Sequence alignment for CL0270

PF00180

LEU3_BACMD/4-351-----KVAVLP--------------GDGVGT---EVTKGAVAVL--KAIGERFD...H---------QFEFTYGLIGGAA
LEU3_SPIPL/6-355-----RITLLS--------------GDGIGP---EIMAVAVDVL--KAVGKQLD...L---------NFEFKEALMGGVA
LEU3_BACSU/4-352-----RIALLP--------------GDGIGP---EVLESATDVL--KSVAERFN...H---------EFEFEYGLIGGAA
LEU3_ECOLI/6-355-----HIAVLP--------------GDGIGP---EVMTQALKVL--DAVRNRFA...M---------RITTSHYDVGGAA
IDH1_COLMA/28-411-----IIPYIE--------------GDGIGV---DVTPPMLKVV--NAAVAKAYGGDR---------KIEWLEVYAGEKA
IDHC_SOYBN/8-403-----KVANPI--------------VEMDGD---EMTRVIWKSI--KDKLILPF...L---------ELDIKYYDLGLPY
LEU3_AGRT5/5-361-----SLFLLP--------------GDGIGP---EAMTEVRKLI--EYMNSAHN...A---------GFTVSEGLVGGSA
LEU3_CANBO/7-356-----KIVLLP--------------GDHVGV---EVVEEAVKIL--KSISEVKP..EI---------QFKFENHLIGGAA
IDH3A_BOVIN/33-358-----TVTLIP--------------GDGIGP---EISAAVMKIF--DAAK..AP....---------.IQWEERNVAAIQ
LEU3_BRANA/45-394-----NITLLP--------------GDGIGP---EVISIAKNVL--QQAGSLEG...L---------EFSFQEMPVGGAA
LEU3_SCHPO/5-363-----KIVVLP--------------GDHIGP---EIVASALEVL--KVVEKKRP..EL---------KLEFEEHKIGGAS
LEU3_LEPIN/3-354-----NVAVLS--------------GDGIGP---EVMEIAISVL--KKALGAKV...S---------EFQFKEGFVGGIA
LEU3_BACCO/4-351-----KLAVLP--------------GDGIGP---EVMDAAIRVL--KTVLDNDG...H---------EAVFENALIGGAA
LEU3_NEUCR/5-358-----NIVVFG--------------GDHCGP---EVVLEAIKVL--KAIETNSPS.AG---------KFNLQNHLLGGAS
LEU3_LACLA/4-340-----KIVTLA--------------GDGIGP---EIMSAGLSVL--KAVSKKID...F---------EYELEAKDFGGIA
IDH_THET8/21-351-----LITVIP--------------GDGIGP---ECVEATLKVL--EAAK..AP....---------.LAYEVREAGASV
LEU3_YARLI/14-367-----KIVLLG--------------GDFCGP---EVIAEAVKVL--KSVAEASG...T---------EFVFEDRLIGGAA
LEU3_BACCA/5-348-----RIAVLP--------------GDGIGK---EVTSGAVEVL--KAVGIRFG...H---------EFTFEYGLIGGAA
IDH2_YEAST/38-365-----TVSFIE--------------GDGIGP---EISKSVKKIF--SAAN..VP....---------.IEWESCDVSPIF
LEU3_THEAQ/2-344-----RVAVLP--------------GDGIGP---EVTEAALRVL--KALDEREG...L---------GLTYETFPFGGAA
IDH_BACSU/21-418-----IIPFIE--------------GDGTGP---DIWNAASKVL--EAAVEKAYKGEK---------KITWKEVYAGEKA
LYS12_YEAST/25-367-----TIGLIP--------------GDGIGK---EVIPAGKQVL--ENLNSKHG...L---------SFNFIDLYAGFQT
LEU3_CLOPA/5-353-----KIAVIP--------------GDGIGP---DIVREAVKIM--TKVGEKYD...T---------KFNFVEVKAGGDA

PF04166

PDXA_XYLFA/24-317--L..VQQ..P--------------RQDC.R---LVAFADPATL..QAAAAALDLP.L.........RLLPPE.....AL
PDXA1_PSEAE/23-321--L..ARS...--------------AQPH.P---LIAIASRTLL..QERAGQLGLA.I.........DLKDVSPAAWPER
PDXA_CAMJE/22-358--S..HEE..L--------------SKIC.T---PFYFIHESLL..NKALKLLNLK.LFNAKIVAFKDDKDYEFNF.IKK
PDXA_AQUAE/23-314--I..SKH..F--------------KEKF.T---YVIYGEEKTL..LEASKLTGIK.L.........NYKKIEKVE.EAK
PDXA_SYNY3/27-337--A..LAEPGL--------------ASIC.Q---LTAIGSRSVLDQTRRQLLAQNPGL.........NLADPE.......
PDXA_BACHD/25-325--ALNKKE..L--------------YDVA.N---PVVIGHGDML..EKMLPVMKAD.L.........TINRITTVD.EAM
PDXA_RHILO/28-330--L..ARE..A--------------VGLP.A---FYLLADPALI..ASRASRLGVS.V.........PIVETTPAL.AAQ
PDXA_HELPY/24-307--S..HKE..V--------------SALC.E---PLYLTDGELL..ERANQLLHNA.Y.........ETKVLN.......
PDXA_SPHAR/30-319--A..LADGAV--------------HTDS.I---PVLVGSAAAV..ERALDFTGTK.A.........RLRVMRGFE.KPS
PDXA2_PSEAE/27-330--LLADTE..V--------------REKA.H---IVLIADEAEM..RRGMRIAGCE.F.........PYRRID.....AL
PDXA_PASMU/24-327--LLAKQN..I--------------REKA.N---IVLVADKDEL..EKGMEIAKAQ.F.........VYEEVSFHQ.LGQ
PDXA_CAUCR/24-325--A..WRA..L--------------RQDGPT---FVVIGDAQLL..ASAGGGVKVR.A.........VTRPQE....AAQ
P94285_BURCE/3-246--A..SGR...--------------......---IVVLD................P.L.........DLAPHE.......
PDXA_ECOLI/25-322--L..AQR...--------------EWPV.E---LVVCADATLL..TNRAAMLGLP.L.........TLRPYSPNS.PAQ
PDXA_VIBCH/24-322--L..SAQ...--------------DWPH.Q---LVVCADKALL..AQRATQLGIQ.V.........KLLDYQRDN.PVQ
PDXA_NEIMB/24-322--L..AFA...--------------RLPC.R---CAVLGDKNLL..RARAEALGKS.V.........VLRDFD.......

PF03971

Q9KSW5_VIBCH/7-741-----TIIYTI--------------TDEAPA---LATYSLLPII--QSFTASSGIN-VETRDISLAGRILANFPEHLTEE
O53611_MYCTU/7-742-----TIIYTL--------------TDEAPL---LATYAFLPIV--RAFAEPAGIK-IEASDISVAARILAEFPDYLTEE
Q9I0L4_PSEAE/6-739-----KITYTF--------------TDEAPA---LATYSLLPIV--KAFAASAGID-VETSDISLAGRILANFADRLEAD
Q9PA20_XYLFA/23-757-----KLIYTL--------------TDEAPF---LATQSLLPII--KAYTKVAGIQ-VETRDISLAGRILAKFPDVLTET
Q9JZS1_NEIMB/6-740-----TIVYTH--------------TDEAPA---LATQSLLPIV--QAFARHADID-VKTSDISLSGRILAAFPEYLTEA

PF02504

PLSX_THETC/1-317--MRIAVDAMG--------------GDYAPL...EITKGVYKALENFN.IEIVLVGNK---------DQLDKYVKE....
PLSX_SYNY3/6-328--AKIALDAMG--------------GDYAPE...EIVIGAIRASQELD.VDIFLVGDR---------QAIEDCLNR...H
PLSX_MYCGE/3-318--FRFAVDCLG--------------FENKPS...EAIEAVLKYWSFHQDLNFILIGDE---------KAFDGLDILP...
PLSX_HELPY/1-317--MKIVIDLMG--------------ADHGVL...PVIEGVSRALENKS.FSTVLVGDK---------DKATPFISK....
PLSX_CHLTR/3-311--VRLGVDMMG--------------GDHDPLVVWEALGEVLLSSTGEQPVEFTVFATS---------DVHHQLMNS....
GRDD_EUBAC/28-365--VKVGITTLG--------------SEHGVE...NLVKGAELAAKDAAGFDIVLIGPK---------VETSLEVVEVATE
PLSX_ECOLI/4-331--LTLALDVMG--------------GDFGPS...VTVPAALQALNSNSQLTLLLVGNS---------DAITPLLAK..AD
PLSX_CHLPN/3-314--VQIGIDLMG--------------GDHSPLVVWQVLVDVLKSQSSTIPFAFTLFASE---------EIRKQIQEEFISD
PLSX_BACSU/1-321--MRIAVDAMG--------------GDHAPK...AVIDGVIKGIEAFDDLHITLVGDK---------TTIESHLTT....
PLSX_RHOCA/47-373--LVLSIDAMG--------------GDRGPA...AVLDGIALARRKYPDLHFLVHGPE---------ADVAPLVKAR...
PLSX_AQUAE/2-322--LRIAVDCMG--------------GDYAPL...EIVRGCILAAKELG.YKIYLVGDK---------EQIIPILEKA..K

PF01515

PTAS_THETC/2-324SIIQSIIEKAK......SNKKKIVLPEGAEP---RTLKAADIVLKEGIAD.LVLLG..---------NADEIRN..AAEG
PTB_BACSU/2-291KLKDLIGKASI......HKNKTIAVAHAEDE---EVIRAVKLAAEHLSAR.FLLTG..---------.............
PTA_SHIFL/391-707AFRYQLTELAR......KAGKRIVLPEGDEP---RTVKAAAICAERGIAT.CVLLG..---------NPAEINRVAASQG
PTAS_BACSU/3-319DLFSTVQEKVA......GKDVKIVFPEGLDE---RILEAVSKLAGNKVLN.PIVIG..---------NENEIQAKAKELN
PTAS_METTE/3-325TFLEKISERAK......KLNKTIALPETEDI---RTLQAAAKILERGIAD.IVLVG..---------NEADIKA..LAGD
PTA_MYCTU/365-682MFTYRLLQQAR......SDLMRIVLPEGDDD---RILKSAGRLLQRGIVD.LTILG..---------DEAKVRLRAAELG
EUTD_ECOLI/1-320MIIERCRELAL......RAPARVVFPDALDQ---RVLKAAQYLHQQGLAT.PILVA..---------NPFELRQFALSHG
PTAS_CLOTH/2-324SFLEQIIERAK......SDVKTIVLPESTDL---RVIKAASMIMKKGIAK.VVLIG..---------NEKEIKS..LAGD
PTAS_PARDE/2-314KPLDRIHEAAK......ALDRHIILPEGEDP---RVAEAARRLLAAGLAR.VTLMG..---------.GPEIPG......
Q45828_CLOAT/4-296SFNEIIMKVKS......KEMKKVAVAVAQDE---PVLEAVRDAKKNGIAD.AILVG..---------.............
MAO1_RHIME/441-763FIMKPVFAAAK.....NAAKNRVIFAEGEDE---RVLRAAQVLLEEGTAK.PILIGRP---------QIIETRLRRYGLR
PTAS_CORGL/5-322LFENWLLKRAR......AEHSHIVLPEGDDD---RILMAAHQLLDQDICD.ITILG..---------DPVKIKERATELG
PTAS_MYCCT/2-318YTLEEIKNQLGL....KSEKKSIVFPEAESE---IIQSVAKTLVDEKLGL.PILLF.K---------SSKEVPSEIKNN.
PTA_SYNY3/374-693LFLYNLVQAAT......AAQRHIVLPEGEEI---RILKAAASLINHGIVR.LTLLGNI---------EAIEQTVKINHID
PTAS_MYCGE/2-315SVIDIFKKRLQA....VSKKPVIIFPEGWSA---SVLKAVEMLNESKLIQ.PAVIF.H---------NRQEIPANFDKK.
PTB_CLOB8/4-295NFDELLSRLKE......VPTKKVAVAVAQDE---PVLEAIKEATENNIAQ.AILVG..---------.............
PTAS_BORBU/10-350CLKDYVFKKARIFVKENKLKANIVFPESSDS---RVLKAAIVILQKNLADSIILIGKK---------DTVINSLKEFSNC
PTAS_MYCPN/2-315SVIDLLKQRVQS....AGKKPVIIFPEGWSP---TVMEAVNQLQQAGILT.PPVIF.R---------TRSEVPAGFNTA.
MAO2_HAEIN/429-750LFMRPIFSQAK......SAKQRIILAEGEEN---KALHATQEVISMGLAN.PILIGRR---------SVIEEKIKKLGLR
PTAS_CLOAB/2-326DLIESIWECAK......QDKKRIILAEGEEK---RNLIAADKIIKEGLAE.LVLVG..---------DENKIKEKASELN
MAO2_RHIME/438-756STLQRIVERVR......RQPKRIVFAEGEEV---QMMRSAIAYANQQLGT.ALLLGRE---------EVMRETAEREGID

PF00180

LEU3_BACMD/4-351IDEAG..TPLPESTIETCKQA.DAVLLG--------SVGGPKWD.....RNPSHLRPEK.GLLAIRKE-----------L
LEU3_SPIPL/6-355IDATG..EPLPEESLQACRDS.DAVLLA--------AIGGYKWD.....NLPRPERPET.GLLALRAG-----------L
LEU3_BACSU/4-352IDEHH..NPLPEETVAACKNA.DAILLG--------AVGGPKWD.....QNPSELRPEK.GLLSIRKQ-----------L
LEU3_ECOLI/6-355IDNHG..QPLPPATVEGCEQA.DAVLFG--------SVGGPKWE.....HLPPDQQPERGALLPLRKH-----------F
IDH1_COLMA/28-411TKMYDSETWLPEETLNILQEY.KVSIKG--------PLTTPV.........GGGMSSLN...VAIRQM-----------L
IDHC_SOYBN/8-403RDETD..DKVTIESAEATLKY.NVAIKC--------ATITPD...........EARVKEFGLKSMWKS-----------P
LEU3_AGRT5/5-361YDAHG..VAISDADMEKALAA.DAILFG--------AVGGPKWD.....GVPYEHRPEA.GLLRLRKD-----------L
LEU3_CANBO/7-356IDATG..VPLPDEALEAAKKS.DAVLLG--------AVGGPKW......GTG.EVRPEQ.GLLKIRKE-----------L
IDH3A_BOVIN/33-358GPGGK..WMIPPEAKESMDKN.KMGLKG--------PLKTPI.........AAGHPSMN..LL.LRKT-----------F
LEU3_BRANA/45-394LDLVG..VPLPEETVSAAKES.DAVLLG--------AIGGYKWD.....KNEKHLKPET.GLLQLRAG-----------L
LEU3_SCHPO/5-363IDAYG..TPLTDETVKACLEA.DGVLLG--------AVGGPEW.......TNPNCRPEQ.GLLKLRKS-----------M
LEU3_LEPIN/3-354IDKTG..HPLPPETLKLCEES.SAILFG--------SVGGPKWE.....TLPPEKQPERGALLPLRKH-----------F
LEU3_BACCO/4-351IDEAG..TPLPEETLDICRRS.DAILLG--------AVGGPKWD.....HNPASLRPEK.GLLGLRKE-----------M
LEU3_NEUCR/5-358IDKHN..DPLTDEALNAAKAA.DAVLLG--------AIGGPEW......GTSSTVRPEQ.GLLKLRKE-----------L
LEU3_LACLA/4-340IDKHG..HPLPEETLQAVKNA.DAILLA--------AIGHPKY.......NNAKVRPEQ.GLLALRKE-----------L
IDH_THET8/21-351FRR.GIASGVPQETIESIRKT.RVVLKG--------PLETPV.........GYGEKSAN...VTLRKL-----------F
LEU3_YARLI/14-367IEKEG..EPITDATLDICRKA.DSIMLG--------AVGGAANTVWTTPDGRTDVRPEQ.GLLKLRKD-----------L
LEU3_BACCA/5-348IDEAG..TPLPEETVRLCRES.DAVLLG--------AVGGPKWD.....DNPPHLRPEK.GLLAIRKQ-----------L
IDH2_YEAST/38-365VNG.L..TTIPDPAVQSITKN.LVALKG--------PLATPI.........GKGHRSLN..LT.LRKT-----------F
LEU3_THEAQ/2-344IDGYG..EPFPEVTRKGVEAA.EAVLLG--------SVGGPKWD.....ALPRKIRPES.GLLALRKS-----------Q
IDH_BACSU/21-418YNKTG..EWLPAETLDVIREY.FIAIKG--------PLTTPV.........GGGIRSLN...VALRQE-----------L
LYS12_YEAST/25-367FQETG..KALPDETVKVLKEQCQGALFG--------AVQSPT..........TKVEGYSSPIVALRRE-----------M
LEU3_CLOPA/5-353IDAYG..EPLPKETIDVCKSS.AAVLLG--------AVGGPKWD.....NLEGSKRPER.ALLGLRGA-----------L

PF04166

PDXA_XYLFA/24-317AERPGDL.PIQAQCH.VH......P.TR........F.GHPD--------PANAPAVIAALCEAASDC-----------V
PDXA1_PSEAE/23-321PAKAGQL.YVWDTPL.AA......P.VR........P.GQLD--------RANAAYVLETLTRAGQGC-----------L
PDXA_CAMJE/22-358ENSLEIYSFCLPLGF.KVDE..NFE.IQ........A.GEID--------AKSGLYGFLSFKAASYFV-----------Y
PDXA_AQUAE/23-314ER..GVY.LIDLNVL.KV......P.VV........E.PSVS--------..SGKAAVAYLARAVADA-----------I
PDXA_SYNY3/27-337..TINLL.EVDLSYLGKI......T.VG........Q.GDAV--------..SGAISFAYLNEAITRT-----------L
PDXA_BACHD/25-325FEYGTID.VIHLDNL.NV......AEVK........M.GTVQ--------AQCGKAAFEYIRHAVQLA-----------N
PDXA_RHILO/28-330VF.ARAL.PIVPLAA.RF......I.DS........P.GRPD--------PANAAGTVEAIDRAVAAC-----------L
PDXA_HELPY/24-307....ALA.IDAPLPL.LN......S.ST........I.GKVS--------AQSGAYSFESFKKACELA-----------D
PDXA_SPHAR/30-319DDPAIID.VIDTGAL.PD......G.VLP.......L.GEDT--------EAAGHATAQWLDELDALA-----------R
PDXA2_PSEAE/27-330ET...LD.FADATPL.LH......P.WLSQGGDEFPR.SEAS--------AVGGRYSLETLALALELT-----------R
PDXA_PASMU/24-327YE...FK.TGVPVLI.SHKSSHPKP.FE........Y.GKVT--------EQSGVYILETLKVALNLA-----------K
PDXA_CAUCR/24-325VFPDALP.VLD.IPV.LS......P.VV........Y.GRPS--------PSHAPQIIRWIETGVGLA-----------L
P94285_BURCE/3-246..........................YV........T.GQPS--------AAAGRAVVRWMALADRIA-----------H
PDXA_ECOLI/25-322PQTAGTL.TLLPVAL.RA......P.VT........A.GQLA--------VENGHYVVETLARACDGC-----------L
PDXA_VIBCH/24-322AQQAGTL.LVEHIPL.AE......P.VV........A.GQLN--------PANGHYVLKTLERAAKGC-----------M
PDXA_NEIMB/24-322PESGGAA.YGELEVL.HI......P.AVEA.....VEAGKLN--------PANAAYVLQLLDTALAGI-----------S

PF03971

Q9KSW5_VIBCH/7-741QRISDALTELGELAKTPEANIIKLPNISASVPQLKAAIKELQDKGYALPNYPEEPSSYEEEAIKATYDKIKGSAVNPVLR
O53611_MYCTU/7-742QRVPDNLAELGRLTQLPDTNIIKLPNISASVPQLVAAIKELQDKGYAVPDYPADPKTDQEKAIKERYARCLGSAVNPVLR
Q9I0L4_PSEAE/6-739QRIEDDLARLAVLATSPDANIIKLPNISASVPQLKGAIAELQGLGYKVPDFPEDPQTDEEKEVRARYAKILGSAVNPVLR
Q9PA20_XYLFA/23-757QRVSDDLAELGEMTASPDANIIKLPNISASMPQLKAAIKELQEQGYLLPDYPDEPKNSAQKDVKIRYDRVKGSAVNPVLR
Q9JZS1_NEIMB/6-740QRVPDALAELGELVKQPDANVIKLPNISASVPQLTAAIKELQSKGFAVPDYPADPQTDEEKAVRERYDRIKGSAVNPVLR

PF02504

PLSX_THETC/1-317.EKG..LTVVHTTETI---TNNEPPVAA--------IRKKKD----------------SSMAVGIDML-----------K
PLSX_SYNY3/6-328PHQGINLTIVDAEGVV---EMEEDAV.V--------VRRKPK----------------ASINVAMNLV-----------K
PLSX_MYCGE/3-318..KN..ITKKLANSFI---EMTDTPLSA--------RRKVN.----------------SSMQIAINLV-----------R
PLSX_HELPY/1-317.ELASKVEMIHTQDYI---KMEEAATEA--------IKRKE.----------------SSIYLGMDIL-----------K
PLSX_CHLTR/3-311.PLSRSVRIVTAEDFV---SMEDSLLAA--------VRKKR.----------------SSMALGLDAL-----------Q
GRDD_EUBAC/28-365EEAHKKMEELLDSGYI---HSCVTVHYN--------FPIGV.----------------STVGRVVTPG-----------M
PLSX_ECOLI/4-331FEQRSRLQIIPAQSVI---ASDARPSQA--------IRASRG----------------SSMRVALELV-----------K
PLSX_CHLPN/3-314LPQEKFPKIISAENFV---AMEDSPLAA--------IRKKS.----------------SSMALGLDYL-----------Q
PLSX_BACSU/1-321.TSDR.ITVLHADEVI---EPTDEPVRA--------VRRKKN----------------SSMVLMAQEV-----------A
PLSX_RHOCA/47-373.RLKSCVTIRHATGVV---TMHDKPAAV--------MRGGKD----------------TSMWSTIDAV-----------R
PLSX_AQUAE/2-322EHNNSLLEVVHAPDKV---EMHEPPS.N--------VLKKKN----------------SSLYVAGMLV-----------R

PF01515

PTAS_THETC/2-324LDISK.AEIIDPLKSEKF.DKYATDFYE--------LRKNKG----ITLEKAKETIK.DNIYFGCMMV-----------K
PTB_BACSU/2-291.................D.SKKLNELTS--------..SMQG----HQVEIVHANTPEESAKLAVRAV-----------H
PTA_SHIFL/391-707VELGAGIEIVDPEVVR...ESYVGRLVE--------LRKNKG----MTETVAREQLE.DNVVLGTLML-----------E
PTAS_BACSU/3-319LTLGG.VKIYDPHTYEGM.EDLVQAFVE--------RRKGK.----ATEEQARKALL.DENYFGTMLV-----------Y
PTAS_METTE/3-325LDLSK.AKIVDPKTYEKK.DEYINAFYE--------LRKHKG----ITLENAAEIMS.DYVYFAVMMA-----------K
PTA_MYCTU/365-682VDLDG.ATVIEPCASELH.DQFADQYAQ--------LRKAKG----ITVEHAREIMN.DATYFGTMLV-----------H
EUTD_ECOLI/1-320VAMDG.LQVIDPHGNLAMREEFAHRWLA--------RAGEK.----.TPPDALEKLT.DPLMFAAAMV-----------S
PTAS_CLOTH/2-324IDLEG.VMIEDSLNSEKL.EDYANTLYE--------LRKSKG----MTIEAARETIK.DPLYYGVMMV-----------K
PTAS_PARDE/2-314......AGRIDPAGGPDL.AELADHWHR--------MRAARG----MTAERALTEMR.DPIRQAAMRV-----------R
Q45828_CLOAT/4-296.................D.HDEIVSIAL--------KIGMDV----NDFEIVNEPNVKKAALKAVELV-----------S
MAO1_RHIME/441-763IRPDVDFEVVNPEGDPRY.RDYVDDYFA--------LVGRLG----VIPEAARTIVRTNTTVIGALAV-----------K
PTAS_CORGL/5-322LHLNT.AYLVNPLTDPRL.EEFAEQFAE--------LRKSKS----VTIDEAREIMK.DISYFGTMMV-----------H
PTAS_MYCCT/2-318......SSIKTICLDEFDTKEFEEEFVK--------LRKGK.----ATIEVAHQVMQ.LPNYIGAMLV-----------K
PTA_SYNY3/374-693LDLSK.VRLINPKTSPDR.ERYAETYYQ--------LRKHKG----VTLAMARDILT.DISYFGTMMV-----------H
PTAS_MYCGE/2-315......ITHYVIDEMD.L.TSYANFVYE--------KRKHKG----MDLKEAQKFVR.DPSSLAATLV-----------A
PTB_CLOB8/4-295.................D.KQQIHEIAK--------KINLDL----SDYEIMDIKDPKKATLEAVKLV-----------S
PTAS_BORBU/10-350NDILGRIEVVDPNSFPDI.EMYLDEYWS--------LQKLKG----VTKQSLKTQVL.DEITFAMLMV-----------R
PTAS_MYCPN/2-315......IKHYVIEEMD.L.TKYANFVYE--------KRKHKG----MEMREAQKFVR.DASSLAATLV-----------A
MAO2_HAEIN/429-750LTAGVDFEIVDNEDNPRY.EECWKHYYE--------LTKRKG----ITPAIAKRVVRSNTTVLASTLL-----------S
PTAS_CLOAB/2-326LDISK.AEIMDPETSLKT.ETYARDFYE--------LRKHKG----MTIEKSEKMVR.DPLYFATMAL-----------K
MAO2_RHIME/438-756LDRAG.IQIVNARLSKRV.GAYTDFLYS--------RLQRKG----YLFRDVQRLINTDRNHFAASMV-----------A

PF00180

LEU3_BACMD/4-351D.LYANLRPVTFY.DSLADA-------SPLKKEYIEG---------------.V-----DFIIVRELTG------GLYFG
LEU3_SPIPL/6-355G.LFANRARLLFC.PHVLDA-------SSLKREVVEG---------------.V-----DIMVVRELTG------GIYFG
LEU3_BACSU/4-352D.LFANLRPVKVF.ESLSDA-------SPLKKEYIDN---------------.V-----DFVIVRELTG------GLYFG
LEU3_ECOLI/6-355K.LFSNLRPAKLY.QGLEAF-------CPLRADIAAN---------------GF-----DILCVRELTG------GIYFG
IDH1_COLMA/28-411D.LYVCQRPVQWF...TGVP-------SPVKR..PSE---------------.V-----DMVIFRENTE------DIYAG
IDHC_SOYBN/8-403NGTIRNILNGTVFREPILCK-------NIPR.LVPGW---------------TK-----AICIGRHAFG------DQYRA
LEU3_AGRT5/5-361E.LFANLRPAICY.PALAAA-------SSLKPELVEG---------------.L-----DILIVRELTG------GVYFG
LEU3_CANBO/7-356N.LYANLRPCNFASDKLLDL-------SPLKSDIVKG---------------.T-----DFTVVRELVG------GIYFG
IDH3A_BOVIN/33-358D.LYANVRPCVSI...EGYK-------TPYHD....V---------------..-----NIVTIRENTE------GEYSG
LEU3_BRANA/45-394K.VFANLRPATVL.PQLVDA-------STLKREVAEG---------------.V-----DLMVVRELTG------GIYFG
LEU3_SCHPO/5-363G.VWANLRPCNFASKSLVKY-------SPLKPEIVEG---------------.V-----DFCVVRELTG------GCYFG
LEU3_LEPIN/3-354D.LFANLRPAIIY.PELKNA-------SPVRSDIIGN---------------GL-----DILILRELTG------GIYFG
LEU3_BACCO/4-351G.LFANLRPVKAY.ATLLNA-------SPLKRERVEN---------------.V-----DLVIVRELTG------GLYFG
LEU3_NEUCR/5-358G.TYGNLRPCNFASESLVDS-------SPLKAEVCRG---------------.T-----DFIVVRELTG------GIYFG
LEU3_LACLA/4-340G.LYANVRPLKIY.PALKKL-------SPIRN..VEN---------------.V-----DFLVIRELTG------GIYFG
IDH_THET8/21-351E.TYANVRPVREF...PNVP-------TPYAG...RG---------------.I-----DLVVVRENVE------DLYAG
LEU3_YARLI/14-367N.LYANLRPCQLLSPKLADL-------SPIR..NVEG---------------.T-----DFIIVRELVG------GIYFG
LEU3_BACCA/5-348D.LYANLRPVVCY.DSLVSR-------SPLKPDLVQG---------------.V-----DFVIVRELTG------GIYFG
IDH2_YEAST/38-365G.LFANVRPAKSI...EGFK-------TTYEN....V---------------..-----DLVLIRENTE------GEYSG
LEU3_THEAQ/2-344D.LFANLRPAKVF.PGLERL-------SPLKEEIARG---------------.V-----DVLIVRELTG------GIYFG
IDH_BACSU/21-418D.LFVCLRPVRYF...TGVP-------SPVKRP..ED---------------.T-----DMVIFRENTE------DIYAG
LYS12_YEAST/25-367G.LFANVRPVKSVE.....G-------EKGKP.....---------------.I-----DMVIVRENTE------DLYIK
LEU3_CLOPA/5-353G.LYANLRPAKVY.NVLKSA-------SPLKNEIIDE---------------GV-----DLLVVRELIG------GIYFG

PF04166

PDXA_XYLFA/24-317HGALHGIVTGPVHKAVINQS....GIHYTGTTELLA.......AQA......EC.....DVVMML.ANP......HLRVA
PDXA1_PSEAE/23-321DGHFAGMITAPVHKGVINEA....GIPFSGHTEFLAD......LTH......TA.....QVVMML.ATR......GLRVA
PDXA_CAMJE/22-358EKHAHALLTLPIHKKAWEDA....GLKYKGHTDALRD......FFK.......K.....NAIMML.GCK......ELFVG
PDXA_AQUAE/23-314RGNIHGILTMPINKFWAKKA....GFQYEGQTEFLAK......ASG......TK.....DYAMMM.YSE......KLKVV
PDXA_SYNY3/27-337AGEFDAIVTAPIAKSAWQAA....GHNYPGQTEVLAH......RAG......VE.....SFAMAF.VGRSPFTGWTLRTL
PDXA_BACHD/25-325DKKVDALATTPINKESLKAA....EVPYIGHTEMLAD......LTK......TE.....DPLTMF.EVH......SMRIF
PDXA_RHILO/28-330AGDAAAMVTCPIAKKPLYDA....GFRFPGHTEYLAH......LAA......RHSGVEAMPVMML.AGP......DLRTV
PDXA_HELPY/24-307SKEVDGICTLPINKLAWQQA....QIPFVGHTDFLKQ......RYK......DH.....QIIMML.GCS......KLFVG
PDXA_SPHAR/30-319DGSFAATIMGPISTGSLKLA....K.....KLDRVIS......PTP......GE.....SYLVLL..TG......PLRVA
PDXA2_PSEAE/27-330SGRTDAILFGPLNKTSLHMA....GMDHSDELHWFAE......RLGFGGPFCEF.....NVLDDL.WTS......R....
PDXA_PASMU/24-327MGYVQAICFAPLNKQAMHKG....GLRYRDELHWFAE......QTD......FN.....EFVCELNVVD......DIWAA
PDXA_CAUCR/24-325SGAVSGLVTAPIAKAPLYEA....GFQFPGHTEFLAELTAAASMVG......AR.....GPVMML.AAG......DLRAT
P94285_BURCE/3-246DGLIGGWIMGPIDSTSLKLA.........GEVASIDE......LQP......EH.....SF.MFR.MSG......RLRVV
PDXA_ECOLI/25-322NGEFAALITGPVHKGVINDA....GIPFTGHTEFFEE......RSQ......AK.....KVVMML.ATE......ELRVA
PDXA_VIBCH/24-322NGEFDAIVTGPVHKGVINRA....GVAFSGHTEFFAE......QSK......TP.....LVVMML.ATE......GLRTA
PDXA_NEIMB/24-322DGIFDGIVTAPLHKGIINDARASTGF.FSGHTEYLAE......KSG......TG.....QVVMML.AGK......GLRVA

PF03971

Q9KSW5_VIBCH/7-741EGNSDRRAPASVKNYAKKNPHSMGAWSKDSKSHVASMSDKDFFGSEKSMTVSGATKVAIEFVGKEGAVKVLKKPFALQDK
O53611_MYCTU/7-742QGNSDRRAPKAVKEYARKHPHSMGEWSMASRTHVAHMRHGDFYAGEKSMTLDRARNVRMELLAKSGKTIVLKPEVPLDDG
Q9I0L4_PSEAE/6-739EGNSDRRAPAAVKAYARKHPHSMGKWSMASRSHADYMRGGDFFSSEQSITMAKAGDVRIEFVGKDGKVEVKK.QLSLQEG
Q9PA20_XYLFA/23-757EGNSDRRAPLSVKNYVRKYPHRMGAWSTTSKSHVAHMEGGDFFGSERSAVLAQAGMLKVELIAKDGTVTVLKDKVAVSAG
Q9JZS1_NEIMB/6-740EGNSDRRAPKAVKNFAKKNPHSMGAWTKDSKTHVATMQSGDFFHNEQSVIVPEATSVSIVFTDKQGNKKELREPVALKAG

PF02504

PLSX_THETC/1-317KGEVDAFLS--AGNTGALMA---------------------------------------GSLLKIGRIK------GIDRP
PLSX_SYNY3/6-328EKQADAVVS--AGHSGAAMA---------------------------------------AALLRLGRLK------GIDRP
PLSX_MYCGE/3-318EGNADVVIS--AGSSAVYAS---------------------------------------LTNDAFGKIN------KNTKS
PLSX_HELPY/1-317NG.ADALIS--AGHSGATMG---------------------------------------LATLRLGRIK------GVERP
PLSX_CHLTR/3-311QGDLDGFVS--SGNTAALVT---------------------------------------LARSKIPMIP------AVPRP
GRDD_EUBAC/28-365GKEMFIATT--TGTSAAQRV---------------------------------------EAMVRNALYG------IITAK
PLSX_ECOLI/4-331EGRAQACVS--AGNTGALMG---------------------------------------LAKLLLKPLE------GIERP
PLSX_CHLPN/3-314EDKLDAFIS--TGNTGALVT---------------------------------------LARAKIPLFP------AVSRP
PLSX_BACSU/1-321ENRADACIS--AGNTGALMT---------------------------------------AGLFIVGRIK------GIDRP
PLSX_RHOCA/47-373DGAAQVAVS--CGNTGALMA---------------------------------------VSMLRLRKMP------GVNRP
PLSX_AQUAE/2-322KGEADGLVS--AGNTGAVLA---------------------------------------VGKFIVGAEE------EVERP

PF01515

PTAS_THETC/2-324EGYADGLVSGAIHATADLLR---------------------------------------PAFQIVKTAP------GAKIV
PTB_BACSU/2-291HKTADVLMKGNVPTSVLLK.---------------------------------------AVLNRQEGLR------SASVL
PTA_SHIFL/391-707QDEVDGLVSGAVHTTANTIR---------------------------------------PPLQLIKTAP------GSSLV
PTAS_BACSU/3-319KGLADGLVSGAAHSTADTVR---------------------------------------PALQIIKTKE------GVKKT
PTAS_METTE/3-325LGEVDGVVSGAAHSSSDTLR---------------------------------------PAVQIVKTAK------GAALA
PTA_MYCTU/365-682NCHADGMVSGAAHTTAHTVR---------------------------------------PALEIIKTVP------GISTV
EUTD_ECOLI/1-320AGKADVCIAGNLSSTANVLR---------------------------------------AGLRIIGLQP------GCKTL
PTAS_CLOTH/2-324KGEADGMVAGAVNSTANTLR---------------------------------------PALQILKTAP------GTKLV
PTAS_PARDE/2-314LGQADGTVGGAVATTADTVR---------------------------------------AALQIIGKAP------GAGIV
Q45828_CLOAT/4-296TGKADILMNGLVNTATFLKI---------------------------------------CILNKEVGLR------TGKTM
MAO1_RHIME/441-763RGEADALICGVEGRYSRHLR---------------------------------------DVSQIIGKRS------GVLDF
PTAS_CORGL/5-322NGDADGMVSGAANTTAHTIK---------------------------------------PSFQIIKTVP------EASVV
PTAS_MYCCT/2-318LNQADCMLSGLNNTTADTIR---------------------------------------PALQIIGTKP------GYNIA
PTA_SYNY3/374-693LGEADGMVSGSVNTTQHTVR---------------------------------------PALQIIKTQP------GFSLV
PTAS_MYCGE/2-315LKVVDGEVCGKEYATKDTLR---------------------------------------PALQLLATGN------...FV
PTB_CLOB8/4-295SGHADMLMKGLVDTATFLR.---------------------------------------SVLNKEVGLR------TGKLM
PTAS_BORBU/10-350FGYAKSCVCGAVSTSAKVLS---------------------------------------NALRIIPKLE------GVKII
PTAS_MYCPN/2-315LNEVDGEVCGKEYATKDTLR---------------------------------------PALQLLGTGN------...FV
MAO2_HAEIN/429-750LGYADALVCGLFGSYGKHLA---------------------------------------SIRDIIGLKD------GVKTA
PTAS_CLOAB/2-326DGYVDGMVSGAVHTTGDLLR---------------------------------------PGLQIIKTAP------GVKIV
MAO2_RHIME/438-756LGDADGMVTGLTRNYSTALE---------------------------------------DVRRCIDPKP------GHRVI

PF00180

LEU3_BACMD/4-351KPSERRT....................EG..NKETVVDTLFYKRTE.IERIIRQAFDTAVNR.....RKKVTSVDK----
LEU3_SPIPL/6-355QPKGIFE....................TE.TGKNEGSNTMAYGESE.IDRIGRVGFETAKKR.....QGRLCSVDK----
LEU3_BACSU/4-352QPSKRYV....................NT.EGEQEAVDTLFYKRTE.IERVIREGFKMAAAR.....KGKVTSVDK----
LEU3_ECOLI/6-355QPKGREG....................SG..QYEKAFDTEVYHRFE.IERIARIAFESARKR.....RHKVTSIDK----
IDH1_COLMA/28-411IEYKAGSDKAKSVIK...FLIEEMGASNIRFTENCGIGIKPVSKEG.SQRLVRQAIQYAIDN....NKDSVTLVHK----
IDHC_SOYBN/8-403TDTVIKGAGKLKLVFVPEGQGEETEFEVFNFTGEGGVSLAMYNTDESIRSFAEASMATALEK.....KWPLYLSTK----
LEU3_AGRT5/5-361EPKQIID....................LGNGQKR.GIDTQIYDTFE.IERIASVAFELARSR.....DNRVCSMEK----
LEU3_CANBO/7-356DRVEDDG....................SG.....FASDSESYSVPE.VERITRMAAFLSLQN...DPPLPIWSLDK----
IDH3A_BOVIN/33-358IEHVIVD....................G......VVQSIKLITEAA.SKRIAEFAFEYARNN....HRSNVTAVHK----
LEU3_BRANA/45-394VPRGIKT....................NE.NGEEVGYNTEVYAAHE.IDRIARVAFETARKR.....RGKLCSVDK----
LEU3_SCHPO/5-363ERTEDNG....................SG.....YAMDTWPYSLEE.VSRIARLAAWLAETS...NPPAPVTLLDK----
LEU3_LEPIN/3-354QPKGREG....................SG..QEEFAYDTMKYSRRE.IERIAKVAFQAARKR.....NNKVTSIDK----
LEU3_BACCO/4-351RPSER......................RGPGENE.VVDTLAYTREE.IERIIEKAFQLAQIR.....RKKLASVDK----
LEU3_NEUCR/5-358DRTEDDG....................SG.....YACDTEPYSRAE.IVRIARLAGFLALAK...NPPAKVWSLDK----
LEU3_LACLA/4-340QHELADD...........................KARDVNDYSADE.IRRILHFAFKSAQSR....PRKLLTSVDK----
IDH_THET8/21-351IEHMQTP....................S......VAQTLKLISWKG.SEKIVRFAFELARAE....GRKKVHCATK----
LEU3_YARLI/14-367ERKEDDG....................SG.....VASDTETYSVPE.VERIARMAAFLALQH...NPPLPVWSLDK----
LEU3_BACCA/5-348QPSAV.......................VENGEEKAVDTLLYKKEE.IERIVRMAFELARGR.....RKKVTSVDK----
IDH2_YEAST/38-365IEHIVCP....................G......VVQSIKLITRDA.SERVIRYAFEYARAI....GRPRVIVVHK----
LEU3_THEAQ/2-344EPRGMS..........................EAEAWNTERYSKPE.VERVAKVAFEAARKR.....RRHLTSVDK----
IDH_BACSU/21-418IEYAKGSEEVQKLIS...FLQNELNVNKIRFPETSGIGIKPVSEEG.TSRLVRAAIDYAIEH....GRKSVTLVHK----
LYS12_YEAST/25-367IEKTYID.....................KATGTRVADATKRISEIA.TRRIATIALDIALKRLQTRGQATLTVTHK----
LEU3_CLOPA/5-353.DRGTKE....................VN..GVETAFDTEKYNVDE.VKRIAHSAFKAAMKR.....RKKVTSVDK----

PF04166

PDXA_XYLFA/24-317LVTTHLP---------------------------LRDVPDVITAAL-LERCLRIVNTAMCGDFGIATPRIAVLGLN----
PDXA1_PSEAE/23-321LATTHLP---------------------------LREVADAISDER-LTRVARILHADLRDKFGIAHPRILVCGLN----
PDXA_CAMJE/22-358LFSEHIP---------------------------LAKVSKKITFKN-LSIFLKDFYKETHFKK......MGLLGFN----
PDXA_AQUAE/23-314LLTTHIP---------------------------LKDVPNYVKKEE-ILKKVRLIRKEFLEKF.KFEPLIKVLGLN----
PDXA_SYNY3/27-337LATTHIP---------------------------LKEVPQALTPQL-MTAKLELLLTCLAQDFGISNPSVAIAGLN----
PDXA_BACHD/25-325FLTRHLS---------------------------LKDAIDQMTKER-VHDYLLRCDKAL.EKLGVKERRFAVAGLN----
PDXA_RHILO/28-330PVTIHIA---------------------------LAEVPKALTTEL-IVATARITAADLAGRFGIARPRLAIAGLN----
PDXA_HELPY/24-307LFSDHVP---------------------------LGAVSQLIQVGA-LVKFLLAFQKSTQAKI......VQVCGFN----
PDXA_SPHAR/30-319HLTDHMS---------------------------LRQVIDVISADL-VATAVGQLHEAMQS.WGIAQPRIAVAGLN----
PDXA2_PSEAE/27-330.VTSHVA---------------------------LAEVPGLLSQER-VGEAIRLIDDALRRSG.LARPRIGVCGLN----
PDXA_PASMU/24-327RVTSHIP---------------------------FKDIVPNLSIKG-VFDCIHLLYRSLVQAG.VENPKIAVQALN----
PDXA_CAUCR/24-325LVTIHTA---------------------------LAKAPSALTTEA-IINSGLVTAQALRKDFGIAEPRLAVAALN----
P94285_BURCE/3-246PLTEHIP---------------------------LRDVPATVTFDA-VLNLVTLVNERLKD.WGIEAPRIGVAGLN----
PDXA_ECOLI/25-322LATTHLP---------------------------LRDIADAITPAL-LHEVIAILHHDLRTKFGIAEPRILVCGLN----
PDXA_VIBCH/24-322LVTTHLP---------------------------LAEVPQAITCER-LEQIVHILHKDLVEKFAIAEPKIYVCGLN----
PDXA_NEIMB/24-322LVTTHLP---------------------------LKDVAAAITQPL-IESVARILHHDLKHKFGIKNPKILVAGLN----

PF03971

Q9KSW5_VIBCH/7-741EIIDTSVMSKKALIAFFEKEIADAKAQDVLFSLHMKATMMKVSDPVIFGHAVKVYYKAVFDKYGQLFDQLGVDVNNGLGD
O53611_MYCTU/7-742DVIDSMFMSKKALCDFYEEQMQDAFETGVMFSLHVKATMMKVSHPIVFGHAVRIFYKDAFAKHQELFDDLGVNVNNGLSD
Q9I0L4_PSEAE/6-739EVLDSMFMSCGKLRDFFEKTLQDCKETGVMWSLHVKATMMKISHPIVFGHAVSVYYKDVFDKWGQLFEELGVNPNNGISS
Q9PA20_XYLFA/23-757DIVDAAVLSKQALAVFVAAQMSDAKSQGVLFSVHLKATMMKVSDPVIFGVFVSEFYKEALTKHADTLKQVGFDPNNGIGD
Q9JZS1_NEIMB/6-740EIIDATVMSKKALLAFLAEQVKDAKAKGVLFSLHMKATMMKVSDPIIFGHAVKVFFAPVFEKFGDKLAAAGVNVNNGFGN

PF02504

PLSX_THETC/1-317ALAPILP--------TLN.----------G.ATILLDAGSNTDCKPINLFQFAIMGNVYAQKML.NIDNP.KIGL-----
PLSX_SYNY3/6-328AIGTLFP--------TMVP----------GKSVIVLDVGANVDCKPKYLEQFALMGTVYSQYVL.GVDSP.KVGL-----
PLSX_MYCGE/3-318AFMSYVP--------TDN.----------NNWFYFLDVGANKYFTGKELYFLGLMADIFVKKTT.TKKTP.KIGL-----
PLSX_HELPY/1-317AICTLMP--------SVG.----------KRPSVLLDAGANTDCKPEYLIDFALMGYEYAKSVL.HYDSP.KVGL-----
PLSX_CHLTR/3-311ALLVSVP--------TLS.----------G.FAVILDVGATVSVNPDEMVGFARMGLAYRQSLSSNSNQPFTLGL-----
GRDD_EUBAC/28-365SMGIENP--------TVG.----------...ILNLDGARAVERALKELAGNGYP.ITFAESLRADGGSVMRGND-----
PLSX_ECOLI/4-331ALVTVLP--------HQQK----------G.KTVVLDLGANVDCDSTMLVQFAIMGSVLAEEVV.EIPNP.RVAL-----
PLSX_CHLPN/3-314ALLVCVP--------TMR.----------G.HAVILDVGANISVKPEEMVGFARMGLAYRQCLG.DSKIP.TIGL-----
PLSX_BACSU/1-321ALAPTLP--------TVS.----------GDGFLLLDVGANVDAKPEHLVQYAIMGSVYSQQVR.GVTSP.RVGL-----
PLSX_RHOCA/47-373AIAAFWP--------CKNP----------SGFNIMLDMGADVKAEARDLLTYALMGSSYARNAL.GLDRP.RVGL-----
PLSX_AQUAE/2-322SIGVALP--------NPK.----------GK.TVLIDVGANVDCKPKHLVQFAVIGHTYAEEIL.GIKNP.RVGI-----

PF01515

PTAS_THETC/2-324SSFFIME--------VPNCE......FGENGVFLFADCAVNPSPNAEELASIAVQSANTAKTLLGMEPRVAMLSF-----
PTB_BACSU/2-291SHVAVFD--------IPD..........FDRLMFVTDSAMNIAPSLEELRQILQNAVHVAHAVGNNMPKAAALAA-----
PTA_SHIFL/391-707SSVFFML--------LP............EQVYVYGDCAINPDPTAEQLAEIAIQSADSAAAFG.IEPRVAMLSY-----
PTAS_BACSU/3-319SGVFIMA--------RG............EEQYVFADCAINIAPDSQDLAEIAIESANTAKMFD.IEPRVAMLSF-----
PTAS_METTE/3-325SAFFIIS--------VPDCE......YGSDGTFLFADSGMVEMPSVEDVANIAVISAKTFELLVQDVPKVAMLSY-----
PTA_MYCTU/365-682SSIFLMC--------LP............DRVLAYGDCAIIPNPTVEQLADIAICSARTAAQFG.IEPRVAMLSY-----
EUTD_ECOLI/1-320SSIFLML--------PQY..........SGPALGFADCSVVPQPTAAQLADIALASAETWRAITGEEPRVAMLSF-----
PTAS_CLOTH/2-324SSFFVMV--------VPNCE......YGHNGTFVYADCGLVENPDADQLSEIAISASKSFEMLVGAKPQVAMLSY-----
PTAS_PARDE/2-314SSFFLML--------SCGPG......APVRGGMIFADCGLVIQPDARELAAIALSAADSCRRILAEEPRVALLSF-----
Q45828_CLOAT/4-296SHVAVFE--------TET..........SDRLSFLTDVAFNTYPELKEKIDIVNNSVKVAHAIGIVNPKVAPICA-----
MAO1_RHIME/441-763SALSLLI--------SQ............RGATFFTDTYVSFSPSAEEIAQTTVMAANEIRRFG.ITPRAALVSH-----
PTAS_CORGL/5-322SSIFLMV--------LR............GRLWAFGDCAVNPNPTAEQLGEIAVVSAKTAAQFG.IDPRVAILSY-----
PTAS_MYCCT/2-318SSIFVMS--------KG............NENYIFTDCALNIKPTSEQLVEITQMAVDFAKALNVKNVEAALLSY-----
PTA_SYNY3/374-693SSVFFMC--------LE............DRVLVYGDCAVNPDPNAEQLAEIALTSAATAKNFG.IEPRVALLSY-----
PTAS_MYCGE/2-315SSVFIME--------KG............EERLYFTDCAFAVYPNSQELATIAENTFNFAKSLNEDEIKMAFLSY-----
PTB_CLOB8/4-295SHVAVFD--------VEG..........WDRLLFLTDAAFNTYPEFKDKVGMINNAVVVAHACGIDVPRVAPICP-----
PTAS_BORBU/10-350SSFMIMD--------TLCTARNVDFCFGHNGILFFADCSVVVNPNSLELAEIALQSAKSFKDILNAKPKVALLSF-----
PTAS_MYCPN/2-315SSVFIME--------KN............EERLYFTDCAFAVYPSPQELAVVAENTFKFAQSMGEPELKMVFLSY-----
MAO2_HAEIN/429-750AALNSLV--------LP............TGNVFLTDTHVNSNPTAEELAEITLMAAEEIHRFG.IEPAVALLSH-----
PTAS_CLOAB/2-326SGFFVMI--------IPDCD......YGEEGLLLFADCAVNPNPTSDELADIAITTAETARKLCNVEPKVAMLSF-----
MAO2_RHIME/438-756.GVSIAL--------CR............GRTVLVADTAVHDMPTSEELADIAEEAAGLAKRLG.YVPRVAMLAY-----

PF00180

LEU3_BACMD/4-351--------------------------------------------------------------------------------
LEU3_SPIPL/6-355--------------------------------------------------------------------------------
LEU3_BACSU/4-352--------------------------------------------------------------------------------
LEU3_ECOLI/6-355--------------------------------------------------------------------------------
IDH1_COLMA/28-411--------------------------------------------------------------------------------
IDHC_SOYBN/8-403--------------------------------------------------------------------------------
LEU3_AGRT5/5-361--------------------------------------------------------------------------------
LEU3_CANBO/7-356--------------------------------------------------------------------------------
IDH3A_BOVIN/33-358--------------------------------------------------------------------------------
LEU3_BRANA/45-394--------------------------------------------------------------------------------
LEU3_SCHPO/5-363--------------------------------------------------------------------------------
LEU3_LEPIN/3-354--------------------------------------------------------------------------------
LEU3_BACCO/4-351--------------------------------------------------------------------------------
LEU3_NEUCR/5-358--------------------------------------------------------------------------------
LEU3_LACLA/4-340--------------------------------------------------------------------------------
IDH_THET8/21-351--------------------------------------------------------------------------------
LEU3_YARLI/14-367--------------------------------------------------------------------------------
LEU3_BACCA/5-348--------------------------------------------------------------------------------
IDH2_YEAST/38-365--------------------------------------------------------------------------------
LEU3_THEAQ/2-344--------------------------------------------------------------------------------
IDH_BACSU/21-418--------------------------------------------------------------------------------
LYS12_YEAST/25-367--------------------------------------------------------------------------------
LEU3_CLOPA/5-353--------------------------------------------------------------------------------

PF04166

PDXA_XYLFA/24-317--------------------------------------------------------------------------------
PDXA1_PSEAE/23-321--------------------------------------------------------------------------------
PDXA_CAMJE/22-358--------------------------------------------------------------------------------
PDXA_AQUAE/23-314--------------------------------------------------------------------------------
PDXA_SYNY3/27-337--------------------------------------------------------------------------------
PDXA_BACHD/25-325--------------------------------------------------------------------------------
PDXA_RHILO/28-330--------------------------------------------------------------------------------
PDXA_HELPY/24-307--------------------------------------------------------------------------------
PDXA_SPHAR/30-319--------------------------------------------------------------------------------
PDXA2_PSEAE/27-330--------------------------------------------------------------------------------
PDXA_PASMU/24-327--------------------------------------------------------------------------------
PDXA_CAUCR/24-325--------------------------------------------------------------------------------
P94285_BURCE/3-246--------------------------------------------------------------------------------
PDXA_ECOLI/25-322--------------------------------------------------------------------------------
PDXA_VIBCH/24-322--------------------------------------------------------------------------------
PDXA_NEIMB/24-322--------------------------------------------------------------------------------

PF03971

Q9KSW5_VIBCH/7-741VYAKIQSLPEAQRAEIEAAIQAVYATQPALAMVDSDRGITNLHVPSDVIVDASMPAMIRTSGQMWGPDGKQKDTKATIPD
O53611_MYCTU/7-742LYSKIESLPASQRDEIIEDLHRCHEHRPELAMVDSARGISNFHSPSDVIVDASMPAMIRAGGKMYGADGKLKDTKAVNPE
Q9I0L4_PSEAE/6-739VYDKIKSLPASQQEEILHDIHEVYSHRPEMAMVDSVKGITNLHIPSDVIVDASMPAMIRNSGQMWGKDGKQKDTKAVMPE
Q9PA20_XYLFA/23-757LYARIVALPEEMQAVIRADVQAQYAKCPGLAMVNSDKGITNLHVPSDVIVDASMPAMIRSSGQMWNVAGTLQDTKAVIPD
Q9JZS1_NEIMB/6-740LLANLDKLDADTRTAVEAEIAAVYAANPDLAMVDSDKGITNLHVPSDVIVDASMPAMIRNSGRMWDKNGKAQDTKAVIPD

PF02504

PLSX_THETC/1-317--------------------------------------------------------------------------------
PLSX_SYNY3/6-328--------------------------------------------------------------------------------
PLSX_MYCGE/3-318--------------------------------------------------------------------------------
PLSX_HELPY/1-317--------------------------------------------------------------------------------
PLSX_CHLTR/3-311--------------------------------------------------------------------------------
GRDD_EUBAC/28-365--------------------------------------------------------------------------------
PLSX_ECOLI/4-331--------------------------------------------------------------------------------
PLSX_CHLPN/3-314--------------------------------------------------------------------------------
PLSX_BACSU/1-321--------------------------------------------------------------------------------
PLSX_RHOCA/47-373--------------------------------------------------------------------------------
PLSX_AQUAE/2-322--------------------------------------------------------------------------------

PF01515

PTAS_THETC/2-324--------------------------------------------------------------------------------
PTB_BACSU/2-291--------------------------------------------------------------------------------
PTA_SHIFL/391-707--------------------------------------------------------------------------------
PTAS_BACSU/3-319--------------------------------------------------------------------------------
PTAS_METTE/3-325--------------------------------------------------------------------------------
PTA_MYCTU/365-682--------------------------------------------------------------------------------
EUTD_ECOLI/1-320--------------------------------------------------------------------------------
PTAS_CLOTH/2-324--------------------------------------------------------------------------------
PTAS_PARDE/2-314--------------------------------------------------------------------------------
Q45828_CLOAT/4-296--------------------------------------------------------------------------------
MAO1_RHIME/441-763--------------------------------------------------------------------------------
PTAS_CORGL/5-322--------------------------------------------------------------------------------
PTAS_MYCCT/2-318--------------------------------------------------------------------------------
PTA_SYNY3/374-693--------------------------------------------------------------------------------
PTAS_MYCGE/2-315--------------------------------------------------------------------------------
PTB_CLOB8/4-295--------------------------------------------------------------------------------
PTAS_BORBU/10-350--------------------------------------------------------------------------------
PTAS_MYCPN/2-315--------------------------------------------------------------------------------
MAO2_HAEIN/429-750--------------------------------------------------------------------------------
PTAS_CLOAB/2-326--------------------------------------------------------------------------------
MAO2_RHIME/438-756--------------------------------------------------------------------------------

PF00180

LEU3_BACMD/4-351----------------------------ANVLESSR....VWRE-----VAEEVAK........----------------
LEU3_SPIPL/6-355----------------------------ANVLDVSQ....LWRD-----RIMALAA........----------------
LEU3_BACSU/4-352----------------------------ANVLESSR....LWRE-----VAEDVAQ........----------------
LEU3_ECOLI/6-355----------------------------ANVLQSSI....LWRE-----IVNEIAT........----------------
IDH1_COLMA/28-411----------------------------GNIMKFTE...GAFKD-----WGYELAIEEFGASLL----------------
IDHC_SOYBN/8-403----------------------------NTILKKYD...GRFKD-----IFQEVYEASWK....----------------
LEU3_AGRT5/5-361----------------------------RNVMKSGV....LWNQ-----VVTETHAA.......----------------
LEU3_CANBO/7-356----------------------------ANVLASSR....LWRK-----TVDRVIKE.......----------------
IDH3A_BOVIN/33-358----------------------------ANIMRMSD....GLFL-----QKCREVAE.......----------------
LEU3_BRANA/45-394----------------------------ANVLDASI....LWRR-----RVTALAA........----------------
LEU3_SCHPO/5-363----------------------------ANVLATSR....LWRK-----TVAKIFKE.......----------------
LEU3_LEPIN/3-354----------------------------ANVLTTSV....FWKE-----VVIELHKK.......----------------
LEU3_BACCO/4-351----------------------------ANVLESSR....MWRE-----IAEETAK........----------------
LEU3_NEUCR/5-358----------------------------ANVLATSR....LWRK-----TVTDVISK.......----------------
LEU3_LACLA/4-340----------------------------QNVLATSK....LWRK-----MADEIAD........----------------
IDH_THET8/21-351----------------------------SNIMKLAE...GTLKR-----AFEQVAQ........----------------
LEU3_YARLI/14-367----------------------------ANVLASSR....LWRK-----TVTRVLKD.......----------------
LEU3_BACCA/5-348----------------------------ANVLSSSR....LWRE-----VAEEVAN........----------------
IDH2_YEAST/38-365----------------------------STIQRLAD....GLFV-----NVAKELSK.......----------------
LEU3_THEAQ/2-344----------------------------ANVLEVGE....FWRK-----TVEEVHK........----------------
IDH_BACSU/21-418----------------------------GNIMKFTEGAFKNWGY-----ELAEKEYGDKVFTWA----------------
LYS12_YEAST/25-367----------------------------SNVLSQSD...GLFRE-----ICKEVYESN......----------------
LEU3_CLOPA/5-353----------------------------ANVLDASR....LWRK-----TVNEVSK........----------------

PF04166

PDXA_XYLFA/24-317----------------------------PHAGEGGY----LGRE-----ELDVVI.........----------------
PDXA1_PSEAE/23-321----------------------------PHAGEGGH----LGRE-----EIEVIE.........----------------
PDXA_CAMJE/22-358----------------------------PHAGDYGV----IG.G-----EEEKIMEKAIAFVNA----------------
PDXA_AQUAE/23-314----------------------------PHAGEMGE----LGRE-----EIEEII.........----------------
PDXA_SYNY3/27-337----------------------------PHSGEEGK----LGSE-----EQDWLI.........----------------
PDXA_BACHD/25-325----------------------------PHSGENGL----FGRE-----EMDEIT.........----------------
PDXA_RHILO/28-330----------------------------PHAGEGGS----LG.L-----EDEHIV.........----------------
PDXA_HELPY/24-307----------------------------PHAGEEGL----FG.E-----EDERIL.........----------------
PDXA_SPHAR/30-319----------------------------PHA.....----MGDE-----DRLEIA.........----------------
PDXA2_PSEAE/27-330----------------------------PHNGDNGS----FGRE-----ELDIIA.........----------------
PDXA_PASMU/24-327----------------------------PHGGEGGV----FGDE-----EMTIIQ.........----------------
PDXA_CAUCR/24-325----------------------------PHAGEGGA----LGRE-----EIDIIA.........----------------
P94285_BURCE/3-246----------------------------PHA.....----MF.E-----EEERII.........----------------
PDXA_ECOLI/25-322----------------------------PHAGEGGH----MGTE-----EIDTII.........----------------
PDXA_VIBCH/24-322----------------------------PHAGEDGV----LGMD-----EIETIT.........----------------
PDXA_NEIMB/24-322----------------------------PHAGEGGH----LGHE-----ETDTII.........----------------

PF03971

Q9KSW5_VIBCH/7-741RCYAGVYQTVIDFCKQHGAFDPTTMGSVPNVGLMAQKAEEYGSH-----DKTFILDAEGVVRVI.DEAGKVLLEQSVEAG
O53611_MYCTU/7-742STFSRIYQEIINFCKTNGQFDPTTMGTVPNVGLMAQQAEEYGSH-----DKTFEIPEDGVANIVDVATGEVLLTENVEAG
Q9I0L4_PSEAE/6-739STYARIYQEMINFCKTNGAFDPTTMGSVPNVGLMAQKAEEYGSH-----DKTFEMTADGTMRVV.LADGSVLMQHKVETG
Q9PA20_XYLFA/23-757RCYAGVYKTVIDDCKLHGAFDPVTMGSVPNVGLMAQKAEEYGSH-----DKTFQVQSGGVVRVS.DDWGEVLFEHSVEVG
Q9JZS1_NEIMB/6-740SSYAGVYQATIDFCREHGAFDPTTMGTVPNVGLMAQAAEEYGSH-----NKTFEIEADGQVQVI.DAAGKVLMQHDVEAG

PF02504

PLSX_THETC/1-317----------------------------FNIGAEEE----KGNE.....LTKQVY-------------------------
PLSX_SYNY3/6-328----------------------------LNIGEESN----KGNT.....LALQTH-------------------------
PLSX_MYCGE/3-318----------------------------LNIGTEEN----KGFD.....YHQEAF-------------------------
PLSX_HELPY/1-317----------------------------LSNGEEDI----KGNM.....LVKETH-------------------------
PLSX_CHLTR/3-311----------------------------LNIGSEER----KGTD.....SHKQTF-------------------------
GRDD_EUBAC/28-365----------------------------LLGGAADV----MVTDSLTGNIMMKVF-------------------------
PLSX_ECOLI/4-331----------------------------LNIGEEEV----KGLD.....SIRDAS-------------------------
PLSX_CHLPN/3-314----------------------------LNIGSEER----KGTE.....AHRQTF-------------------------
PLSX_BACSU/1-321----------------------------LNVGTEDK----KGNE.....LTKQTF-------------------------
PLSX_RHOCA/47-373----------------------------LNVGTEEH----KGHA.....ELKIAA-------------------------
PLSX_AQUAE/2-322----------------------------LSIGEEEG----KGNE.....LVKETY-------------------------

PF01515

PTAS_THETC/2-324----------------------------STKGSASH----ELVD-----KVRTAT-------------------------
PTB_BACSU/2-291----------------------------VETVNPKM----EATV-----NAAALA-------------------------
PTA_SHIFL/391-707----------------------------STGTSGAG----SDVE-----KVREAT-------------------------
PTAS_BACSU/3-319----------------------------STKGSAKS----DETE-----KVADAV-------------------------
PTAS_METTE/3-325----------------------------STKGSAKS----KLTE-----ATIAST-------------------------
PTA_MYCTU/365-682----------------------------STGDSGKG----ADVD-----KVRAAT-------------------------
EUTD_ECOLI/1-320----------------------------SSNGSARH----PCVA-----NVQQAT-------------------------
PTAS_CLOTH/2-324----------------------------SSYGSAKS----ELTE-----KVIKAT-------------------------
PTAS_PARDE/2-314----------------------------STAGSAEH----PSLG-----RIREAL-------------------------
Q45828_CLOAT/4-296----------------------------VEVINPKM----PSTL-----DAAMLS-------------------------
MAO1_RHIME/441-763----------------------------SNFGSRDS----ESAF-----KMRTAL-------------------------
PTAS_CORGL/5-322----------------------------STGNSGGG----SDVD-----RAIDAL-------------------------
PTAS_MYCCT/2-318----------------------------STNGSGKG----EDVD-----RVHQAV-------------------------
PTA_SYNY3/374-693----------------------------SSGSSGQG----ADVE-----KVRQAT-------------------------
PTAS_MYCGE/2-315----------------------------STLGSGKG----EMVD-----KVVLAT-------------------------
PTB_CLOB8/4-295----------------------------VEVVNTSM----QSTV-----DAALLA-------------------------
PTAS_BORBU/10-350----------------------------STKGSSSA----KETE-----KVKNAL-------------------------
PTAS_MYCPN/2-315----------------------------STLGSGKG----EAVD-----KVVSAT-------------------------
MAO2_HAEIN/429-750----------------------------SNFGSSDS----LGAP-----KMREVL-------------------------
PTAS_CLOAB/2-326----------------------------STMGSAKG----EMVD-----KVKNAV-------------------------
MAO2_RHIME/438-756----------------------------STFGHPSG----ERSE-----RVREAV-------------------------

PF00180

LEU3_BACMD/4-351-------------------......................DYPDVELE----HMLVDSAAMQ-----------LIRNP.
LEU3_SPIPL/6-355-------------------......................DYPEVELS----HLYVDNAAMQ-----------LVRWP.
LEU3_BACSU/4-352-------------------......................EFPDVKLE----HMLVDNAAMQ-----------LIYAP.
LEU3_ECOLI/6-355-------------------......................EYPDVELA----HMYIDNATMQ-----------LIKDP.
IDH1_COLMA/28-411-------------------HGGP......WCSLKNPNTGKE....IIIK----DVIADAMLQQ-----------VLLRP.
IDHC_SOYBN/8-403-------------------...................SKFEAAGIWYE----HRLIDDMVAY-----------ALKSE.
LEU3_AGRT5/5-361-------------------......................KYKDVQLE----HMLADAGGMQ-----------LVRKP.
LEU3_CANBO/7-356-------------------......................EFPKLTVQ----HQLIDSAAMI-----------LVKSPT
IDH3A_BOVIN/33-358-------------------......................NCKDIKFN----EMYLDTVCLN-----------MVQDP.
LEU3_BRANA/45-394-------------------......................EYPDVELS----HMYVDNAAMQ-----------LVRDP.
LEU3_SCHPO/5-363-------------------......................EYPHLTLK----NQLIDSAAML-----------LVKSPR
LEU3_LEPIN/3-354-------------------......................EFSDVQLN----HLYVDNAAMQ-----------LIVNP.
LEU3_BACCO/4-351-------------------......................KYPDVELS----HMLVDSTSMQ-----------LIANP.
LEU3_NEUCR/5-358-------------------......................EFPQLQLE----HQLIDSAAML-----------LVKNPR
LEU3_LACLA/4-340-------------------......................EYPDVRLE----HQLVDSCAML-----------LITNP.
IDH_THET8/21-351-------------------......................EYPDIEAV----HIIVDNAAHQ-----------LVKRP.
LEU3_YARLI/14-367-------------------......................EFPQLELN----HQLIDSAAMI-----------LIKQPS
LEU3_BACCA/5-348-------------------......................EFPDVTLE----HMLVD.MRMQ-----------LIRAP.
IDH2_YEAST/38-365-------------------......................EYPDLTLE----TELIDNSVLK-----------VVTNP.
LEU3_THEAQ/2-344-------------------......................GYPDVALD----HQYVDAMAMH-----------LVKNP.
IDH_BACSU/21-418-------------------QYDRIAEEQGKDAANKAQSEAEAAGKIIIK----DSIADIFLQQ-----------ILTRP.
LYS12_YEAST/25-367-------------------....................KDKYGQIKYN----EQIVDSMVYR-----------LFREP.
LEU3_CLOPA/5-353-------------------......................EYPEVELS----HLYVDNTAMQ-----------LVRKP.

PF04166

PDXA_XYLFA/24-317-------------------..........------------..PVLQRL----R..AEGMVLL.....G.....PLSAD-
PDXA1_PSEAE/23-321-------------------..........------------..PCLERL----R..GEGLDLI.....G.....PLPAD-
PDXA_CAMJE/22-358-------------------FLHSKKDEKF------------FKKALKDE----N..LQKELLLNFKGKGVYLPYPLVAD-
PDXA_AQUAE/23-314-------------------..........------------..PAVEEA----K..KEGIKVV.....G.....PLVPD-
PDXA_SYNY3/27-337-------------------..........------------..PWLEQA----RKKYPQAQLI.....G.....PIPPD-
PDXA_BACHD/25-325-------------------..........------------..PGIELA----K..KDGINAV.....G.....PVPAD-
PDXA_RHILO/28-330-------------------..........------------.RPAVDIL----R..AEGIDAF.....G.....PLAAD-
PDXA_HELPY/24-307-------------------..........------------..KAIQKS----NQTLGFECFL.....G.....PLPAD-
PDXA_SPHAR/30-319-------------------..........------------..PGIEAA----R..ARGIDVE.....G.....PIAPD-
PDXA2_PSEAE/27-330-------------------..........------------..PAVQKA----R..EQGIAAD.....G.....PYPAD-
PDXA_PASMU/24-327-------------------..........------------..PGMEQA----R..KAGIDVY.....G.....PFPGD-
PDXA_CAUCR/24-325-------------------..........------------..PAVEAL----R..ALGVQAS.....G.....PAPAD-
P94285_BURCE/3-246-------------------..........------------.GPAVEQA----R..AQGIDVR.....G.....PVSPD-
PDXA_ECOLI/25-322-------------------..........------------..PVLNEL----R..AQGMKLN.....G.....PLPAD-
PDXA_VIBCH/24-322-------------------..........------------..PTLQRL----R.EQYGMQLV.....G.....PLPAD-
PDXA_NEIMB/24-322-------------------..........------------..PALENL----R..REGINLA.....G.....PYPAD-

PF03971

Q9KSW5_VIBCH/7-741DIFRMCQVKDAPIQDWVKLAVTRARASNTPAVFWLDPARAHDAELIKKV----NQYLPNHDTS-----GLEIKILSPIEA
O53611_MYCTU/7-742DIWRMCIVKDAPIRDWVKLAVTRARISGMPVLFWLDPYRPHENELIKKV----KTYLKDHDTE-----GLDIQIMSQVRS
Q9I0L4_PSEAE/6-739DIWRACQTKDAPIRDWVKLAVTRARQSDTPAIFWLDPERAHDRELRKKV----ELYLKDHDLT-----GLDISIMGYNEA
Q9PA20_XYLFA/23-757DLWRMCQTKDAPIQDWVRLAVERARLSHVPAVFWLDSARAHDVQVIAKV----ERYLKDHDTN-----GLDIRIMSPVAA
Q9JZS1_NEIMB/6-740DIWRMCQTKDAPVKDWVQLAVNRARLSNTPAVFWLDENRPHDKSLLAKV----KAYLAELDTN-----GLDIRVLAPEEA

PF02504

PLSX_THETC/1-317-------------------------------------------DLIKN.S...HLNFIGNVEG-----------RDIAY-
PLSX_SYNY3/6-328-------------------------------------------ELLQSNP...EIPFVGNAEG-----------RDVLS-
PLSX_MYCGE/3-318-------------------------------------------KLLKADK...NLNFLGFVES-----------RFLLD-
PLSX_HELPY/1-317-------------------------------------------KMLKA.....YDFFYGNVEG-----------SDIFK-
PLSX_CHLTR/3-311-------------------------------------------RMLRNIF...GSAFLGNIES-----------GDVFS-
GRDD_EUBAC/28-365-------------------------------------------SSYTTGG...SYEGLGYGYG-----------PGIGD-
PLSX_ECOLI/4-331-------------------------------------------AVLKTIP...SINYIGYLEA-----------NELLT-
PLSX_CHLPN/3-314-------------------------------------------RMLRETF...GEAFLGNIES-----------GAVFD-
PLSX_BACSU/1-321-------------------------------------------QILKETA...NINFIGNVEA-----------RDLLD-
PLSX_RHOCA/47-373-------------------------------------------EMIGAMETAGGYEFVGFVEG-----------NDLPG-
PLSX_AQUAE/2-322-------------------------------------------PLLKAT....KLNFKGNAEG-----------RDIYA-

PF01515

PTAS_THETC/2-324-------------------------------------------EIAKNL----IPDV..AIDG-----------ELQLD-
PTB_BACSU/2-291-------------------------------------------QMYKRG----QIKG.CIVDG-----------PLALD-
PTA_SHIFL/391-707-------------------------------------------RLAQEK----RPDL..MIDG-----------PLQYD-
PTAS_BACSU/3-319-------------------------------------------KIAKEK----APEL..TLDG-----------EFQFD-
PTAS_METTE/3-325-------------------------------------------KLAQEL----APDI..AIDG-----------ELQVD-
PTA_MYCTU/365-682-------------------------------------------ELVRAR----EPQL..PVEG-----------PIQYD-
EUTD_ECOLI/1-320-------------------------------------------EIVRER----APKL..VVDG-----------ELQFD-
PTAS_CLOTH/2-324-------------------------------------------QLAKEK----APHL..AIDG-----------ELQVD-
PTAS_PARDE/2-314-------------------------------------------ALIRAA----APGL..EVDG-----------EMQFD-
Q45828_CLOAT/4-296-------------------------------------------KMSDRG----QIKG.CVVDG-----------PLALD-
MAO1_RHIME/441-763-------------------------------------------QLVREL----APDL..EVDG-----------EMHGD-
PTAS_CORGL/5-322-------------------------------------------AEARRL----NPEL..CVDG-----------PLQFD-
PTAS_MYCCT/2-318-------------------------------------------EILKSK----EKDY..VCEG-----------EIQFD-
PTA_SYNY3/374-693-------------------------------------------AIAKER----EPDL..ALEG-----------PIQYD-
PTAS_MYCGE/2-315-------------------------------------------KLFLEK----HPELHQSVCG-----------ELQFD-
PTB_CLOB8/4-295-------------------------------------------KMSDRG----QIKG.CVIDG-----------PFALD-
PTAS_BORBU/10-350-------------------------------------------NIVRNK----ESDL..LIDG-----------ELQLD-
PTAS_MYCPN/2-315-------------------------------------------QIFLEK----HPELKANVCG-----------ELQFD-
MAO2_HAEIN/429-750-------------------------------------------QIVKER----NPHL..MIDG-----------EMRGD-
PTAS_CLOAB/2-326-------------------------------------------EITKKF----RPDL..AIDG-----------ELQLD-
MAO2_RHIME/438-756-------------------------------------------KILDRR----RVDF..EYDG-----------EMAAD-

PF00180

LEU3_BACMD/4-351KYFD..--------VVVTE---NMFGDILSDEASMLTGS.LG--------------------------M-LPSASLTA..
LEU3_SPIPL/6-355KQFD..--------TIVTG---NLFGDILSDAAAMLTGS.IG--------------------------M-LPSASLGA..
LEU3_BACSU/4-352NQFD..--------VVVTE---NMFGDILSDEASMLTGS.LG--------------------------M-LPSASLSS..
LEU3_ECOLI/6-355SQFD..--------VLLCS---NLFGDILSDECAMITGS.MG--------------------------M-LPSASLNE..
IDH1_COLMA/28-411AEYS..--------VIATL---NLNGDYLSDALAAQVGG.IG--------------------------I-APGANLG...
IDHC_SOYBN/8-403..GG.Y--------VWACK---NYDGDVQSDFLAQGFGS.LG--------------------------L-MTSVLVCP..
LEU3_AGRT5/5-361KQFD..--------VIVTD---NLFGDMLSDVAAMLTGS.LG--------------------------M-LPSASLGAPD
LEU3_CANBO/7-356KLNG..--------IVITN---NMFGDIISDEASVIPGS.LG--------------------------L-LPSASLASLP
IDH3A_BOVIN/33-358SQFD..--------VLVMP---NLYGDILSDLCAGLIGG.LG--------------------------V-TPSGNIGA..
LEU3_BRANA/45-394KQFD..--------TIVTN---NIFGDILSDEASMITGS.IG--------------------------M-LPSASLSD..
LEU3_SCHPO/5-363TLNG..--------VVLTD---NLFGDIISDEASVIPGS.LG--------------------------L-LPSASLSGVV
LEU3_LEPIN/3-354KQFD..--------VVLCE---NMFGDILSDEASIITGS.IG--------------------------M-LPSASLSE..
LEU3_BACCO/4-351GQFD..--------VIVTE---NMFGDILSDEASVITGS.LG--------------------------M-LPSASLRS..
LEU3_NEUCR/5-358ALNG..--------VVITS---NLFGDIISDEASVIPGS.IG--------------------------L-LPSASLGGIP
LEU3_LACLA/4-340QQFD..--------VIVTE---NLFGDILSDEASSLAGS.LG--------------------------V-MPSSSHGF..
IDH_THET8/21-351EQFE..--------VIVTT---NMNGDILSDLTSGLIGG.LG--------------------------F-APSANIG...
LEU3_YARLI/14-367KMNG..--------IIITT---NMFGDIISDEASVIPGS.LG--------------------------L-LPSASLASLP
LEU3_BACCA/5-348KQFD..--------VIVTE---NMFGDILSDEASMLSGS.LG--------------------------M-LPSASLSA..
IDH2_YEAST/38-365SAYTDA--------VSVCP---NLYGDILSDLNSGLSAGSLG--------------------------L-TPSANIG...
LEU3_THEAQ/2-344ARFD..--------VVVTG---NIFGDILSDLASVLPGS.LG--------------------------L-LPSASLG...
IDH_BACSU/21-418NEFD..--------VVATM---NLNGDYISDALAAQVGG.IG--------------------------I-APGANINYE.
LYS12_YEAST/25-367QCFD..--------VIVAP---NLYGDILSDGAAALVGS.LG--------------------------V-VPSANVGP..
LEU3_CLOPA/5-353SQFD..--------VILTN---NIFGDILSDEASMITGS.IG--------------------------M-LASSSIRE..

PF04166

PDXA_XYLFA/24-317TAFLPT........KLIGY...DAVVAMYHDQGLPVLKH-SG--------------------------F.EQAVNITL--
PDXA1_PSEAE/23-321TLFTPK........HLEHC...DAVLAMYHDQGLPVLKY-KG--------------------------F.GAAVNVTL--
PDXA_CAMJE/22-358TAFTKT........GLKNC...NRLVAMYHDLALAPLKA-LY--------------------------F.DKSINVSL--
PDXA_AQUAE/23-314VAFINP........SEE.....DVFLCMYHDQGLIPFKM-LA--------------------------F.DEGVNFTL--
PDXA_SYNY3/27-337TMWVGPGKAWLTDGQTTVS...DAYLALYHDQGLIPVKL-LA--------------------------F.DQAINTTI--
PDXA_BACHD/25-325SVFHHA........LNGRY...DAVLSLYHDQGHIAAKM-TD--------------------------F.ERTISITN--
PDXA_RHILO/28-330TLFHAR........ARAGY...DAALCMYHDQALIPAKT-LA--------------------------F.DDAVNVTL--
PDXA_HELPY/24-307SAFAPN........KRKIT...PFYVSMSHDVGLAPLKA-LY--------------------------F.DESINVSL--
PDXA_SPHAR/30-319SVFRHC........IEGRY...DMVLAMFHDQGHIAVKT-WG--------------------------FSGNSV.IIM--
PDXA2_PSEAE/27-330TIFLKV........QGD.ARAFDAVVTMYHDQGQIAIKL-MG--------------------------F.SRGVTVQG--
PDXA_PASMU/24-327TTMREV........ERLKI...NGVVSMYHDQFSTALKI-LG--------------------------F.ERGVTVQG--
PDXA_CAUCR/24-325TLFHPE........ARARY...DGVLCMYHDQALIPVKM-LD--------------------------F.WGGVNITL--
P94285_BURCE/3-246SVFRHG........LDGRY...DAVVSMYHDQGQIALKS-AA--------------------------F.EGACTLYL--
PDXA_ECOLI/25-322TLFQPK........YLDNA...DAVLAMYHDQGLPVLKY-QG--------------------------F.GRGVNITL--
PDXA_VIBCH/24-322TIFSEK........YLQQA...DAVLGMYHDQVLPVLKY-KG--------------------------F.GRSVNITL--
PDXA_NEIMB/24-322TLFQPF........MLEGA...DAVLAMYHDQGLPVLKY-HS--------------------------F.GQGVNITL--

PF03971

Q9KSW5_VIBCH/7-741TQYSLVR-------MKAGQDTISVTGNVLRDYLTDLFPI-LE--------------------------L-GTSAKMLSIV
O53611_MYCTU/7-742MRYTCER-------LVRGLDTIAATGNILRDYLTDLFPI-LE--------------------------L-GTSAKMLSVV
Q9I0L4_PSEAE/6-739IRVSMER-------LIRGKDTISVTGNVLRDYLTDLFPI-ME--------------------------L-GTSAKMLSIV
Q9PA20_XYLFA/23-757MEFSLAR-------IRKGQDTISVTGNVLRDYLTDLFPI-ME--------------------------L-GTSAKMLSIV
Q9JZS1_NEIMB/6-740AKFSLGR-------LKNGEDTISVTGNVLRDYLTDLFPI-LE--------------------------L-GTSAKMLSIV

PF02504

PLSX_THETC/1-317GVAD----------VVTCDG....-..FVGNAILKSMEG-TASVISSLLKQELQRNLLTKLGAIL...IYNGLKNIVKKM
PLSX_SYNY3/6-328GNFD----------VIVCDG....-..FVGNIVLKFAEA-VGEILLSIVKEELPRGWRGKLGAII...LAPNLKRIKQRV
PLSX_MYCGE/3-318GICD----------ILIADG....-..YSGNLVLKAMEG-TFKTIARILKRGYKRNPLAGLFSLG......IIKSVAKKF
PLSX_HELPY/1-317GVVD----------VVVCDG....-..FMGNVVLKTTEG-VASAIGSIFKDEIKSSFKSKMGALM...LKNAFDILKQKT
PLSX_CHLTR/3-311GKVD----------IVVTDG....-..FTGNVFLKTAEG-LFDFLRHILGDRLEK...S.............IK...MQF
GRDD_EUBAC/28-365GYNR----------TILILSRASG-VPVAANAIKYAAKL-AQNNVKAIAAAEFKAAKAAGLESILA.GLSKDTKKASTEE
PLSX_ECOLI/4-331GKTD----------VLVCDG....-..FTGNVTLKTMEG-VVRMFLSLLKSQGEGKKRSWWLLLLKRWLQKSLTRRFSHL
PLSX_CHLPN/3-314GAAD----------IVVTDG....-..FTGNIFLKTAEG-VFEFLQRILGDKLEA...D.............IQ...RRL
PLSX_BACSU/1-321DVAD----------VVVTDG....-..FTGNVTLKTLEG-SALSIFKMMRDVMTSTLTSKLAAAV...LKPKLKEMKMKM
PLSX_RHOCA/47-373SRVD----------VIVTDG....-..FTGNVALKTGEG-TAKFAGELMREAFTSSLLSKLGALL...ASGALKRLKAKI
PLSX_AQUAE/2-322GTFD----------VIVCDG....-..FVGNVILKASES-LGLAVVQMIKEEIKRSILAKLGALL...LMPALNRFKKKA

PF01515

PTAS_THETC/2-324AALV----------KEVAELKAPG.SPVAGRANVLIFPD-LQ--------------------------AGNIGYKLVQRL
PTB_BACSU/2-291NAVS----------QIAAAQKKIS.GDVAGNADILLVPT-IE--------------------------AGNILYKSLIYF
PTA_SHIFL/391-707AAVM----------ADVAKSKAPN.SPVAGRATVFIFPD-LN--------------------------TGNTTYKAVQRS
PTAS_BACSU/3-319AAFV----------PSVAEKKAPD.SEIKGDANVFVFPS-LE--------------------------AGNIGYKIAQRL
PTAS_METTE/3-325AAIV----------PKVAASKAPG.SPVAGKANVFIFPD-LN--------------------------CGNIAYKIAQRL
PTA_MYCTU/365-682AAVE----------PSVAATKLRD.SPVAGRATVLIFPD-LN--------------------------TGNNTYKAVQRS
EUTD_ECOLI/1-320AAFV----------PEVAAQKAPA.SPLQGKANVMVFPS-LE--------------------------AGNIGYKIAQRL
PTAS_CLOTH/2-324AAIV----------PEVAKSKAKG.SSVAGKANVLIFPD-LD--------------------------AGNIAYKLTQRL
PTAS_PARDE/2-314AALD----------EAIRARKAPE.SPLTGRPNVFVFPD-LA--------------------------DGNIGYKIAERL
Q45828_CLOAT/4-296IALS----------EEAAHHKGVT.GEVAGKADIFLMPN-IE--------------------------TGNVMYKTLTYT
MAO1_RHIME/441-763SAIS----------EVLRQRVMPD.STLNGEANLLVFPN-LD--------------------------AANITLGVVKTM
PTAS_CORGL/5-322AAVD----------PGVARKKMPD.SDVAGQANVFIFPD-LE--------------------------AGNIGYKTAQRT
PTAS_MYCCT/2-318AAFD----------KKTRDKKFKNCSLLKQTPDIFVFPD-IN--------------------------AGNIGYKIAQRM
PTA_SYNY3/374-693AAVD----------STVAAQKMPG.SAVAGKATVFIFPD-LN--------------------------TGNNTYKAVQRE
PTAS_MYCGE/2-315AAFV----------EKVRLQKAPQ.LTWKNSANIYVFPN-LD--------------------------AGNIAYKIAQRL
PTB_CLOB8/4-295NAIS----------EEAAHHKGVT.GSVAGKADILLLPN-IE--------------------------AANVMYKTLTYF
PTAS_BORBU/10-350SAII----------KDVAEKKCRE.SLVAGSANVLIFPN-LD--------------------------AGNIGYKLVERF
PTAS_MYCPN/2-315SAFV----------EKVRKQKAPN.LTWNGSANIYVFPN-LD--------------------------AGNIGYKIAQRL
MAO2_HAEIN/429-750LAMN----------EAHRKELMPD.SPLKGSANLLVFPD-LS--------------------------ASRISYSLLRGT
PTAS_CLOAB/2-326AAID----------SEVAALKAPS.SNVAGNANVLVFPD-LQ--------------------------TGNIGYKLVQRF
MAO2_RHIME/438-756VALN----------ARVMEQ.YPF.CRLSGTANVLVMPA-FH--------------------------SASISTKMLQEL

PF00180

LEU3_BACMD/4-351.....DGPSLYEPVHGSAPDIAGQN-K......ANPIAAILSAAMLLRHSFGLEKEA......AVIEQAVESVLHA....
LEU3_SPIPL/6-355.....SGPGVFEPVHGSAPDIAGQD-K......ANPLAQVLSAAMMLRYGLDEPAAS......DPVEKAVLKVLDW....
LEU3_BACSU/4-352.....SGLHLFEPVHGSAPDIAGKG-M......ANPFAAILSAAMLLRTSFGLEEEA......KAVEDAVNKVLAS....
LEU3_ECOLI/6-355.....QGFGLYEPAGGSAPDIAGKN-I......ANPIAQILSLALLLRYSLDADDAA......CAIERAINRALEE....
IDH1_COLMA/28-411.....DEVAVFEATHGTAPKYAGKN-K......VNPGSVILSAEMMLRH.MGWL.EA......DLLLKGMSGAIQA....
IDHC_SOYBN/8-403....DGKTIEAEAAHGTVTRHFRVH-QKGGETSTNSIASIFAWTRGLAHRAKLDDNAKLLDFTEKLEAACIGVVEA....
LEU3_AGRT5/5-361A.KTGKRKAMYEPVHGSAPDIAGKS-I......ANPIAMIASFAMCLRYSFNMVDEA......TKLEAAIANVLDK....
LEU3_CANBO/7-356..DTNQAFGLYEPCHGSAPDLP.KN-K......VNPIATILSAAMMLKLSLNLVKEG......NAVEEAVRKVLDQ....
IDH3A_BOVIN/33-358.....NGVAIFESVHGTAPDIAGKD-M......ANPTALLLSAVMMLRH.MGLFDHA......AKIETACFATIKD....
LEU3_BRANA/45-394.....SGPGLFEPIHGSAPDIAGQD-K......ANPLATILSAAMLLKYGLGEEKAA......KRIEDAVLGALNK....
LEU3_SCHPO/5-363GKSEEKVHCLVEPIHGSAPDIAGKG-I......VNPVGTILSASLLLRYGLNAPKEA......EAIEAAVRKVLDDTSIG
LEU3_LEPIN/3-354.....SGFGLYEPSGGSAPDIAGKG-V......ANPIAQVLSAALMLRYSFSMEEEA......NKIETAVRKTIAS....
LEU3_BACCO/4-351.....DRFGMYEPVHGSAPDIAGQG-K......ANPLGTVLSAALMLRYSFGLEKEA......AAIEKAVDDVLQD....
LEU3_NEUCR/5-358D.GKGKCNGIYEPIHGSAPDISGKG-I......VNPVGTILSVAMMLRYSLNLPKEA......DAVEAAVKAAIDN....
LEU3_LACLA/4-340.....NGLALYEPIHGSAPDIAGKG-I......ANPVSMILSIAMMLRESFGQEDGA......AMIEKAVTQTFTD....
IDH_THET8/21-351.....NEVAIFEAVHGSAPKYAGKN-V......INPTAVLLSAVMMLRY.LEEFATA......DLIENALLYTLEE....
LEU3_YARLI/14-367..DTNEAFGLYEPCHGSAPDLG.KQ-K......VNPIATILSAAMMLKFSLNMKPAG......DAVEAAVKESVEA....
LEU3_BACCA/5-348.....SGPSLYEPVHGSAPDIAGMN-K......ANPIAAILSAAMMLRLSFGLTAEA......GG.RARVWQALAL....
IDH2_YEAST/38-365.....HKISIFEAVHGSAPDIAGQD-K......ANPTALLLSSVMMLNH.MGLTNHA......DQIQNAVLSTIASG...
LEU3_THEAQ/2-344.....RGTPVFEPVHGSAPDIAGKG-I......ANPTAAILSAAMMLEHAFGLVELA......RRVEAAVAKALRE....
IDH_BACSU/21-418...TG..HAIFEATHGTAPKYAGLD-K......VNPSSVILSGVLLLEH.LGWNEAA......DLVIKSMEKTIAS....
LYS12_YEAST/25-367......EIVIGEPCHGSAPDIAGKG-I......ANPIATIRSTALMLEF.LGHNEAA......QDIYKAVDANLRE....
LEU3_CLOPA/5-353.....DSFGMYEPIHGSAPDIAGLD-I......ANPLAQILSAAMLMEYSLDMSEAA......RDVEAAVEKVLNE....

PF04166

PDXA_XYLFA/24-317----GLPYPRVAVDHGTALDLAGRG.V------ADPSSLFAATALCA---------------------------------
PDXA1_PSEAE/23-321----GLPIIRTSVDHGTALDLAGSG.R------IDSGSLQVALETAY---------------------------------
PDXA_CAMJE/22-358----NLPIIRVSVDHGTAFDKAYKNAK------INTKSYFEAAKFAI---------------------------------
PDXA_AQUAE/23-314----GLPFIRTSPDHGTAYDIAWKN.K------ARESSSLHALRLIE---------------------------------
PDXA_SYNY3/27-337----GLPFVRTSPDHGTAFDIAGQG.I------ARADSLIAAIKLAA---------------------------------
PDXA_BACHD/25-325----GLPFLRTSVDHGTAFDIAGKG.I------ASTVSMEECIKLAA---------------------------------
PDXA_RHILO/28-330----GLPFIRTSPDHGTAFDIAGKG.I------ARPDSLIAALKLAR---------------------------------
PDXA_HELPY/24-307----NAPILRTSTDHGTAFDIAYQN.K------ANNKSYLNAIKYLA---------------------------------
PDXA_SPHAR/30-319----GPPYLHMSVAHGTAYDIVGTG.K------ADAAMMLSAMRTCG---------------------------------
PDXA2_PSEAE/27-330----GLPIPIATPAHGTAFDIAGQG.R------ADVGATRQAFEIAC---------------------------------
PDXA_PASMU/24-327----GIPIPITTANHGTAFDLHGKN.I------AIPTAFEAAFNIAV---------------------------------
PDXA_CAUCR/24-325----GLPIVRTSPDHGTGFDIAGRG.I------ARPDSLIAAIQLAA---------------------------------
P94285_BURCE/3-246----GVPYVRATVPHGTAMGIAGRN.L------AQHHSMVAALRTAA---------------------------------
PDXA_ECOLI/25-322----GLPFIRTSVDHGTALELAGRG.K------ADVGSFITALNLAI---------------------------------
PDXA_VIBCH/24-322----GLPFIRTSVDHGTALDLAGTG.Q------ADAGSFWTALAYAI---------------------------------
PDXA_NEIMB/24-322----GLPFIRTSVDHGTALDLAATG.R------ADSGSLITAVETAV---------------------------------

PF03971

Q9KSW5_VIBCH/7-741PLMNGGGLFETGA-GGSAPKHVQQV-QKENHLRWDSLGEFLALAASLEHLSVVTGNRKAQVLADALDKATGKFLDMNKSP
O53611_MYCTU/7-742PLMAGGGMYETGA-GGSAPKHVKQL-VEENHLRWDSLGEFLALGAGFEDIGIKTGNERAKLLGKTLDAAIGKLLDNDKSP
Q9I0L4_PSEAE/6-739PLMAGGGMYETGA-GGSAPKHVQQL-VEENYLRWDSLGEFLALAVSLEETGIKTGNAKAKLLGKALDEATGKLLDNNKSP
Q9PA20_XYLFA/23-757PLMAGGGLFETGA-GGSAPKHVQQF-TEENYLRWDSLGEFLALAASLEHLGNRYDHVAAKVLAKALDVANGQILDNNKSP
Q9JZS1_NEIMB/6-740PLMNGGGMFETGA-GGSAPKHVQQF-LEENHLRWDSLGEFLALAVSFEHLAQKTGNAKAQVLADTLDAATEKLLLNDKSP

PF02504

PLSX_THETC/1-317DYTEYGGAPLLG.IKKPVIKAHGS---------SKSKAIFNAIRQAKTIVEMDVISH-----------------------
PLSX_SYNY3/6-328DHAEHGGALLFG.VDGVCVISHGS---------SRSGSIFNAIRLAKEAIDNQVSVR-----------------------
PLSX_MYCGE/3-318DYKNNAGAVVMG.LNKLALKTHGS---------ADKQQFLSTIRLAHLSLKSDLINA-----------------------
PLSX_HELPY/1-317DYAEYGGAPLLG.VNKSVIISHGK---------SNARAIECAIYQAISAVESQVCLR-----------------------
PLSX_CHLTR/3-311DYTIYPGSIISG.LSRLVIKCHGK---------SHGTALFGGISGAIDLARANVCSR-----------------------
GRDD_EUBAC/28-365EVKMPPKEVVTGTISGVDVMDLED---------AQKVLWKAGIYAESGMGCTGPIVM-----------------------
PLSX_ECOLI/4-331NPDQYNGACLLG.LRGTVIKSHGA---------ANQRAFAVAIEQAVQAVQRQVPQR-----------------------
PLSX_CHLPN/3-314DYTFYPGSVVCG.LSKLVIKCHGK---------ACGSSLFHGILGSINLAQARLCKR-----------------------
PLSX_BACSU/1-321EYSNYGGASLFG.LKAPVIKAHGS---------SDSNAVFHAIRQAREMVSQNVAAL-----------------------
PLSX_RHOCA/47-373DPRRVNGGVFLG.LNGTVIKSHGG---------ADATGVAAAIDLAARLAGLGFAER-----------------------
PLSX_AQUAE/2-322DFAEYGGIPLLG.AKKPVIITHGR---------ANAKAIKNAVRVAGEFLNTDFNKK-----------------------

PF01515

PTAS_THETC/2-324AKANAIGPITQG-MGAPVNDLSRG---------CSYKDIVDVIATTA---------------------------------
PTB_BACSU/2-291AK.ASVAAVITG-AKAPIALTSRA---------DSAENKLYSIALAI---------------------------------
PTA_SHIFL/391-707ADLISIGPMLQG-MRKPVNDLSRG---------ALVDDIVYTIALTA---------------------------------
PTAS_BACSU/3-319GNFEAVGPILQG-LNMPVNDLSRG---------CNAEDVYNLALITA---------------------------------
PTAS_METTE/3-325AKAEAYGPITQG-LAKPINDLSRG---------CSDEDIVGAVAITC---------------------------------
PTA_MYCTU/365-682AGAIAIGPVLQG-LRKPVNDLSRG---------ALVDDIVNTVAITA---------------------------------
EUTD_ECOLI/1-320GGYRAVGPLIQG-LAAPMHDLSRG---------CSVQEIIELALVAA---------------------------------
PTAS_CLOTH/2-324AKAEAYGPITQG-LARPVNDLSRG---------CSAEDIVGVAAITA---------------------------------
PTAS_PARDE/2-314AGLTAIGPILQG-LAKPANDLSRA---------CSVKDIVNATAITA---------------------------------
Q45828_CLOAT/4-296TD.SKNGGILVG-TSAPVVLTSRA---------DSHETKMNSIALAA---------------------------------
MAO1_RHIME/441-763TDSLHVGPILLG-SALPAHILSPS---------VTSRGVVNMAALAV---------------------------------
PTAS_CORGL/5-322GHALAVGPILQG-LNKPVNDLSRG---------ATVPDIVNTVAITA---------------------------------
PTAS_MYCCT/2-318GGFEAIGPFVLG-LNQPVNDLSRG---------ATFVDVLNTAIMTL---------------------------------
PTA_SYNY3/374-693TKAIAIGPILQG-LNKPVNDLSRG---------CLVEDIINTVVITA---------------------------------
PTAS_MYCGE/2-315GGYDAIGPIVLG-LSSPVNDLSRG---------ASVSDIFNVGIITA---------------------------------
PTB_CLOB8/4-295SK.SRNGGLLVG-TSAPVILTSRA---------DSFETKVNSIALAA---------------------------------
PTAS_BORBU/10-350AFAKAYGPFLQG-FSKPISDLSRG---------CSVDEIVFASALMI---------------------------------
PTAS_MYCPN/2-315GGYEAIGPIVLG-LARPFNDLSRG---------ASVSDVFNVGIITA---------------------------------
MAO2_HAEIN/429-750TTAITVGPILMG-MNKSAHILNPG---------ASVRRIINMIAYAA---------------------------------
PTAS_CLOAB/2-326AKAKAIGPICQG-FAKPINDLSRG---------CSSEDIVNVVAITV---------------------------------
MAO2_RHIME/438-756GGSTVIGPLLVG-LDKSVQIASMS---------AKDSDLVNLAAIAA---------------------------------

PF00180

LEU3_BACMD/4-351..GHRTADLADGN........HYLGTDKMVEAI-----------------------------------------------
LEU3_SPIPL/6-355..GYPTGDIMSEG.......MKAVGCRKWGICY-----------------------------------------------
LEU3_BACSU/4-352..GKRTRDLARSE........EFSSTQAITEEV-----------------------------------------------
LEU3_ECOLI/6-355..GIRTGDLARGA........AAVSTDEMGDII-----------------------------------------------
IDH1_COLMA/28-411..KTVTYDFERLMD.....DATLVSCSAFGDCI-----------------------------------------------
IDHC_SOYBN/8-403..GKMTKDLALILHGSKLSREHYLNTEEFIDAV-----------------------------------------------
LEU3_AGRT5/5-361..GIRTADIMA..D.....GCRQVGTSDMGDAV-----------------------------------------------
LEU3_CANBO/7-356..GIMTGDLGGNN...........STTEVGDAI-----------------------------------------------
IDH3A_BOVIN/33-358.GKSLTKDLGGNS...........KCSDFTEEI-----------------------------------------------
LEU3_BRANA/45-394..GFRTGDIYSAG.......TKLVGCKEMGEEV-----------------------------------------------
LEU3_SCHPO/5-363GRGLYTRDLGGEA...........STADITKAV-----------------------------------------------
LEU3_LEPIN/3-354..GKRTRDIAEVG.......STIVGTKEIGQLI-----------------------------------------------
LEU3_BACCO/4-351..GYCTGDLQVAN.......GKVVSTIELTDRL-----------------------------------------------
LEU3_NEUCR/5-358..GTKTKDLGGNA...........TTSDMGNAV-----------------------------------------------
LEU3_LACLA/4-340..GILTKDLGGTA...........TTKEMTEAI-----------------------------------------------
IDH_THET8/21-351.GRVLTGDVVGYD........RGAKTTEYTEAI-----------------------------------------------
LEU3_YARLI/14-367..GITTADIGGSS...........STSEVGDLL-----------------------------------------------
LEU3_BACCA/5-348..GS.GSRLGQRR........PHLSTNEMVEEI-----------------------------------------------
IDH2_YEAST/38-365.PENRTGDLAGTA...........TTSSFTEAV-----------------------------------------------
LEU3_THEAQ/2-344..TP.PPDLGGSA.......GTQAFTEEVLRHL-----------------------------------------------
IDH_BACSU/21-418..KVVTYDFARLMD.....GATEVKCSEFGEEL-----------------------------------------------
LYS12_YEAST/25-367.GSIKTPDLGGKA...........STQQVVDDV-----------------------------------------------
LEU3_CLOPA/5-353..GYRTADIYIEG.......TKKVGTSEMGNLV-----------------------------------------------

PF04166

PDXA_XYLFA/24-317--------------------------------------------------------------------------------
PDXA1_PSEAE/23-321--------------------------------------------------------------------------------
PDXA_CAMJE/22-358--------------------------------------------------------------------------------
PDXA_AQUAE/23-314--------------------------------------------------------------------------------
PDXA_SYNY3/27-337--------------------------------------------------------------------------------
PDXA_BACHD/25-325--------------------------------------------------------------------------------
PDXA_RHILO/28-330--------------------------------------------------------------------------------
PDXA_HELPY/24-307--------------------------------------------------------------------------------
PDXA_SPHAR/30-319--------------------------------------------------------------------------------
PDXA2_PSEAE/27-330--------------------------------------------------------------------------------
PDXA_PASMU/24-327--------------------------------------------------------------------------------
PDXA_CAUCR/24-325--------------------------------------------------------------------------------
P94285_BURCE/3-246--------------------------------------------------------------------------------
PDXA_ECOLI/25-322--------------------------------------------------------------------------------
PDXA_VIBCH/24-322--------------------------------------------------------------------------------
PDXA_NEIMB/24-322--------------------------------------------------------------------------------

PF03971

Q9KSW5_VIBCH/7-741SRRVGEIDNRGSHFYLATYWAQALAEQTADADLAAEFAPIAKALEEKEAQIVAELNGAQGKPGDLGGYYAPEFAKVAPLM
O53611_MYCTU/7-742SRKTGELDNRGSQFYLAMYWAQELAAQTDDQQLAEHFASLADVLTKNEDVIVRELTEVQGEPVDIGGYYAPDSDMTTAVM
Q9I0L4_PSEAE/6-739SRKVGDIDNRGSHFYLAMYWAQALAAQNEDAELKAHFAPLAKALTEQEATIVAELNAVQGKPAEIGGYYRSNPELTSKVM
Q9PA20_XYLFA/23-757AREIGELDNRGSHFYLALYWAQALAAQDEDVALQVKFASLAKVLSEHEVAIVADLNVVQGFPVDIGGYYHPDLARVAAAM
Q9JZS1_NEIMB/6-740KRKAGELDNRGSHFYLTLYWAQELAAQDKDAELKAAFTPLAAALTADEAKIVAELSAVQGKAADIGGYYAANPEKAAQVM

PF02504

PLSX_THETC/1-317--------------------------------------------------------------------------------
PLSX_SYNY3/6-328--------------------------------------------------------------------------------
PLSX_MYCGE/3-318--------------------------------------------------------------------------------
PLSX_HELPY/1-317--------------------------------------------------------------------------------
PLSX_CHLTR/3-311--------------------------------------------------------------------------------
GRDD_EUBAC/28-365--------------------------------------------------------------------------------
PLSX_ECOLI/4-331--------------------------------------------------------------------------------
PLSX_CHLPN/3-314--------------------------------------------------------------------------------
PLSX_BACSU/1-321--------------------------------------------------------------------------------
PLSX_RHOCA/47-373--------------------------------------------------------------------------------
PLSX_AQUAE/2-322--------------------------------------------------------------------------------

PF01515

PTAS_THETC/2-324--------------------------------------------------------------------------------
PTB_BACSU/2-291--------------------------------------------------------------------------------
PTA_SHIFL/391-707--------------------------------------------------------------------------------
PTAS_BACSU/3-319--------------------------------------------------------------------------------
PTAS_METTE/3-325--------------------------------------------------------------------------------
PTA_MYCTU/365-682--------------------------------------------------------------------------------
EUTD_ECOLI/1-320--------------------------------------------------------------------------------
PTAS_CLOTH/2-324--------------------------------------------------------------------------------
PTAS_PARDE/2-314--------------------------------------------------------------------------------
Q45828_CLOAT/4-296--------------------------------------------------------------------------------
MAO1_RHIME/441-763--------------------------------------------------------------------------------
PTAS_CORGL/5-322--------------------------------------------------------------------------------
PTAS_MYCCT/2-318--------------------------------------------------------------------------------
PTA_SYNY3/374-693--------------------------------------------------------------------------------
PTAS_MYCGE/2-315--------------------------------------------------------------------------------
PTB_CLOB8/4-295--------------------------------------------------------------------------------
PTAS_BORBU/10-350--------------------------------------------------------------------------------
PTAS_MYCPN/2-315--------------------------------------------------------------------------------
MAO2_HAEIN/429-750--------------------------------------------------------------------------------
PTAS_CLOAB/2-326--------------------------------------------------------------------------------
MAO2_RHIME/438-756--------------------------------------------------------------------------------

PF00180

LEU3_BACMD/4-351------------
LEU3_SPIPL/6-355------------
LEU3_BACSU/4-352------------
LEU3_ECOLI/6-355------------
IDH1_COLMA/28-411------------
IDHC_SOYBN/8-403------------
LEU3_AGRT5/5-361------------
LEU3_CANBO/7-356------------
IDH3A_BOVIN/33-358------------
LEU3_BRANA/45-394------------
LEU3_SCHPO/5-363------------
LEU3_LEPIN/3-354------------
LEU3_BACCO/4-351------------
LEU3_NEUCR/5-358------------
LEU3_LACLA/4-340------------
IDH_THET8/21-351------------
LEU3_YARLI/14-367------------
LEU3_BACCA/5-348------------
IDH2_YEAST/38-365------------
LEU3_THEAQ/2-344------------
IDH_BACSU/21-418------------
LYS12_YEAST/25-367------------
LEU3_CLOPA/5-353------------

PF04166

PDXA_XYLFA/24-317------------
PDXA1_PSEAE/23-321------------
PDXA_CAMJE/22-358------------
PDXA_AQUAE/23-314------------
PDXA_SYNY3/27-337------------
PDXA_BACHD/25-325------------
PDXA_RHILO/28-330------------
PDXA_HELPY/24-307------------
PDXA_SPHAR/30-319------------
PDXA2_PSEAE/27-330------------
PDXA_PASMU/24-327------------
PDXA_CAUCR/24-325------------
P94285_BURCE/3-246------------
PDXA_ECOLI/25-322------------
PDXA_VIBCH/24-322------------
PDXA_NEIMB/24-322------------

PF03971

Q9KSW5_VIBCH/7-741RPSSTFNAIIDR
O53611_MYCTU/7-742RPSKTFNAALEA
Q9I0L4_PSEAE/6-739RPSATFNAAIDS
Q9PA20_XYLFA/23-757QPSKTFNDALRL
Q9JZS1_NEIMB/6-740RPSVTFNQALNA

PF02504

PLSX_THETC/1-317------------
PLSX_SYNY3/6-328------------
PLSX_MYCGE/3-318------------
PLSX_HELPY/1-317------------
PLSX_CHLTR/3-311------------
GRDD_EUBAC/28-365------------
PLSX_ECOLI/4-331------------
PLSX_CHLPN/3-314------------
PLSX_BACSU/1-321------------
PLSX_RHOCA/47-373------------
PLSX_AQUAE/2-322------------

PF01515

PTAS_THETC/2-324------------
PTB_BACSU/2-291------------
PTA_SHIFL/391-707------------
PTAS_BACSU/3-319------------
PTAS_METTE/3-325------------
PTA_MYCTU/365-682------------
EUTD_ECOLI/1-320------------
PTAS_CLOTH/2-324------------
PTAS_PARDE/2-314------------
Q45828_CLOAT/4-296------------
MAO1_RHIME/441-763------------
PTAS_CORGL/5-322------------
PTAS_MYCCT/2-318------------
PTA_SYNY3/374-693------------
PTAS_MYCGE/2-315------------
PTB_CLOB8/4-295------------
PTAS_BORBU/10-350------------
PTAS_MYCPN/2-315------------
MAO2_HAEIN/429-750------------
PTAS_CLOAB/2-326------------
MAO2_RHIME/438-756------------

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window