Sequence alignment for CL0282

PF09164

VTDB_HUMAN/405-472--ELCADYSENTFTEYKKKLAERLKAKLPDATPKELAKLVNKRSDFASNCCSINSP------------------------
VTDB_RAT/405-472--EMCADYSENTFTEYKKKLAERLRTKMPNASPEELADMVAKHSDFASKCCSINSP------------------------
VTDB_RABIT/405-472--ELCAGYSENTFTEYKKKLSQQLRAKLPEATSAELAELVEKHSDFASKCCSINSP------------------------
VTDB_BOVIN/404-471--ELCADYSENTFTEYKKKLAERLRGKFPDATETDLQELVAKRSDFASKCCSVNSP------------------------
Q5FW02_XENTR/405-472--ELCGDYHKYPFLEFKERLNKALSRRVPKLSTSQVKEMVEARSSLASTCCLINAP------------------------
Q9W6F5_CHICK/407-474--QLCGQYTELNFLDFKKRLRDSIRQTRPDASPELLTQLTDQRADFASTCCPANSP------------------------

PF00273

AFAM_MOUSE/220-394QRNVCGALIKFGPKVLNSINVAVFSKKFPKIGFKDLTTLLEDVSSMYEGCCEGDV...VHCIRSQSQ.VVNHICSKQDSI
AFAM_MOUSE/28-202DVDHFNATQKFIDENTTYLAIIAFSQYVQEASFDEVETLVKVMLDYRDRCWADNTL..PECSKTANDAIQDMLCDMEGLP
AFAM_MOUSE/412-590VQQECKQFQELGKDTLQRHFLVKFTKAAPQLPMEELVSLSKEMVAALTTCCTLSDE..FACVDNLADLVLGELCGVNTNR
ALBU_RABIT/28-202KSEIAHRFNDVGEEHFIGLVLITFSQYLQKCPYEEHAKLVKEVTDLAKACVADESA..ANCDKSLHDIFGDKICALPSLR
ALBU_PETMA/240-417SQNLCKALKSLGKEKFEDRIIVRFTQRAPQAPFELIQKLAHRFEVLAEKCCELGHS..DRCLVEERYTVDDELCLEQSFV
Q9YGH6_9NEOB/219-391HKQKCRVLKEFPERVSQALTLVQVSQRFGNAKYDDVEKVTIEIAHLNEDCCKGDA...VECMIERME.ATEHICLAKEKL
ALBU_MOUSE/220-394QRMKCSSMQKFGERAFKAWAVARLSQTFPNADFAEITKLATDLTKVNKECCHGDL...LECADDRAE.LAKYMCENQATI
FETA_GORGO/28-202IASILDSYQCTAEISLADLATIFFAQFVQEATYKEVSKMVKDALTAIEKPTGDEQS..AGCLENQLPAFLEELCHEKEIL
FETA_RAT/34-204IESTLDSSQCPTEKNMFNVATIVVAQFVQDATKAEVNKMSSDALAAMKENTGD......GCLENQLSVFLDEICHETELS
ALBU_CHICK/31-206KSEIAHRYNDLKEETFKAVAMITFAQYLQRCSYEGLSKLVKDVVDLAQKCVANEDA..PECSKPLPSIILDEICQVEKLR
ALBU_HUMAN/28-202KSEVAHRFKDLGEENFKALVLIAFAQYLQQCPFEDHVKLVNEVTEFAKTCVADESA..ENCDKSLHTLFGDKLCTVATLR
ALBU_BOVIN/219-393QRLRCASIQKFGERALKAWSVARLSQKFPKAEFVEVTKLVTDLTKVHKECCHGDL...LECADDRAD.LAKYICDNQDTI
VTDB_HUMAN/216-385SNRVCSQYAAYGEKKSRLSNLIKLAQKVPTADLEDVLPLAEDITNILSKCCESAS...EDCMAKELPEHTVKLCDNLSTK
FETA_HORSE/220-394NQHVCAVIRNFGPRTLQAITVTTLSQRYSKANFTEIQKLVLDVAHAHEECCRGNV...EECVQDGEK.LISYVCSQEDIL
ALBU_HORSE/28-201KSEIAHRFNDLGEKHFKGLVLVAFSQYLQQCPFEDHVKLVNEVTEFAKKCAADESA..ENCDKSLHTLFGDKLCTVATLR
ALBU_CHICK/224-398QQYFCGILKQFGDRVFQARQLIYLSQKYPKAPFSEVSKFVHDSIGVHKECCEGDM...VECMDDMAR.MMSNLCSQQDVF
ALBU_PETMA/1041-1217VQHICGSLHSRGEETFIQREVTLLSQKAPNASFEKVSQLARHFLSLAKKCCAPDHA..AGCFLEEPYAIHDEVCRDDEVV
ALBU_BOVIN/28-201KSEIAHRFKDLGEEHFKGLVLIAFSQYLQQCPFDEHVKLVNELTEFAKTCVADESH..AGCEKSLHTLFGDELCKVASLR
O42279_PETMA/145-322AAQLCSSLQALGAQKFLGRMVLVFSQRAPNATFDQISKLSHRFHSYAQTCCGEGWS..PGCFAEQRHLIHDEMCHDMEAL
ALBUB_XENLA/219-393QHHFCWILDNFPEKVLKALNLARVSHRYPKAEFKLAHNFTEEVTHFIKDCCHDDM...FECMTERLE.LTEHTCQHKDEL
FETA_GORGO/220-394NQHACAVMKNFGTRTFQAITVTKLSQKFTKVNFTEIQKLVLDVAHVHEHCCRGDV...LDCLQDGEK.IMSYICSQQDTL
ALBU1_SALSA/22-196QNQICTIFTEAKEDGFKSLILVGLAQNLPDSTLGDLVPLIAEALAMGVKCCSDTPP..EDCERDVADLFQSAVCSSETLV
ALBU_PIG/28-201KSEIAHRFKDLGEQYFKGLVLIAFSQHLQQCPYEEHVKLVREVTEFAKTCVADESA..ENCDKSIHTLFGDKLCAIPSLR
FETA_HORSE/28-202IASALDSFQCSPEMNLVDLATIFFAQFVQEATYKEVSKMVKDVLTVTEKSTGSEQP..TGCSENRLSAFLEEICHEEEIP
FETA_MOUSE/408-588SKQSCALYQTLGDYKLQNLFLIGYTRKAPQLTSAELIDLTGKMVSIASTCCQLSEEKWSGCGEGMADIFIGHLCIRNEAS
ALBU_PETMA/1235-1413GNLTCQRLKAQGVEHFEQLVILNFARAAKSLPMEKVVEFAHRFTRIAGQCCEHDT....HCLIDESFHLHAEMCGDHGYI
AFAM_HUMAN/412-590VQQECKHFQNLGKDGLKYHYLIRLTKIAPQLSTEELVSLGEKMVTAFTTCCTLSEE..FACVDNLADLVFGELCGVNENR
ALBU1_SALSA/214-390LRSLCIVHKKYGDRVVKAKKLVQYSQKMPQASFQEMGGMVDKIVATVAPCCSGDM...VTCMKERKT.LVDEVCADESVL
ALBU_MERUN/29-203KSEIAHRYKDLGEKYFKGLVLYTFSQYLQKCSYEEHVKLVREVTDFASNCAKDESA..ENCDKSLHTLFGDKLCSLPNFG
VTDB_HUMAN/25-199KNKVCKEFSHLGKEDFTSLSLVLYSRKFPSGTFEQVSQLVKEVVSLTEACCAEGAD..PDCYDTRTSALSAKSCESNSPF
Q9YGH6_9NEOB/29-201PRIINDIVKAVGKPAVEKLVLVMVAQDFEKCSLDEHLKVQAKIIEAVDNCEKHPEE..AECKKPAIELYHDIVCKEEDID
ALBU_FELCA/28-202QSEIAHRFNDLGEEHFRGLVLVAFSQYLQQCPFEDHVKLVNEVTEFAKGCVADQSA..ANCEKSLHELLGDKLCTVASLR
ALBU_HORSE/219-393ERLKCSSFQNFGERAVKAWSVARLSQKFPKADFAEVSKIVTDLTKVHKECCHGDL...LECADDRAD.LAKYICEHQDSI
ALBU_MOUSE/28-202KSEIAHRYNDLGEQHFKGLVLIAFSQYLQKCSYDEHAKLVQEVTDFAKTCVADESA..ANCDKSLHTLFGDKLCAIPNLR
ALBU_RABIT/220-394ERLRCASIQKFGDRAYKAWALVRLSQRFPKADFTDISKIVTDLTKVHKECCHGDL...LECADDRAD.LAKYMCEHQETI
FETA_MOUSE/28-198IASTLDSSQCVTEKNVLSIATITFTQFVPEATEEEVNKMTSDVLAAMKKNSGD......GCLESQLSVFLDEICHETELS
ALBU_MACMU/212-386QRLKCASLQKFGDRAFKAWAVARLSQKFPKAEFAEVSKLVTDLTKVHTECCHGDL...LECADDRAD.LAKYMCENQDSI
Q91134_NAJNA/31-206QHSTIRLASQISATDFGAITLTLVTQTVPNATLEDLKKLSAEIIELHKKCVASEFS.DPPCTKPLGIVFLDVLCHNEEFS
ALBUA_XENLA/31-202HKHIADMYNLLTERTFKGLTLAIVSQNLQKCSLEELSKLVNEINDFAKSCTGNDKT..PECEKPIGTLFYDKLCADPKVG
FETA_MOUSE/216-390NEHVCSVIRKFGSRNLQATTIIKLSQKLTEANFTEIQKLALDVAHIHEECCQGNS...LECLQDGEK.VMTYICSQQNIL
AFAM_HUMAN/28-202DIENFNSTQKFIEDNIEYITIIAFAQYVQEATFEEMEKLVKDMVEYKDRCMADKTL..PECSKLPNNVLQEKICAMEGLP
AFAM_HUMAN/220-394QKHVCGALLKFGTKVVHFIYIAILSQKFPKIEFKELISLVEDVSSNYDGCCEGDV...VQCIRDTSK.VMNHICSKQDSI

PF09164

VTDB_HUMAN/405-472-----------------PLYCDSEIDAELKN-------------------------------------------------
VTDB_RAT/405-472-----------------PRYCSSQIDAEMRD-------------------------------------------------
VTDB_RABIT/405-472-----------------PNYCDSEIDAEIKN-------------------------------------------------
VTDB_BOVIN/404-471-----------------PLYCNSEIDAEINT-------------------------------------------------
Q5FW02_XENTR/405-472-----------------PVYCREMINKFLNS-------------------------------------------------
Q9W6F5_CHICK/407-474-----------------PLYCVAQVTAELAS-------------------------------------------------

PF00273

AFAM_MOUSE/220-394S..SKIKVCCEKKTLE.REACIINANKDDRPEGLSLREA..KFTESENVCQERDSDPDKFFAEFIYEYSRRHPDLSTPEL
AFAM_MOUSE/28-202QKHN.FSHCCGKAGFP.RRLCFFYNKKANVGFLPPFPT.....LDPEEKCQAYKNNSESFLHLYMYEVARRNPFVFAPVL
AFAM_MOUSE/412-590TINPAVDHCCKTDFAF.RRHCFEHLKADTTYELPSVSAL..VSALHTDWCQPRKEDLQNKKHRFLVNLVKWMPGITDEEW
ALBU_RABIT/28-202DTYGDVADCCEKKEPE.RNECFLHHKDDKPD.LPPFAR.....PEADVLCKAFHDDEKAFFGHYLYEVARRHPYFYAPEL
ALBU_PETMA/240-417ATCPRLSSCCSLSGSS.RAQCLETVPVLETSDKASPATP...TLPISEQCTLWAGKPVEFHKRVVWQISHRYPTTGVAQV
Q9YGH6_9NEOB/219-391S..SKLSDCCAKGVLE.RTPCILALPNE..EPDLPIELK..EYYEDEHVCENYQKDKRKYLAHFTHDYSRSHQESSPQSC
ALBU_MOUSE/220-394S..SKLQTCCDKPLLK.KAHCLSEVEHDTMPADLPAIAA..DFVEDQEVCKNYAEAKDVFLGTFLYEYSRRHPDYSVSLL
FETA_GORGO/28-202EKYG.LSDCCSQSEEG.RHNCFLAHKKPTPASIPLFQV.....PEPVTSCEAYEEDRETFMNKFIYEIARRHPFLYAPTI
FETA_RAT/34-204NKYG.FSGCCNQSGVE.RHQCLLARKKTAPDSVPPFHF.....PETAESCPAYEENRAMSINTFIYDVSKRNPFLYAPTI
ALBU_CHICK/31-206DSYGAMADCCSKADPE.RNECFLSFKVSQPDFVQPYQR.....PASDVICQEYQDNRVSFLGHFIYSVARRHPFLYAPAI
ALBU_HUMAN/28-202ETYGEMADCCAKQEPE.RNECFLQHKDDNPN.LPRLVR.....PEVDVMCTAFHDNEETFLKKYLYEIARRHPYFYAPEL
ALBU_BOVIN/219-393S..SKLKECCDKPLLE.KSHCIAEVEKDAIPENLPPLTA..DFAEDKDVCKNYQEAKDAFLGSFLYEYSRRHPEYAVSVL
VTDB_HUMAN/216-385N..SKFEDCCQEKTAMDVFVCTYFMPAAQLPELPDVEL.....PTNKDVCD...PGNTKVMDKYTFELSRR.THLPEVFL
FETA_HORSE/220-394S..SSIVECCKLPTVE.LAQCIIHAENDDKPEGLSPNLN..RLLGERDFNQFSSKEKDLFMARFTYEYSRRHTKLAVPVI
ALBU_HORSE/28-201ATYGELADCCEKQEPE.RNECFLTHKDDHPN.LPKLK......PEPDAQCAAFQEDPDKFLGKYLYEVARRHPYFYGPEL
ALBU_CHICK/224-398S..GKIKDCCEKPIVE.RSQCIMEAEFDEKPADLPSLVE..KYIEDKEVCKSFEAGHDAFMAEFVYEYSRRHPEFSIQLI
ALBU_PETMA/1041-1217DQVGGLATCCRMSGTS.RAKCLAQLPRDLGRHGNRETP....EFDELKICELRRDNPAVLMEKILYEFGRRHSDSAVSEV
ALBU_BOVIN/28-201ETYGDMADCCEKQEPE.RNECFLSHKDDSPD.LPKLK......PDPNTLCDEFKADEKKFWGKYLYEIARRHPYFYAPEL
O42279_PETMA/145-322SRVPAMAKCCQISGSA.RAKCMETIPRGKPVLDVALAR.....FDGHKVCQMNAEAPQELLGRMLYEFGRRHTDASVGEA
ALBUB_XENLA/219-393S..SKLEKCCNIPLLE.RTYCIVTLENDDVPAELSQPIT..EFTEDPHVCEKYAENNEVFLGRYLHAVSRKHQELSEQFL
FETA_GORGO/220-394S..NKITECCKLTTLE.RGQCIIHAENDEKPEGLSPNLN..RFLGDRDFNQFSSGEKNIFLASFVHEYSRRHPQLAVSVI
ALBU1_SALSA/22-196EKND.LKMCCEKTAAE.RTHCFVDHKAKIPRDLSLKAE.....LPAADQCEDFKKDHKAFVGRFIFKFSKSNPMLPPHVV
ALBU_PIG/28-201EHYGDLADCCEKEEPE.RNECFLQHKNDNPD.IPKLK......PDPVALCADFQEDEQKFWGKYLYEIARRHPYFYAPEL
FETA_HORSE/28-202EKYG.LSGCCSQNEEE.RHNCLLARKKDSPASIPPFQV.....PEPVTSCKAYEENREMFLNRYLYEIARRHPFLYSSTA
FETA_MOUSE/408-588PVNSGISHCCNSSYSN.RRLCITSFLRDETYAPPPFSED..KFIFHKDLCQAQGKALQTMKQELLINLVKQKPELTEEQL
ALBU_PETMA/1235-1413MAHPGVANCCKSDVSE.QGTCFKIHEDVHHAEEILSKDVSPAHPTAERVCLRYRQFPEKFINLALFELVHRLPLLESSVL
AFAM_HUMAN/412-590TINPAVDHCCKTNFAF.RRPCFESLKADKTYVPPPFSQD..LFTFHADMCQSQNEELQRKTDRFLVNLVKLKHELTDEEL
ALBU1_SALSA/214-390SRAAGLSACCKEDAVH.RGSCVEAMKPDPKPDGLSEHYD..IHADIAAVCQTFTKTPDVAMGKLVYEISVRHPESSQQVI
ALBU_MERUN/29-203EKYAEMADCCAKQEPE.RNECFLQHKDDNPQ.LPPFKR.....AEPDAMCTAFQENAEAFMGHYLHEVARRHPYFYGPEL
VTDB_HUMAN/25-199PVHPGTAECCTKEGLE.RKLCMAALK....HQPQEFPTY..VEPTNDEICEAFRKDPKEYANQFMWEYSTNYGQAPLSLL
Q9YGH6_9NEOB/29-201QLYPWTTECCGKAEAE.RTKCFYEHREVR...VEEYKI.....PNIEESCKEHKEHPQRAFSYYLSNIAKRHSKLYPPAV
ALBU_FELCA/28-202DKYGEMADCCEKKEPE.RNECFLQHKDDNPG.FGQLVT.....PEADAMCTAFHENEQRFLGKYLYEIARRHPYFYAPEL
ALBU_HORSE/219-393S..GKLKACCDKPLLQ.KSHCIAEVKEDDLPSDLPALAA..DFAEDKEICKHYKDAKDVFLGTFLYEYSRRHPDYSVSLL
ALBU_MOUSE/28-202ENYGELADCCTKQEPE.RNECFLQHKDDNPS.LPPFER.....PEAEAMCTSFKENPTTFMGHYLHEVARRHPYFYAPEL
ALBU_RABIT/220-394S..SHLKECCDKPILE.KAHCIYGLHNDETPAGLPAVAE..EFVEDKDVCKNYEEAKDLFLGKFLYEYSRRHPDYSVVLL
FETA_MOUSE/28-198NKYG.LSGCCSQSGVE.RHQCLLARKKTAPASVPPFQF.....PEPAESCKAHEENRAVFMNRFIYEVSRRNPFMYAPAI
ALBU_MACMU/212-386S..SKLKECCDKPLLE.KSHCLAEVENDEMPADLPSLAA..DYVESKDVCKNYAEAKDVFLGMFLYEYARRHPDYSVMLL
Q91134_NAJNA/31-206NKYG.INDCCAKADPD.RNECVLSHKTSSTGTISPFVH.....PNAEEACQAFQNDRDSVLAQYIFELSRRYPTALSVVI
ALBUA_XENLA/31-202VNYEWSKECCSKQDPE.RAQCFRAHRVFEHN...PVR......PKPEETCALFKEHPDDLLSAFIHEEARNHPDLYPPAV
FETA_MOUSE/216-390S..SKIAECCKLPMIQ.LGFCIIHAENGVKPEGLSLNPS..QFLGDRNFAQFSSEEKIMFMASFLHEYSRTHPNLPVSVI
AFAM_HUMAN/28-202QKHN.FSHCCSKVDAQ.RRLCFFYNKKSDVGFLPPFPT.....LDPEEKCQAYESNRESLLNHFLYEVARRNPFVFAPTL
AFAM_HUMAN/220-394S..SKIKECCEKKIPE.RGQCIINSNKDDRPKDLSLREG..KFTDSENVCQERDADPDTFFAKFTFEYSRRHPDLSIPEL

PF09164

VTDB_HUMAN/405-472--------------------------
VTDB_RAT/405-472--------------------------
VTDB_RABIT/405-472--------------------------
VTDB_BOVIN/404-471--------------------------
Q5FW02_XENTR/405-472--------------------------
Q9W6F5_CHICK/407-474--------------------------

PF00273

AFAM_MOUSE/220-394LRITKVYMDFLEDCCS..RENPAGCY
AFAM_MOUSE/28-202LAVAAWFEEAATTCCE..QQQKATCF
AFAM_MOUSE/412-590LCLFTKFTAAREECSE..VQEPESCF
ALBU_RABIT/28-202LYYAQKYKAILTECCE..AADKGACL
ALBU_PETMA/240-417EALAHHYLEHLTICCA..SEDKDTCI
Q9YGH6_9NEOB/219-391LRVSRGFEMLLEKCCA..SANSAECL
ALBU_MOUSE/220-394LRLAKKYEATLEKCCA..EANPPACY
FETA_GORGO/28-202LLWAARYDKIIPSCCK..AENAVECF
FETA_RAT/34-204LYLAAQYDKAVPACCK..ADNMEECF
ALBU_CHICK/31-206LSFAVDFEHALQSCCK..ESDVGACL
ALBU_HUMAN/28-202LFFAKRYKAAFTECCQ..AADKAACL
ALBU_BOVIN/219-393LRLAKEYEATLEECCA..KDDPHACY
VTDB_HUMAN/216-385SKVLEPTLKSLGECCD..VEDSTTCF
FETA_HORSE/220-394LRVAKGYQEFLEKCSQ..SENPLECQ
ALBU_HORSE/28-201LFHAEEYKADFTECCP..ADDKLACL
ALBU_CHICK/224-398MRIAKGYESLLEKCCK..TDNPAECY
ALBU_PETMA/1041-1217KNFAQKFSHSVTECCT..SEKTHECF
ALBU_BOVIN/28-201LYYANKYNGVFQECCQ..AEDKGACL
O42279_PETMA/145-322KKIITEWMDGVKDCCAGNHSEEQACL
ALBUB_XENLA/219-393LQSAKEYESLLNKCCK..TDNPPECY
FETA_GORGO/220-394LRVAKGYQELLEKCFQ..TENPLECQ
ALBU1_SALSA/22-196LAIAKGYGEVLTTCCG..EAEAQTCF
ALBU_PIG/28-201LYYAIIYKDVFSECCQ..AADKAACL
FETA_HORSE/28-202LYLASHYDKIISACCK..SENAVECF
FETA_MOUSE/408-588AAVTADFSGLLEKCCK..AQDQEVCF
ALBU_PETMA/1235-1413RRKALAYTGFTDDCCR..AVDKTACF
AFAM_HUMAN/412-590QSLFTNFANVVDKCCK..AESPEVCF
ALBU1_SALSA/214-390LRFAKEAEQALLQCCD..MEDHAECV
ALBU_MERUN/29-203LYLADKYTAVLTECCA..ADDKGACL
VTDB_HUMAN/25-199VSYTKSYLSMVGSCCT..SASPTVCF
Q9YGH6_9NEOB/29-201LGFAIQYNEITTECCA..AEDKAKCF
ALBU_FELCA/28-202LYYAEEYKGVFTECCE..AADKAACL
ALBU_HORSE/219-393LRIAKTYEATLEKCCA..EADPPACY
ALBU_MOUSE/28-202LYYAEQYNEILTQCCA..EADKESCL
ALBU_RABIT/220-394LRLGKAYEATLKKCCA..TDDPHACY
FETA_MOUSE/28-198LSLAAQYDKVVLACCK..ADNKEECF
ALBU_MACMU/212-386LRLAKAYEATLEKCCA..AADPHECY
Q91134_NAJNA/31-206LESTKTYKKILETCCA..EADKDACI
ALBUA_XENLA/31-202LLLTQQYGKLVEHCCE..EEDKDKCF
FETA_MOUSE/216-390LRIAKTYQEILEKCSQ..SGNLPGCQ
AFAM_HUMAN/28-202LTVAVHFEEVAKSCCE..EQNKVNCL
AFAM_HUMAN/220-394LRIVQIYKDLLRNCCN..TENPPGCY

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window