTRR------------HLRVRKRISGTTSVPRLVVNRSARHMFVQVVDDTQSRTIAYASTMEA---------DVR
RL18_BORBU/7-119AEQRKLRRK------------KRIKDKIGRGVASRPRITVFKSNRYFYAQVIDDSKGHTIASISTI..---------.EK
RL51_ORYSJ/27-173GKTDYRARI------------RLTNQDKNKYNTPKYRFVVRFTNKDITAQIVYATIAGDIVMAAAYSH---------ELP
RK18_CYAPA/4-121TRKQATQRR------------HRRVRRKVFGTSERPRLAVFRSHQHIYAQIIDDTQHRTLAASSTLEP---------SVK
RL18_SYNP6/4-120SRRESTRRR------------HRRVRRTIVGTPARPRLSVFRSNNHIYAQVIDDAAGHTLAAASSLDP---------DLR
RL18_MYCGE/4-115NDKRRIRHK------------RIVKKIRLTNLNNRVVLIVIKSLKNISVQAWDFSKNVVLTSSSSLQL---------KLK
RK18_ODOSI/19-135KPNKYKQLK------------RESLRGLIKGTPERPRLSVFRSNENIYAQIIDDTNSKTLVSCSTLDR---------DIK
RL18_MYCTU/8-122TRRISRLRR------------HTRLRKKLSGTAERPRLVVHRSARHIHVQLVNDLNGTTVAAASSIEA---------DVR
RL18_VIBPR/1-117MDKKASRIR------------RATRARRKIAELGATRLVVHRTPRHVYAQVIASNGSEVIAAASTVEK---------AIR
RL18_HAEIN/1-117MDKKSARIR------------RAARARHMMREQGVTRLVIHRTPRHIYAQVIAPNGSEVLAAASTVEK---------AIR
RL18_SYNY3/4-120TRKSATQRR------------HRRLRRHLSGTSERPRLAVFRSNDHIYAQVIDDVAQHTLAAASTLDP---------DLK
RL18_ARCFU/12-132PLRRRREGK------------TNYRKRLKLLLSRKPRLVVRITNRRVIAQIVEYAPEGDRVVVGVDSA---------MLR
RL18_GEOSE/6-120DRNAVRKKR------------HARIRKKIFGTTERPRLSVFRSNKHIYAQIIDDTKSATIVSASTLDK---------EFG
RL18_SULAC/10-131KFRRRREGK------------TDYYTRYTYVINNAIRFVPRLTNKYVIVSVSKFDQKGDIMIAYAHSI---------ELV
RL18_HELPY/9-119KKKALRDRR------------KLRIKSKLLGDALRPRVSVFRSNRYFYAQAIDDVKQSTITHID....---------.GR
RL18_MYCCT/4-116TKTEARKRR------------HFRVRHKVVGTAERPRLNVFKSNTNFYAQIIDDTKGVTLVSASTLKM---------DLK
RL5_CAEEL/26-172GKTDYYARK------------RLTVQDKNKYNTPKYRLIVRITNKDVVAQLAYSKIEGDVVVASAYSH---------ELP
RL18_METTH/10-130AFRRRREGK------------TDYRARYKMVETGKSRLVVRITTYHVIAQIINVGMNGDETLVSAHSK---------QLQ
RL5A_SCHPO/26-173GKTDYYARK------------RLIAQAKNKYNAPKYRLVVRFSNRFVTCQIVSSRVNGDYVLAHAHSS---------ELP
RL18_STRCO/13-127YKRAAIKRR------------HIRIRKNLSGTAERPRLVVTRSNRHIVAQVIDDIKGHTLASASTLDT---------SIR
RL18_BUCAK/1-117MDKKSARIR------------RATRARRKLKELGATRLVVHRSPRHMYAQVIAPNGSEVLVAASTLEK---------AIT
RL5_DUNSA/26-173GKTDYRARL------------RLVRQDKNKYNTHKYRLVVRFSNKNVTCQIVYSTIQGDVVMAAAYSK---------ELP
RL18_BACSU/6-120SKNAARLKR------------HARVRAKLSGTAERPRLNVFRSNKHIYAQIIDDVNGVTLASASTLDK---------DLN
RL18_METJA/10-130KFRRRREAK------------TDYRKRLKLLLSRKPRLVARRTLNHCIAQIVLYDEKGDKTVVSAHSR---------ELI
RL18_AQUAE/6-124TRREKRLRR------------HKRIRKKVFGTPERPRLCVYRSLKHFYAQIIDDTIGHTLVSASTLDP---------EFE
RK18_PORPU/4-120NSKQTRIHK------------HRRVRKKVQGTASRPRLCVFRSNKHIYAQVIDDIKGITLVAASSINL---------KLQ
RL18_METVA/12-132PFRRRREGK------------TDFRQRLGLLLSGKPRLVARKSLNNIIAQLMAYDEKGDIVLVSAHSR---------ELV
RL18_CHLTR/7-123KKTSGKARR------------ALRVRKALKGCSLKPRLSVVKTNKHVYVQLIDDVEGKTLASISTLAK---------VAK

PF03464

ERF1_CAEEL/153-285KFGFIIMDGNGCLFGTLQGNTREVLHKFTVDLPKKHGRGGQSAVRFARLRNEKRHNYVRKVAENSVEQFI.....KNDKV
PELO_HUMAN/136-268DVAAVVMQEGLAHICLVTPSMTLTRAKVEVNIPRKRK.GNCSQH......DRALERFYEQVVQAIQRH........IHFD
PELO_METTH/136-256KAIILVMEDDVAELGLIRQYGVEYRGPITGHIPGKRI...QQRD.....RGKLRREFYESIVESLQKY...........G
PELO_AERPE/128-247TAVIAAVDYDEFALAVLAGHGMKILEDTSARLPGKDDPS..........REQEVEKYVDRAAKRIVEE........AARH
DOM34_YEAST/141-274DTAAVVLQEGIAHVCLVTSSSTILKQKIEYSMPKKKRT..TDVLKF....DEKTEKFYKAIYSAMKKD........LNFD
ERF1_STYMT/150-282KFGFIIVDGNGALYATLQGNSREILQKITVELPKKHRKGGQSSVRFARLREEKRHNYLRKVAELAGSNFIT....N.DKP
ERF1_GIAIN/150-287TFGFIIMDGKETLMATLSGTVRTILDRSTVDLPKKHGRGGQSSVRFARLREEARHNYVRKVAERANSLFISSGPTGTNKP
RF1_PYRHO/142-275AYGLITVEKNEATIGLLRGKRIELLDELTSNVPGKTRAGGQSARRYERIREQETHEFMKRIGEHANRAFLP....LLEKG
RF1_AERPE/142-276AIGIIIVERDQATIGLLKGARLEVLKELEGFVPGKHKMGGQSQRRYERIIEQMVDEFFKKVGEEASNLLVP....LAEKG
PELO_METJA/133-251KVLVVVMDDEEADIFEVRDYSIKEICSIKSHTSKKLD......YKIN...EELKKEYYHEIAKVLSE............Y
ERF1_TETTH/144-276PFGFIVMDGQGALYANLQGNTKTVLNKFSVELPKKHGRGGQSSVRFARLRVEKRHNYLRKVCEVATQTFI.....SQDKI
RF1_THEVO/143-274IYGLIVIDRKEATVGFLNGTRIEVVENVQSQVPSKHHQGGQSSRRFERLIEIAANEFFKKVGEIANNAFIP....R..IK
O96203_PLAF7/141-273KFGFIIVDGNGALFGTIQGNTREVIRRFTVDLPKKHGRGGQSALRFARLRLEKRHNYVRKVAEVATSVFIT....N.DKV
RF1_HALSA/147-278LYGLIVLDRRESNVGWLKGKRVQPVKSAESLVPGKQRKGGQSAQRFARLRLEAIDNFYQEVAGMADDLFV.....P.KRH
ERF1_TRYBB/146-278KFGFIVVDGSGTTYATLCGSVKEKLSSFTVELPKKHGRGGQSKNRFARIRMERRHNYLRKVAEGATQLFIT....N.DRP
ERF1_PODAS/146-278KFGFIVMDGNGALFGTLSGNTRDIVHKFSVDLPKKHGRGGQSALRFARLREEKRHNYVRKVAELAVQNFIT....N.DKV
PELO_ARCFU/130-243EIVMLTIEEGYAVAGVLRQWGVEEIFEERMGY.GK.GMG............DSRKEFFGEVAAKL............ESF
RF1_METTH/141-271TYGLAVLDRKEATIATLKGKRIDILKTLTSGVPGKHKAGGQSQRRFDRLIDLAAHEFLKRIGEHMNEAFL.......QID
PELO_THEVO/132-244VYLAIALDDDEANVFIIHPYGIQQMGTIYSGRSGKYSESSYSET...........SYFSAI.ENAIKQF...........
Q9ZT87_ARATH/136-268DLAVVLMQEGLAQIFLVGRSVTSSRARIETSIPRKHGP...AIAGYE........SALKKFFENVLQAFVK....HVDFS
PELO_DROME/136-268DVAAVVMQEGLAHVCLITASMTLVRSKIEVSIPRKRK.GSVQQH......EKGLAKFYEQVMQSILRH........VNFD
ERF1_BLEAM/145-277KFGFIIIDGNGTLFGTLQGNTKEVLHKFSVDLPKKHRRGGQSALRFARLRMESRNNYLRKVAEQAVVQFIS....S.DKV
YNU6_CAEEL/136-268DVAAVVLHEGLANVCLITPAMTLTRAKIDMTIPRKR.KGFTSQH..........EKGLEKFYEAVSTAFMR....HVNLQ
Q9BMX1_EUPAE/141-273TFGFVVVDGSGCLFGTLQGNSRTILQQISVSLPKKHGRGGQSAPRFGRIREEKRHNYVRKVAELSTQHFI.....TDDRP
PELO_HALSA/136-251DVAIATVEEGEAHIHVVQQYGVDEQGSFTATT.GK...GEQN........DRGRDELFGTLADALA............RM
P79004_SACPS/141-274DTAAVVLQEGISHVCLLTASSTILKQKTEISMPKKKDA..TDINKFN....EKTEKFYRATYNAMMKN........FNFD
DOM34_SCHPO/136-268EIGAVVLDEGLANICLITDYMTILRQRIDQVIPRKR.RGDSSAYQ......KGLDKFYDSVFQSINSE........FDFD
ERF1_SCHPO/142-274RFGFIVMDGHQTLYGVVSGSAREVLQRFTVDLPKKHGRGGQSALRFARLRDEKRHNYVRKVAEGAVQHFI.....TDDKP
PELO_PYRAB/135-257KVMIVAMEDGEAEVAIVREYGLDFIASIRHNI......GG...KRYNVKREDEEKKFFHDVAKTIKDL........IERE
RF1_ARCFU/136-267LYGLIVLDRREATVGLLKGKRIEVLDWDTSMVPGKHRQGGQSSVRFERLREIAIHEFYKKVGEMASEALLP....Y..KD
RF1_SULSO/138-272VYGLIIVERDEATIGLLKGARIEILEEIEGFVPGKHMMGGQSQRRIDRIIDEMYHNFLKEVGEKVNAYFMP....FVQNG
PELO_SULSO/129-242IIALVDFDEY..LIAIPFEQGIKILSEKSLR.PLNEEEGIIEQNAL.........EIATELAEYVKQY............
Q98RP4_GUITH/141-274KIAFIILDGKGALFGILAGNNKEILYKLNVNLPKKHGRGGQSALRFSRIRIEKRTNFIRKICELADQYYLS....DFNKN
PELO_THEAC/132-244VYTAVAMDEDEAQIFLIHPYGIQQVGTVYSGRSGKYAEGNYSEA...........SYFDQIVNALKNY............
RF1_METJA/141-274AYGVILVDRNEATIALVKGRNINILKKLTSGVPGKFKAGGQSARRLERLIDLAAHEFLQRVGQKANEQFLP....LLQEK

PF00411

RS11_SHIFL/19-128M---VKG........PGPGRESTIRALNA-------AGF---------------------RITNITDVTPIPHN.GCRPP
RR11_MARPO/20-129M---ISG........PGPGRDTALRAIRR-------SGI---------------------ILSFVRDVTPMPHN.GCRPP
RR11_EPIVI/28-135M---IKG........PGIGRDAVLRAIRG-------SGV---------------------LLTFVRDVTPMPHN.GCRPP
RR11_EUGGR/19-128N---ISG........PGTGRETALKCVQS-------LGL---------------------RISCIRDVTPLPHN.GCRPS
RT11_PROWI/18-127K---IKG........LGYGKKSAIRGLQK-------SNL---------------------VIKQIQEVTPIAHN.GCRPP
RR11_PEA/28-137R---IKG........PGLGRDAALRAIYR-------SGI---------------------LLKVIRDVTPLPHN.GCRAP
RS11_HALMA/10-127R---VRGPGGNLQTSPGPGAQATIRALAR-------AGL---------------------EIGRIEDVTPTPHD.GTRAP
RT11_MARPO/15-124R---IKG........LGYGKESSLRGLKL-------GGL---------------------IITKIRDVTPTPHN.GCRPP
RR11_MAIZE/36-142M---VKG........AGSGRDAALRAIAK-------SGV---------------------RLSCIRDVTPMPHN.GCRPP
RS11_GEOSE/19-128N---VKG........PGAGREAAIRALQA-------AGL---------------------EITAIKDVTPIPHD.GCRPP
RT11_ACACA/55-172F---FMN.....TNQTKIGK.TIFESFKK-------TGL---------------------FILQGVVVKNKSHGLLMRKK
RS11_SULAC/10-128K---VRAQGGYGSKTPGPGAQPAIRALAR-------AGF---------------------IIGRIEDVTPLPHD.TIRRP
RS141_MAIZE/27-145K---LRATGGNKTKTPGPGAQSALRALAR-------SGM---------------------KIGRIEDVTPVPTD.STRRK

PF00861

RL5_YEAST/26-173R.YGITHGLTNWAAAYATGLLIARRTLQKLGLDETYKGVEEVEGEYELTEAVEDGPRPFKVFLDIGLQRTTTGARVFGAL
RL5A_XENLA/26-173K.YGIKVGLTNYAAAYCTGLLLARRLLNKFGLDKVYEGQVEVTGDEYNVESIDGEPGAFTCYLDAGLTRTTTGNKVFGAL
RL18_HALMA/10-130E.YGWEAPTGNMPSAYLTGLLAGLRAQE........AGVE...................EAVLDIGLNSPTPGSKVFAIQ
RL5_STYCL/26-173R.YGVKVGLTNYAAAYCTGLLLSRRLLNKFGLDEIYEGQTEIDGDEFYVEDVDGKPGAFRAFLDVGLARTTTGAKVFGAM
RL18_MYCPN/5-116......NG..NKDNAKLVGQDIADKLVK........LKL.....................TNVVFDTGGSKYHGRIAALA
RL18_MICLU/5-119A.....LEGDKTAKAKRVGELVAERAKA........AGI.....................EAAVFDRAGNKYHGRVAAVA
RL18_BORBU/7-119S.LNLGKN...IDDVKKLGEVLAKRLKE........KNI.....................NNLIFDRNGYKYHGLIASFA
RL51_ORYSJ/27-173R.YGLEVGLTNYAAAYCTGLLLARRVLKLRGLDQEYEGNIEATGEDYYV.EPADERRPFRALLDVGLIRTTTGNRVFGAL
RK18_CYAPA/4-121N.SE.LSSTSTCAASAIVGQLIAKKALE........KGI.....................TQVVFDRGGKIYHGRVRTLA
RL18_SYNP6/4-120Q.S..LTSGGNQQASAAVGKLIAERAQA........KGV.....................TTVVFDRGGNLYHGRVKALA
RL18_MYCGE/4-115......NG..NKENAKLVGMDIATKLIK........LNQ.....................KDVVFDTGGSKYHGRIAALA
RK18_ODOSI/19-135L.N..IQNGRTCDASKLIGQKLAKLSLK........KNI.....................TKIVFDRGPYLYHGRIKALA
RL18_MYCTU/8-122G.....VPGDKKARSVRVGQLIAERAKA........AGI.....................DTVVFDRGGYTYGGRIAALA
RL18_VIBPR/1-117E.QV.KNTGNVDA.AKAVGKAIAERALE........KGV.....................ETVAFDRSGFQYHGRVAALA
RL18_HAEIN/1-117E.QV.KYTGNKDA.AAAVGKAVAERALA........KGV.....................QAVAFDRSGFKYHGRVQTLA
RL18_SYNY3/4-120K.S..LSSTATQEASAEVGKLVAQRAIA........KGI.....................NQVVFDRGGKLYHGRVKALA
RL18_ARCFU/12-132E.FGWKGDLNNTPAAYLTGILIAKKALQ........KG.I..................GEAVLDIGLHTPTRGSRVFAVL
RL18_GEOSE/6-120...LDSTN..NIEAAKKVGELVAKRALE........KGI.....................KQVVFDRGGYLYHGRVKALA
RL18_SULAC/10-131KKYGWKGDTNNTPAAYLTGYLAGLRAVK........SGVK...................AAVSDIGLFVPVKGGRIFAVI
RL18_HELPY/9-119K.MGFKNT...QEDAKKLGALFAEELKK........AGI.....................ERAVYDRNGYLYHGVVAAFA
RL18_MYCCT/4-116.....SKS..NIQAAEKVAEELTKKALA........ANI.....................NQVVFDRNGYLYHGKIKAFA
RL5_CAEEL/26-172R.YGLKVGLTNYAAAYATGLLLARRHLKTIGLDSTYKGHEELTGEDYNV.EEEGDRAPFKAVLDIGLARTTTGSKIFAVM
RL18_METTH/10-130K.MGWLGGTSNTAAAYLTGYLCGKRALK........EG.I..................EEAVLDIGLRPAIRGSKVFAAL
RL5A_SCHPO/26-173R.YGIKWGLANWTAAYATGLLVARRALAKVGLADKYEGVTEPEGEFELTEAIEDGPRPFKVFLDVGLKRTSTGSRVFGAM
RL18_STRCO/13-127...GGEAD..KSAQAKQVGALVAERAKA........AGV.....................EAVVFDRGGNQYAGRIAALA
RL18_BUCAK/1-117E.QL.KYSGNKDA.AAAVGKALAERALE........KGI.....................AKVSFARSGFQYHGRVQALA
RL5_DUNSA/26-173N.YGLKVGLTNYSAAYCVGLLVARRILTKLNLADTYKGQEEPDGEDYNVEPVEDGPKPFYCLLDTGLKRTSTGSKVFAAM
RL18_BACSU/6-120...VESTG..DTSAATKVGELVAKRAAE........KGI.....................SDVVFDRGGYLYHGRVKALA
RL18_METJA/10-130K.LGYKGHTGNLPSAYLTGYLLGKKALA........KG.Y..................TEAVLDIGLHRATKGNAIFAIL
RL18_AQUAE/6-124K.ITGKRGGKSIKDAEVVAEIIARRALE........KGI.....................KKVVFDRGGFKYHGKIKAFA
RK18_PORPU/4-120S.SITLGS..NCEASRSVGKTLAERSIK........EGI.....................ENVVFDRGGKLYHGRVEALA
RL18_METVA/12-132K.MGYKGHCGNLPAAYLTGLLLGKKAVE........EG.L..................EEAILDKGLHRATKGAAIFAVL
RL18_CHLTR/7-123T.SGLTRK..NQDNAKALGIKIAELGKG........LQV.....................DRVVFDRGAHKYHGVVAMVA

PF03464

ERF1_CAEEL/153-285TVAGLILAGSADFKTELGQSDMFDQRLQA........KM---------------------IK.TVDIAYGGENGFNQAIE
PELO_HUMAN/136-268VVKCILVASPGFVREQFCDYLFQQAVKTDNKLLLENRSK---------------------FL.QVHASSGHKYSLKEALC
PELO_METTH/136-256DLETIIIAGPGFYKSDFYDYLMERYPEIA........KK---------------------AV.LENTGTGGRAGISEVLR
PELO_AERPE/128-247RSPIAVIAGPGQLKTSVAEKVQRAMPSLK..........---------------------.VATVDTSMGGVAGVREALR
DOM34_YEAST/141-274KLKTIILCSPGFYAKILMDKIFQYAEEEHNKKILDNKGM---------------------FF.IAHCSTGYLQGINEVLK
ERF1_STYMT/150-282NVTGLVLAGNAGFKNELSETDMLDKRLLP........II---------------------VS.IVDVSYGGENGLNEAIT
ERF1_GIAIN/150-287IVSGLILGGSADFKNVLSTSAIFDQRLQS........IV---------------------MK.QIDINYGGEQGFNQAIE
RF1_PYRHO/142-275ELKGIIIGGPGPTKEEFVEGEYLHHELKK........KI---------------------LG.VVDISYHGEYGLRELVE
RF1_AERPE/142-276VLKGVIVAGPGLAKQEFVEGNYLDYRLK........KIL---------------------APELVDVAYQGLQGLKEAVM
PELO_METJA/133-251DVDNILVAGPGFAKNSFYNFISSQYPELK......NK..---------------------.IVVESISTTSRAGLNEVIK
ERF1_TETTH/144-276NVQGLVLAGSGDFKNELSTTQMFDPRLAC........KI---------------------IK.IVDVSYGGENGLNQAIE
RF1_THEVO/143-274EIRAIFLGGPGATKEYFFEKDYLRNEVKD........KI---------------------KD.LFDVGYTDESGLRELVE
O96203_PLAF7/141-273NVTGIVLAGSADFKNDLLNSDMFDQRLFA........KV---------------------IK.IVDISYGGDNGFNQAIE
RF1_HALSA/147-278EIDGILVGGPSPTKDEFLDGDYLHHELQD........KV---------------------LG.KFDVSYTDESGLSDLVD
ERF1_TRYBB/146-278NIVGLVLAGSAEFKEVLYQSDLFDPRLK........AIV---------------------VK.VVDVAHPGDVGLNQAID
ERF1_PODAS/146-278NVMGIVLAGSADFKNDLNASDMFDQRLAT........KV---------------------IK.VVDVSYGGENGFNQAIE
PELO_ARCFU/130-243DFKYLIVAGPGFAKNDFLDFLKERYPEMA......KN..---------------------.AVVVDVSSVGSRGFIEILK
RF1_METTH/141-271DLKGIILGGPGHTKEEFLNGDYLHHELKK........KV---------------------IT.TVDTSYTGEFGIREVID
PELO_THEVO/132-244.KYPIIVIGPGFAKNGL..SAFLKER..........NYK---------------------VVAVSSSNRTDQGAIYEFIS
Q9ZT87_ARATH/136-268VVRCAVVASPGFTKDQFHRHLLLEAERRQLRPIIENKSR---------------------II.LVHTNSGYRHSLGEVLH
PELO_DROME/136-268VVKCVLIASPGFVRDQFYDYMFQQAVKMDYKLLLDNKSK---------------------FM.LVHASSGFKHSLREILQ
ERF1_BLEAM/145-277NVAGLIIAGSAEFKNVLVQSDLFDQRLAA........KV---------------------LK.IVDVAYGGENGFTQAIE
YNU6_CAEEL/136-268VVKCVIVASRGFVKDAFMQHLIAHADANGKKFTTEQRAK---------------------FM.LTHSSSGFKHALKEVLE
Q9BMX1_EUPAE/141-273NVKGLILAGSANFKNDLSGSDLFDKRLAE........VV---------------------IK.IVDVSYGGENGFSQAIS
PELO_HALSA/136-251QADAIILAGPGFTKQDALDHITEEYPDLQ........ET---------------------IT.MVDTSAVGGRGVHEVLK
P79004_SACPS/141-274ELRMIILCSPGFYAKALMEKILKYAEKEQNNSILENQEM---------------------FI.IAHCSTGYLQGITEVLR
DOM34_SCHPO/136-268KLKVVILASPGFVARGLYDYIFSMAVKLDLKQIVKSKNK---------------------FV.ILHSSTGHIHSLNEILK
ERF1_SCHPO/142-274NVAGIVLAGSADFKTELGQSDLFDQRLQS........RI---------------------IK.TVDVSYGGDAGFNQAIE
PELO_PYRAB/135-257NVQKVIVAGPGFYKENFYGFLRENYPELA......GK..---------------------.VVLDDTSMGGRVGVYEVIK
RF1_ARCFU/136-267KLIGILIGGPSPTKEEFYEGEYLHHELQK........KV---------------------LG.LFDVGYTDESGLYELVE
RF1_SULSO/138-272KMKGVLLGGPGYAKEDFYKEDYVDYRIKN........LI---------------------LQPLIDVSDQGEVGLREMIM
PELO_SULSO/129-242DPDAILLAGPGFFKEEVSKKVNAILK..........NKK---------------------IY.IDSVSSATRAGLHEVLK
Q98RP4_GUITH/141-274FIEGLVIAGPADLKNELISSELFNEKLRE........KI---------------------LS.IIDISYGGEIGFNKAIE
PELO_THEAC/132-244.SNSIIILGPGFARDRFARYCAQR............GVN---------------------VIGSFPANRTDSGAVYEFIT
RF1_METJA/141-274KLRGILVGGPGHTKNEFVEGDYLHHELKK........IV---------------------LD.TFDLCYTEEFGIRELLE

PF00411

RS11_SHIFL/19-128KKRR------
RR11_MARPO/20-129RKRR------
RR11_EPIVI/28-135KKRR------
RR11_EUGGR/19-128KRRR------
RT11_PROWI/18-127KKRR------
RR11_PEA/28-137KKRR------
RS11_HALMA/10-127KNS.------
RT11_MARPO/15-124KKRR------
RR11_MAIZE/36-142KKRR------
RS11_GEOSE/19-128KRRR------
RT11_ACACA/55-172KAKR------
RS11_SULAC/10-128GGRR------
RS141_MAIZE/27-145GGRR------

PF00861

RL5_YEAST/26-173KGASDGGLYV
RL5A_XENLA/26-173KGAVDGGLSI
RL18_HALMA/10-130EGAIDAGLDI
RL5_STYCL/26-173KGAADGGLDI
RL18_MYCPN/5-116EAARERGLNF
RL18_MICLU/5-119DGAREGGLQL
RL18_BORBU/7-119TSLREFGINI
RL51_ORYSJ/27-173KGALDGGLDI
RK18_CYAPA/4-121EAAREAGLQF
RL18_SYNP6/4-120EAAREAGLEF
RL18_MYCGE/4-115EGARAKGLNF
RK18_ODOSI/19-135DGAREGGLQF
RL18_MYCTU/8-122DAARENGLSF
RL18_VIBPR/1-117ESAREAGLKF
RL18_HAEIN/1-117DAAREAGLQF
RL18_SYNY3/4-120EAAREAGLNF
RL18_ARCFU/12-132RGAVEGGLEV
RL18_GEOSE/6-120DAAREAGLEF
RL18_SULAC/10-131KGAIDAGLKV
RL18_HELPY/9-119ESLRENGIAL
RL18_MYCCT/4-116QKARENGLKF
RL5_CAEEL/26-172KGVADGGINV
RL18_METTH/10-130KGAVDAGLNV
RL5A_SCHPO/26-173KGASDGGLFI
RL18_STRCO/13-127DAAREAGLKF
RL18_BUCAK/1-117DAAREAGLQF
RL5_DUNSA/26-173KGALDGGLDI
RL18_BACSU/6-120DAAREAGLKF
RL18_METJA/10-130KGALDAGMEI
RL18_AQUAE/6-124DKCREMGLEF
RK18_PORPU/4-120EAAKEAGMVF
RL18_METVA/12-132KGALDAGMDI
RL18_CHLTR/7-123DGAREGGLQF

PF03464

ERF1_CAEEL/153-285L..AADTLAS
PELO_HUMAN/136-268DPTVASRLSD
PELO_METTH/136-256KGTVERVSSE
PELO_AERPE/128-247RESVTRILRE
DOM34_YEAST/141-274NPLYASKLQD
ERF1_STYMT/150-282L..SADALTN
ERF1_GIAIN/150-287M..AGDTLKD
RF1_PYRHO/142-275K..ASDILRD
RF1_AERPE/142-276K..AEKVVEA
PELO_METJA/133-251RGIINRIYAE
ERF1_TETTH/144-276L..AQESLTN
RF1_THEVO/143-274K..ASESIKD
O96203_PLAF7/141-273L..SSEALQN
RF1_HALSA/147-278A..GQAALAE
ERF1_TRYBB/146-278L..AADALSG
ERF1_PODAS/146-278L..ASETLGN
PELO_ARCFU/130-243RRVVDKIVGE
RF1_METTH/141-271K..SMDVLSE
PELO_THEVO/132-244SEDGKKLISK
Q9ZT87_ARATH/136-268APNVMNMIKD
PELO_DROME/136-268DPAVLAKMSD
ERF1_BLEAM/145-277L..SADTLSN
YNU6_CAEEL/136-268TPQVALRLAD
Q9BMX1_EUPAE/141-273L..AEDALSN
PELO_HALSA/136-251RGAVEDVQEE
P79004_SACPS/141-274DPEYSTVLQN
DOM34_SCHPO/136-268DPAVESKLAD
ERF1_SCHPO/142-274L..AADTLSN
PELO_PYRAB/135-257RGTVDKVYTE
RF1_ARCFU/136-267K..AKDVLQE
RF1_SULSO/138-272K..AEDLLKN
PELO_SULSO/129-242RDIIDKIMTD
Q98RP4_GUITH/141-274N..SSSVLDQ
PELO_THEAC/132-244SADGAKLLSN
RF1_METJA/141-274K..AAPLLKD

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window