Sequence alignment for CL0293

PF01289

TACY_STRPN/2-468ANKAVNDFILAMNYDKKKLLTHQGESIENRFIKEGNQLPDEFVVIERKKRSLSTNTSDISVTATNDSRLYPGALLV----
TACY_STRP1/105-570HTEEINDKIYSLNYNELEVLAKNGETIENFVPKEGVKKADKFIVIERKKKNINTTPVDISIIDSVTDRTYPAALQL----
TACY_PAEAL/37-501PND.IDMGIAGLNYNRNEVLAIQGDQISSFVPKEGIQSNGKFIVVERDKKSLTTSPVDISIVDSITNRTYPGAIQL----
TACY_LISIV/56-523NAAQIDQYIQGLDYDKNNILVYDGEAVKNVPPKAGYKEGNQYIVVEKKKKSINQNNADIQVINSLASLTYPGALVK----
TACY_LISMO/57-524HADEIDKYIQGLDYNKNNVLVYHGDAVTNVPPRKGYKDGNEYIVVEKKKKSINQNNADIQVVNAISSLTYPGALVK----

PF01823

A0T3F5_ACRMI/321-527----------------------AYFKANVKV.SSKNE......ELHEASYSYVKSQAVCSYYKGSI..FPDLPPR.....
A1E348_TOXGO/562-791----------------------NSFSASTGY.RDFAK......EVSKKDTRTYMLKNYCMRYEAGVAQSNHFKWN.....
A0SEH2_PIG/282-508----------------------STSDKGKRFISRTK.......RFSHTKSTFLHARSDLEVARYKL...KSRNLM.....
Q8IB27_PLAF7/139-408----------------------HPFNDSNYY.KMLV.......KRINRGDSIIIEKKLCSKYFSFI..NDINKND.....
Q6PFT2_DANRE/240-463----------------------IDLANEPLYREAVK.......ASQQKDSVFYRVHQVIATSTFKV...KSSDLY.....
Q4RWM0_TETNG/144-362----------------------MLAGTQSKL.AEYSM.....EKTKNDKFSFASQSTSCVFYSYRLSSSPT.........
Q22CA7_TETTS/139-349----------------------ASFSASADF.KQMKD......TLSQKDTQCIQSHATCTAFDLSFYNDINSLPL.....
Q4MYP2_THEPA/89-325----------------------YSGYNNDEY.THDDM.....LHNLNKHNKLLIKSYKCIVYKANL..TSL.NFLKNKNN
TX60A_PHYSE/126-348----------------------GAYTLGVSV.AAVTN......NIASSEEEVQGLSLNLKAYSMSSILKKNCVNTK....
Q5M7M6_XENTR/258-494----------------------LGYSKNKSVQRLRQ.......YSETKDKTYMRVSGTVQLASFQM...RTRGAM.....
NSL1_ARATH/109-324----------------------GMFNNMFAF.SKCWP......KDASSVKTLAYDGWFISLYSVEI..VRK.QLT.....
Q4SUR7_TETNG/132-350----------------------AVGGSHSRS.SQFAS.....SHSRKDKFSFTTHNLKCSYYTFRIHSRPP.........
A8GEE9_SERP5/117-324----------------------FSASATNEF.SDS........SLRKSENEFSRCQQSFDLWSISI......PADIARLQ
Q5W1L1_ONCMY/293-522----------------------VSGNVESALLTNLT.......KYTNQELGFIRLQSKVQTAQFKM...RSEGLM.....
Q6DBQ7_DANRE/163-385----------------------VEFSAEFMFLNNIS.......KYTNKEMGFVQLMSKIQTSQFKM...RSKDLV.....
Q4SP15_TETNG/268-494----------------------YNSAKYSKSVKKLR.......RVSGKSYSFVRAKAQLELAQYML...KSNDLM.....
Q6H965_ONCMY/224-445----------------------TTGFNNYDLHQT.........EEKNRNNHLLVVKNNVEVAQFQN..QAPGYLS.....
Q4T1D8_TETNG/231-450----------------------LWGHDRRKFHKT.........VTESRAHRLIILKNKVELAQFQN..TAPEYLT.....
CO9_ONCMY/242-472----------------------AEYDRTQMIKEVSE.......YTTIKNKSFMRVNGRVQLSTYRM...RSRDLQ.....
O84155_CHLTR/410-619----------------------FSGSLTCEFVKK.........STQHAKNTVTCSTAAHSLYTLKE......DDSSNPSE
Q498V9_DANRE/220-439----------------------RGGHDHKTFHNQ.........LKQDKTYHLLIIRNEVEVAQFQN..NAPEYLP.....
Q23QV7_TETTS/139-349----------------------ASFSASADF.QQMQD......TLSQKDNQCIHSFATCSAFDLSFYNDPNSIPL.....
Q4XY78_PLACH/215-440----------------------GSFSASTGY.KKFIN......EVSKRTSKTYFIKSNCIKYTIGL..PPYVPWE.....
A0SEH0_PIG/291-514----------------------QTSSHNSAFKQAIQ.......ASHKKDSSFIRIHKVIKVLNFTM...KTKDLQ.....
Q6DK87_XENTR/264-490----------------------LNYGLKTSFLKKIT.......SFNQKNLEFVRMVTKIQTARFKM...RRNLLT.....
Q4N9F0_THEPA/681-905----------------------FSFSASTGY.KNFVK......STATNKVRTYITKTYCLRYVGGI..VDYHSLD.....
Q503Q0_DANRE/121-337----------------------LNGKFSEEN.TRM........KIHQVRGNSVTTRVQVRNHLYTV..NAYPDFT.....
Q4MYP3_THEPA/129-351----------------------VNYEHKLEN.KSL........NKLLTKNNLSIKKINCSIHTSGM..IISYQWK.....
Q4SP14_TETNG/273-499----------------------LGGSQESEFFHNVT.......HYKSTDLGFVRLWSKVETAHFKM...RSDKLM.....
Q9JRT3_CHLPN/15-224----------------------FSASFSYEFVKS.........STRESKNTVTHSTASRTLYILRQ......DCSYDPRA
Q4MYN1_THEPA/127-337----------------------ELWNRNSKG.LGLN.......DITFNKSKFKIVKCYCSLYESGL..ITPFHGE.....
Q23I78_TETTS/118-326----------------------ISLGINHEL.DQFHQ......EITQNNKAVSVSQSYWAQYSLTT..APAFLMP.....
Q653N7_ORYSJ/105-322----------------------GLFNSCFDFGSDSWA......SDAGDTRCLAFDGYFISLLDLRL..DCR.PLA.....
Q22CA8_TETTS/139-351----------------------GRFRASVDY.QNMQN......DMASGTYQYIVSNSRCSVFQLDLIDSPTYHPQ.....
Q1ENV5_MUSAC/18-204----------------------GSFNSMFSF.TGSWK......VDAAATKALAMDGFYFPLYKAKL..ISD.DLL.....
Q4Y6N1_PLACH/479-703----------------------YSFSASAGY.KNALK......KLKIQNSIIFMMKIYCLRYYTGI.STTTNTWE.....
Q4Y3F0_PLACH/139-383----------------------HPFNSSNYY.RMLV.......ERIEKGYSIIIDKKICSRYFVAL..KNVDSSK.....
Q6I604_ORYSJ/118-331----------------------GAFNAMFDY.HGCWH......KDAAATGSLCFDGRFIELYAVEA..PRA.HLA.....
Q4N2L1_THEPA/109-327----------------------NSFTGSLEY.KNALM......NFKSKRQKIYNKTEQCVRYQVGI..PLNLKWG.....
Q23QV5_TETTS/142-348----------------------GKFSASSDY.QEVQD......GLNSANIQYIESQARCSIFQLDVYNSPSQNAQ.....
Q32N46_XENLA/145-359----------------------AMAGAQSKM.VQFAF.....EKLHLDKYTFLSHKFECEYYSFQMSRHWN.........
Q1MTI0_DANRE/134-352----------------------AVGGTHSKS.ARFAR.....SHASKDKFSYTSHTFSCRYYSFRLHARPP.........
Q8IB29_PLAF7/119-370----------------------KPFSASMPY.KSYFA......DLEIKKKKYALAQNMCVLNYATYDLKESGNN......
Q4MYP0_THEPA/120-344----------------------AKFSLSTNY.SEISD......LLKNNDNKLYVDKSYCFLLEAAL..PIHNSLK.....
Q4XPE5_PLACH/64-292----------------------GSFSASVGY.ASASN......TISKKKFRMFILKSYCFKYVASL..SQYSQWK.....
Q4RL61_TETNG/125-342----------------------LNGKFSTEN.QRM........KIHQVKDSSVTTRVQIRNFIYKV..KVFPDFS.....
Q4SMI5_TETNG/282-498----------------------VVGGSQSSA.YKYAI.....ARTREDRHFFSLHRVTCSHYSYRV..SS..KPI.....
Q54I05_DICDI/30-225----------------------ISAEVKSKF.SKESL......DVKVGKEVYLTSSVSVPRLEFCI...NPLKVK.....
Q6INM0_XENLA/212-434----------------------TSNHGYYHYHKDTQS......NTKEKNYQLMVIKNHVEVAQFIN..QKPEFLI.....
Q4Z2G1_PLABA/126-386----------------------NPFSASIPY.KGYFT......DLEIKKRKYIVAENTCLHSYATYSLRESIKN......
Q6RYF8_HALRU/131-348----------------------VSGTFSSGY.ESV........KSKQIGDKSYTTRVQLRYVRYSA..KLQPDAA.....
PERF_MOUSE/145-366----------------------SVAGSHSKV.ANFAA.....EKTYQDQYNFNSDTVECRMYSFRLVQKPP.........
MACP1_ARATH/106-325----------------------GNFNATFGFQSGSWA......TDAANVKSLGLDASVVTLFNLHI..HNPNRLR.....
A0BCZ0_PARTE/148-361----------------------WAFTASSEF.NHMQQ......KIEQTSATFVISMATCQIAQITQVPELAE........
A0SEG9_PIG/276-505----------------------FTYSKTETYKLLLS.......YSSKKEKIFLHVKGVIHLGRFVM...RKRDVM.....
Q4W1E5_SUBDO/94-327----------------------TSFSYSQCK.VTYDRRYLIPDETFAIPIKTSTIDYQAELFDHWDAYKSVTSRS.....
A0SEH1_PIG/270-495----------------------LSGSRESAFLNKLS.......TYNEKKYSFIRIFTKVQTASFMM...RRDNIM.....
MPEG1_MOUSE/125-341----------------------VNGKFSTEF.QRM........KTLQVKDQAVTTRVQVRNRIYTV..KTTPTSE.....
Q4T0Y8_TETNG/194-450----------------------TTGYRNYDFRET.........EDRTRMQKLLVLKNEIEVAQFQS..NSPQYIP.....
O76288_HELER/134-362----------------------VKFSASHRY.ESISNDA..STKGYVYSSEQTIQNFGHMRYLTSL..AEHDGFE.....
Q4RL62_TETNG/147-365----------------------VLGGSRSDL.AKFAR.....SQHSVDKATFAIHEISCTYYSYRL..AD..HPQ.....
Q64VU4_BACFR/120-323----------------------FSGSLSSSF.SST........QHYTSKYSIADYTSFIRRRRLFL......TASTELLS
Q4N2L3_THEPA/168-367----------------------GTGSLNTQY............QELKKDSEHTNNKLS......................
CO7_HUMAN/230-448----------------------SSSRSYTSHTNE.........IHKGKSYQLLVVENTVEVAQFIN..NNPEFLQ.....
Q5JN47_ORYSJ/106-319----------------------GFFNAMFEF.TGCWQ......KDASITKSLAFDGWCITLYTVAL..SKA.HII.....
Q4N5X6_THEPA/441-666----------------------FKFSASAKF.KKLQD......VSKSGKSKMFINKSYCFKYVAGI..STSLKWD.....
Q6IR82_XENLA/294-518----------------------TKSWASSSFREAIT.......ATRQKSSKFIRINKLILVSDFTM...KKDNLW.....
Q969A3_BRABE/302-522----------------------VSHSQSRMTHEVIE.......SAQKIDSKYFKVMNTVELAQFKM...RRSDLN.....
Q117U3_TRIEI/85-286----------------------FLGEIENRF.DMSDD......KSSKRTNEYISYDINNTLYRITL..KG..NVP.....

PF01289

TACY_STRPN/2-468--VDETL-----LENNPTLLAV-DRAPMTYSIDLPGLASSDSFLQVEDPSNSSVRGAVNDLLAKWHQDYGQVN.NVPARM
TACY_STRP1/105-570--ANKGF-----TENKPDAVVT-KRNPQKIHIDLPGMGD.KATVEVNDPTYANVSTAIDNLVNQWHDNYSGGN.TLPART
TACY_PAEAL/37-501--ANKDF-----ADNQPSLVMA-ARKPLDISIDLPGLKN.ENTISVQNPNYGTVSSAIDQLVSTWGEKYSSTH.TLPARL
TACY_LISIV/56-523--ANSEL-----VENQPDVLPV-KRDSVTLSIDLPGMVNHDNEIVVQNATKSNINDGVNTLVDRWNNKYSEEYPNISAKI
TACY_LISMO/57-524--ANSEL-----VENQPDVLPV-KRDSLTLSIDLPGMTNQDNKIVVKNATKSNVNNAVNTLVERWNEKYAQAYPNVSAKI

PF01823

A0T3F5_ACRMI/321-527..LTPQI.....LATMKKCSDN.PTDDN.............................FNNLVEYFGTHY-----------
A1E348_TOXGO/562-791..VTLAF.....AAGVSQLPDV.FDAHNPECACSAEQWRQDQ...NAEACTKTNVPIWISFIEQFGTHF-----------
A0SEH2_PIG/282-508..LHYEF.....LQRVKQLPLE.YSYGE.............................YRDLFRDFGTHY-----------
Q8IB27_PLAF7/139-408..LDTFF.....LTTLNELGDN.YQNIKDDTYKCSLQYYKMNNMNKYSENCLKTITPWISFFNMYGTHV-----------
Q6PFT2_DANRE/240-463..LSDPF.....LQFLNSLPLE.YNYAL.............................YRHIFQLFGTHY-----------
Q4RWM0_TETNG/144-362..LSQEF.....RKAVRGLPKT.YSPENKLK..........................FYRLIDTFGTHY-----------
Q22CA7_TETTS/139-349..LSLQL.....VDKIQQLYSY.SNYTNEKE.........................YYYDFFDSWGTHV-----------
Q4MYP2_THEPA/89-325DEIGLNFNGMLILNVLKKLNKN.CNSEFDNQKCPISMFRNDP....FDANCIRCIMPWMEFFKDYGTFM-----------
TX60A_PHYSE/126-348.PLSKDL.....VSDFEALDSE.ITKPWKLSSW......................KKYKVLLEKYGSRI-----------
Q5M7M6_XENTR/258-494..LSPTF.....IEDIKSLPRD.YDKAE.............................YFSILEMYGTHY-----------
NSL1_ARATH/109-324..LRDEV........KREVPSS.WDSAALAG.............................FIEKYGTHV-----------
Q4SUR7_TETNG/132-350..LSKEF.....EESLKNLPST.YDHKNTSA..........................FTQFLSVYGTHF-----------
A8GEE9_SERP5/117-324NYVSDDF.....IKLINAINPE.SKDSIAT..............................VFNVYGSHV-----------
Q5W1L1_ONCMY/293-522..LHEDM.....YLSLMELPEEKYDFGL.............................YSRFLNTYGTHY-----------
Q6DBQ7_DANRE/163-385..LDEDM.....LWALSDLPDH.YHFGA.............................YSQFFNEYGTHY-----------
Q4SP15_TETNG/268-494..LHPEF.....LHRLRALPLS.YVYGE.............................YRQIFQDYGTHY-----------
Q6H965_ONCMY/224-445..LSEEF.....WKVLATLPTV.YDYAT.............................YRMVVERFGTHY-----------
Q4T1D8_TETNG/231-450..LAEGF.....WRALSSLPTT.YDYAA.............................YRQLFQTYGTHY-----------
CO9_ONCMY/242-472..VAGEF.....LEHVKSLPLE.YEKGQ.............................YFSFLEDYGTHY-----------
O84155_CHLTR/410-619KRLDSCF.....RNWIENKLSA.NSPDSWSA.............................FIQKFGTHY-----------
Q498V9_DANRE/220-439..LSEDF.....WKDLSALPIT.YEPSA.............................YRLFIQRYGTHY-----------
Q23QV7_TETTS/139-349..LSLQL.....VDKIQQLYSY.SNYTNERE.........................YYYDFFDSWGTHV-----------
Q4XY78_PLACH/215-440..QTTAY.....MNAVGILPKE.FTGLNEDSCAPDVYEQKK......MTKQCKNVHQWIQFFKTYGTHI-----------
A0SEH0_PIG/291-514..LSDVF.....LKALNHLPLE.YNAAL.............................YSRIFDDFGTHY-----------
Q6DK87_XENTR/264-490..LDEDA.....MQSLMELPDE.YNYGL.............................YAQFINDFGTHY-----------
Q4N9F0_THEPA/681-905..TTDEF.....KKAVEALPDK.FDSHSCTIETFKSNEDD........SICAETVLPWMQFIKMFGTHF-----------
Q503Q0_DANRE/121-337..LDSRF.....SQQISELADA.IENNQTRQAM......................YLSEKVILEYGTHV-----------
Q4MYP3_THEPA/129-351..LKKSI.....SILLNDIQNK.LVKDSGHTSNSNPQK...........NQKNIEKDWYNIFNTYGTHV-----------
Q4SP14_TETNG/273-499..LHEDF.....YISLMDLPEQ.YDFGM.............................YSRFFNTYGTHY-----------
Q9JRT3_CHLPN/15-224LKVDDEF.....RYWVEKRLDA.KNPDSLNA.............................FVKEVGTHY-----------
Q4MYN1_THEPA/127-337..LRGEF.....VEMVGKLPNT.VESTECPIDIFITEL...........ESCKNLRIWINLFKTYGTHI-----------
Q23I78_TETTS/118-326..LNPMF.....KQSLDALNRM.AKEPTTDTQQ......................TIYNQVINSFGTHY-----------
Q653N7_ORYSJ/105-322..LAGHV........VADVPAA.WDPSAIAS.............................FIEKYGTHI-----------
Q22CA8_TETTS/139-351..FSNDI.....LLNLQQLALN.QNNANNTEA.......................NAYYDFFDNWGTHV-----------
Q1ENV5_MUSAC/18-204..LRDDV........KRAVPHS.WDPPLLAS.............................FIENFGTHI-----------
Q4Y6N1_PLACH/479-703..FTNNF.....RNALNKLPNT.FDGLKEDNECTYEYYITKS....HSPQCEKNVNKWMTFFKLHGTHV-----------
Q4Y3F0_PLACH/139-383..LDPFF.....INMLNDLEKN.YKNININKYKCSVHSYKKN...KYDQNCLRTITPWITFFNLYGTHL-----------
Q6I604_ORYSJ/118-331..LLDRV........KRDVPPF.WDPAALAE.............................FIDKYGTHV-----------
Q4N2L1_THEPA/109-327..YTEYF.....NRTLSRLPIL.SSKVIKNCNIDNKLNLS........DEECKSIKPWIKFFEVFGTHF-----------
Q23QV5_TETTS/142-348..LTPQL.....QQALFTLAFN.QTSQND............................YYDFIDTWGTHV-----------
Q32N46_XENLA/145-359..LSPHF.....LKALVQLPNY.YNSRSNVQ..........................YQQLIASYGTHY-----------
Q1MTI0_DANRE/134-352..LTKEF.....AGSISSLPAK.FDSTSESA..........................YNHFISIYGTHF-----------
Q8IB29_PLAF7/119-370..INKDF.....VLDIEKLPIL.TKNQMKLCTKVLYMNNN........LHCSEGIKSWMKFFEKYGTHV-----------
Q4MYP0_THEPA/120-344..MTRSF.....ATAMSKLTRD.FKKHTKDCNAIKYSINK.......NNKDCKEIKNWMELFDQFGTHF-----------
Q4XPE5_PLACH/64-292..LSDQF.....LRAINLLPSY.FNSLEHDGKYCNAEELRDNK..TGMDSCGKSVESWLYFFKNFGTHV-----------
Q4RL61_TETNG/125-342..LDVRF.....AQQAKEIADA.IENNQSRYAD......................YLSERMVMDFGTHV-----------
Q4SMI5_TETNG/282-498..LSKEF.....SRDLTSLPHV.YNSVTKPQ..........................YARLILTYGTHY-----------
Q54I05_DICDI/30-225..LSDEF.....YSKLNNVETH.........G........................ELIKVFKEYGEFY-----------
Q6INM0_XENLA/212-434..LSEPF.....WKELASLPSV.YDYNT.............................YRKFIDKYGTHF-----------
Q4Z2G1_PLABA/126-386..INSDF.....LLDTENLPIL.SKSITEKTCSKLIYMYNS.....KNDQCIKFIKPWIDFFRKYGTHV-----------
Q6RYF8_HALRU/131-348..LHPTF.....KSRLLSIAGS.LQLNKTDQAR......................YDSELLVRDFGTHV-----------
PERF_MOUSE/145-366..LHLDF.....KKALRALPRN.FNSSTEHA..........................YHRLISSYGTHF-----------
MACP1_ARATH/106-325..LTDRV........RNAVPSS.WDPQLLAR.............................FIERYGTHV-----------
A0BCZ0_PARTE/148-361..FHQSF.....IDQLSALPVE.YSAPQ.............................YLEFLSNFGTHY-----------
A0SEG9_PIG/276-505..LTKTF.....LDDVKYLPST.YEKGE.............................YFAFLETYGTHY-----------
Q4W1E5_SUBDO/94-327..INAGFD..FFGKIGGEILSL.LKSNDTESAD......................YAAQILIRDYGTHC-----------
A0SEH1_PIG/270-495..LDEVM.....LQSLMELPEQ.YNYGM.............................YAKFIDDYGTHY-----------
MPEG1_MOUSE/125-341..LSLGF.....TKALMDICDQ.LEKNQTKMAT......................YLAELLILNYGTHV-----------
Q4T0Y8_TETNG/194-450..LSEEL.....WKALVKLPSV.YDYAA.............................YRKVLERFGTHY-----------
O76288_HELER/134-362..IAREF.....RIDVCDLPTT.YATNT.............................YMEFLSKWGTSV-----------
Q4RL62_TETNG/147-365..LSAEF.....TKYLRRLPQR.VQTKQDRG.........................PYRRLIDTYGTHY-----------
Q64VU4_BACFR/120-323KYLTKMF.....VDDLSKQSPS.F....................................IIQHYGTHV-----------
Q4N2L3_THEPA/168-367..TTEDF.....NLSVSELPKK.IKDYEKCTPEGYKNRI..........KECKDLVKWMEFFSEFGTHV-----------
CO7_HUMAN/230-448..LAEPF.....WKELSHLPSL.YDYSA.............................YRRLIDQYGTHY-----------
Q5JN47_ORYSJ/106-319..LKDHV........KQAVPST.WEPAALAR.............................FIKKFGTHI-----------
Q4N5X6_THEPA/441-666..FTLGF.....QSSLGRLSD..FKGLEKDSICKPFIYREDP...KNENCQELGISDWMELFNTFGTHV-----------
Q6IR82_XENLA/294-518..LSDVF.....LKALNHLPLE.YNYPL.............................YSRIFDDFGTHY-----------
Q969A3_BRABE/302-522..PSDIF.....LRRMKDLPVY.YNYLD.............................YSFLIEDFGTHY-----------
Q117U3_TRIEI/85-286..LSEQF.....QEDLNSLDAT.T....................................LFEKYGTHY-----------

PF01289

TACY_STRPN/2-468QYEKITAHSMEQLKVKFGSDFEKTGNSLDIDFNSVHSGEKQIQIVNFKQIYYTVSVDAVKNPGDVFQDTVTVEDLKQRGI
TACY_STRP1/105-570QYTESMVYSKSQIEAALNVNSKILDGTLGIDFKSISKGEKKVMIAAYKQIFYTVSANLPNNPADVFDKSVTFKELQRKGV
TACY_PAEAL/37-501QYAESMVYSQNQISSALNVNAKVLNGTLGIDFNAVANGEKKVMVAAYKQIFYTVSAGLPNNPSDLFDDSVTFAELARKGV
TACY_LISIV/56-523DYDQEMAYSESQLVAKFGAAFKAVNNSLNVNFGAISEGKVQEEVINFKQIYYTVNVNEPTSPSRFFGKSVTKENLQALGV
TACY_LISMO/57-524DYDDEMAYSESQLIAKFGTAFKAVNNSLNVNFGAISEGKMQEEVISFKQIYYNVNVNEPTRPSRFFGKAVTKEQLQALGV

PF01823

A0T3F5_ACRMI/321-527-------------------------------IAQGVMGSKFGSESKL.......STEKYEELQSNGIN............
A1E348_TOXGO/562-791-------------------------------LVRLFAGGKMTYQVTA.......KRSEVEKMRNMGID............
A0SEH2_PIG/282-508-------------------------------ITEAVLGGVYEYTLIM.......NKEAMERADYSLKDV........HAC
Q8IB27_PLAF7/139-408-------------------------------ISGVYYGGKIIHNLYF.......ENNNLKKKEYKIRMYKSRLNPFSTIN
Q6PFT2_DANRE/240-463-------------------------------FSSGTLGGKYDLLFQF.......DREELKTFGLKESDS........EYC
Q4RWM0_TETNG/144-362-------------------------------ITKVKLGGEVQSVTSI.......RQCQASLQGLSTEEV........QMC
Q22CA7_TETTS/139-349-------------------------------ATSVRLGSLFGYQFKM.......SSSSVQQQSSLGFD............
Q4MYP2_THEPA/89-325-------------------------------TKEITMGGVINKFYNI.......KKYEGSMRKEYKKK...........T
TX60A_PHYSE/126-348-------------------------------VKESISGSSIYQYVFA.......KSSQKFNHRSFTVK..........AC
Q5M7M6_XENTR/258-494-------------------------------TVSGTVGGKYDLVYVL.......DSIVMKSLDITTEDV........TDC
NSL1_ARATH/109-324-------------------------------VVGVTMGGKDVIHVKQMRK.SNHEPEEIQKMLKHWGDE.......RFCV
Q4SUR7_TETNG/132-350-------------------------------IRRVRLGGHVNSITAI.......RTCQASMSQMSVQTV........SNC
A8GEE9_SERP5/117-324-------------------------------LMSGVMGGKAHVSASA.......NKLTLTQKFEM..............S
Q5W1L1_ONCMY/293-522-------------------------------VTQGIMGGTLEYVAVV.......NTTAMKTSKIDAEQL........KGC
Q6DBQ7_DANRE/163-385-------------------------------VTEGTMGGLMDYVAVV.......NINEMEENQMTGQMI........GSC
Q4SP15_TETNG/268-494-------------------------------ITEAALGGEFEYTIIL.......NKERLEQSDYTLEDY........KKC
Q6H965_ONCMY/224-445-------------------------------LSEGTLGGYFQALLSI.......DQETATQMAKVTWKY........NEC
Q4T1D8_TETNG/231-450-------------------------------FSEGSLGGEYQALLEL.......TQHALATTSTTSREY........ERC
CO9_ONCMY/242-472-------------------------------TRNGKSGGEHQLVYVL.......NQDTIKDKKLTERKL........QDC
O84155_CHLTR/410-619-------------------------------IASATFGGIGFQVLKL.......SFEQVEDLHSKKIS............
Q498V9_DANRE/220-439-------------------------------MEEGSLGGQYRALLEL.......DANYMMEMSRTETDF........HQC
Q23QV7_TETTS/139-349-------------------------------ATSIKLGSLFGYQFIM.......SSSSVQQQSNLGFD............
Q4XY78_PLACH/215-440-------------------------------IVEAQLGGKITKIINV.......SNTAVNQMKKDGVS............
A0SEH0_PIG/291-514-------------------------------FTSGSLGGVYDLLYQF.......SNEELKNSGLTQEEA........KNC
Q6DK87_XENTR/264-490-------------------------------TTSGTMGGLVENIVVL.......DKEIMKKQEITASMV........SHC
Q4N9F0_THEPA/681-905-------------------------------TTIVHLGGKITHQVQI.......DKSDVLHMQQNGIN............
Q503Q0_DANRE/121-337-------------------------------ITSIDAGATLVQEDYI.......KRSYVSDTNSERSS............
Q4MYP3_THEPA/129-351-------------------------------LTKITLGGKIIEINAVEGGQNITENTSIFGSKLDINF............
Q4SP14_TETNG/273-499-------------------------------VTQGTMGGTLEYALVL.......NKTKMAESKLQGEQA........GRC
Q9JRT3_CHLPN/15-224-------------------------------VASVTYGGIGFQVLKM.......SYLQVEELEKEKIS............
Q4MYN1_THEPA/127-337-------------------------------TTYAMTGGKFINMESVVNINLQARDSDIKNTKAKRTG............
Q23I78_TETTS/118-326-------------------------------VTSAIMGGAAKIYTTL.......DQNYLKTVDIEQTK............
Q653N7_ORYSJ/105-322-------------------------------IVGLSMGGQDVVYVKQDKS.SPLSPSVIKEHLDKLGDQ.......LFTG
Q22CA8_TETTS/139-351-------------------------------VTSVDLGSLFGYKFKM.......LKTDVQSMQNQGID............
Q1ENV5_MUSAC/18-204-------------------------------ITSVTIGGKDELYIKQHHS.SQLSESEIEKYVKDIGDQ.......RFLN
Q4Y6N1_PLACH/479-703-------------------------------AHEMYLGGKIIIKVNI.......EKEEYNKMKETNLD............
Q4Y3F0_PLACH/139-383-------------------------------VSEVYYGGKIINILYSEYYNNIYNSEQVQIYKKRLNP..........FT
Q6I604_ORYSJ/118-331-------------------------------IAGVKMGGKDVVCIKQLKG.SNLTQSDVQSRLKKLSDD.......KLAQ
Q4N2L1_THEPA/109-327-------------------------------NNQLTLGGKINQTMVF.......DSSTLEELKKKGID............
Q23QV5_TETTS/142-348-------------------------------VTSVNLGSRFGYKYQM.......DKYQSNQLTQQGVN............
Q32N46_XENLA/145-359-------------------------------ITDATMGGQLQEVTAL.......RTCEVALSDSTMQLV........KDC
Q1MTI0_DANRE/134-352-------------------------------LRRVDLGGRVKSTTAV.......RTCQVSMKGLSANDV........SNC
Q8IB29_PLAF7/119-370-------------------------------VLSAHFGGMSFNTMEI.......TKRKIEEIKIYKYKYSLWNNPYLNIF
Q4MYP0_THEPA/120-344-------------------------------SYNIKLGGRITFITQE.......EGSKDERGNEKSVD............
Q4XPE5_PLACH/64-292-------------------------------STVIHLGGKITQQVKI.......SKNEYKSLSESGLS............
Q4RL61_TETNG/125-342-------------------------------ITSVDAGASLVEEDYL.......NSKYVSDNVSQSSS............
Q4SMI5_TETNG/282-498-------------------------------LRQVYLGGRLRRITAA.......RTCLSTLNGLSSSEV........HSC
Q54I05_DICDI/30-225-------------------------------PKRYILGGMITNHETQ.......KFTTIENLESKLLS............
Q6INM0_XENLA/212-434-------------------------------LQSGSLGGEYKFLFYL.......DSEKITANGVTKRDM........QSC
Q4Z2G1_PLABA/126-386-------------------------------IVSAHFGGKTINTLEV.......PIHKFEELKIYNYKYPIENNRYLNVF
Q6RYF8_HALRU/131-348-------------------------------VTSVDAGAALVQEDQV.......SSEFVNSRKFTKNQ............
PERF_MOUSE/145-366-------------------------------ITAVDLGGRISVLTAL.......RTCQLTLNGLTADEV........GDC
MACP1_ARATH/106-325-------------------------------ITGVSVGGQDVVVVRQDKS.SDLDNDLLRHHLYDLGDQ.......LFTG
A0BCZ0_PARTE/148-361-------------------------------ATDIILGSKVGYVYTL.......PPAIVDDFDQKKFK...........E
A0SEG9_PIG/276-505-------------------------------SSSGSLGGLYELIYVL.......DKATMTEKGIELRDV........HRC
Q4W1E5_SUBDO/94-327-------------------------------ITSIDAGAVLIKEDNL.......KSTIMSNYKGRADS............
A0SEH1_PIG/270-495-------------------------------ITSGSMGGVYEYILVL.......NKENMTKSGVTSDDV........TSC
MPEG1_MOUSE/125-341-------------------------------ITSVDAGAALVQEDHV.......RSSFLLDNQNSQNT............
Q4T0Y8_TETNG/194-450-------------------------------LSEGSLGGTFKVVAKI.......DEETQRYMRTESSEY........NEC
O76288_HELER/134-362-------------------------------VTEADVGVRTGINSRE......DRSSFVKDASTDMSN...........S
Q4RL62_TETNG/147-365-------------------------------IHQVQLGGKVRRITAF.......RTCLATLKGFAETDV........KTC
Q64VU4_BACFR/120-323-------------------------------LTDITLGGRITVLYRS.......SINTSKKTATVEAG...........C
Q4N2L3_THEPA/168-367-------------------------------VVQVHLG.KLTRYLSV.......PSSIIESLANKGLD............
CO7_HUMAN/230-448-------------------------------LQSGSLGGEYRVLFYV.......DSEKLKQNDFNSVEE........KKC
Q5JN47_ORYSJ/106-319-------------------------------VVGVKMGGKDVIYLKQQHS.SSLQAVDVQKRLKEMSDQ.......RFLD
Q4N5X6_THEPA/441-666-------------------------------ATKIYLGGKIFTTLEI.......KKSQEKKLSDQGLD............
Q6IR82_XENLA/294-518-------------------------------ITEGSMGGSYDVLFQY.......STENVQSSGLTDQEM........AHC
Q969A3_BRABE/302-522-------------------------------FSSGSLGGQYEYVYRY.......SRADLSHSGLTEEEQ........KSC
Q117U3_TRIEI/85-286-------------------------------LKSTWIGGRISFSTTI.......DTYGMTDDMRKKFA...........F

PF01289

TACY_STRPN/2-468SAERPLVYISSVAYGRQVYLKLETTSKSDEVEAAFEALIKGVKVA--PQTEWKQILDNTEVKAVILGGDPSSGARVV---
TACY_STRP1/105-570SNEAPPLFVSNVAYGRTVFVKLETSSKSNDVEAAFSAALKGTDVK--TNGKYSDILENSSFTAVVLGGDAAEHNKVV---
TACY_PAEAL/37-501SNEAPPLMVSNVAYGRTIYVKLETTSKSNDVQTAFKLLLNNPSIQ--ASGQYKDIYENSSFTAVVLGGDAQTHNQVV---
TACY_LISIV/56-523NAENPPAYISSVAYGRDIFVKLSTSSHSTRVKAAFDTAFKGKSVK--GDTELENIIQNASFKAVIYGGSAKDEVEII---
TACY_LISMO/57-524NAENPPAYISSVAYGRQVYLKLSTNSHSTKVKAAFDAAVSGKSVS--GDVELTNIIKNSSFKAVIYGGSAKDEVQII---

PF01823

A0T3F5_ACRMI/321-527VGTAAGYEG..................MFSAGYQQETDSQREQRE..AF.....ENARESKFSYTYGTQM..........
A1E348_TOXGO/562-791VKTQLKMQL.................GGVSGGAGQGTSSKKNQSS..SE.....YQMNVQKETLVIGGRPPGNV......
A0SEH2_PIG/282-508AQHGFKIGVAIEE.........VYVKLGVPVHKCKDILNEIKDRN..KR.....SSMVNDLVVLVRGGASEHITALAY..
Q8IB27_PLAF7/139-408SNLYFGSSLSKEKIIYI.RERNLIMDGGVHINPYNINEVNMENKK..KN.....IYVNNVEKNLYDQKKKYRNYYNFYE.
Q6PFT2_DANRE/240-463LSDDDTLVTFF.............YNRHKQRNTCGNISMKTKYEG..SM.....VKASERCITSVQGGRTEFAAALAWE.
Q4RWM0_TETNG/144-362LEAEASATIK..............ATVKTELKHCKKDTEKMESKS..SF.....SSLFNDRFTEIKGGQTTEPDLLF...
Q22CA7_TETTS/139-349ASVGAS.....................LYGVKGKVSTSYAQQQLN..SF.....QQSLKSWSSYSLGATP..........
Q4MYP2_THEPA/89-325IKQSSTFFH....................LSKSRSESLNEKKSGE..TN.....KEELEELYTLTIGPEPPGNV......
TX60A_PHYSE/126-348VSLAGPTKV...................GKLSFSGCTGVSQQEIE..QS.....SSQSMIKKLVVRGGKTETRASLI...
Q5M7M6_XENTR/258-494LKLNAGANIGGTENG.....AKVDVNPNVKTDICNKGGGETETEPRRTQ.....KPVIESIISFVDGGSVEYVTALEEKL
NSL1_ARATH/109-324DPVES....KSPASVYS.GKPKEENLLQWGLQPFGTSVSSAVVMH..TK.....N.EEIMRVCIRRGGVD..........
Q4SUR7_TETNG/132-350LSVEAQANIKG.............VTVSAATQFCKTKSSKLKTGA..TF.....RQAFSDRSIEVLGGDGDVGDVLF...
A8GEE9_SERP5/117-324TIVQAKYEQ...................LTSQLSVEDKLKYSEAF..DS.....FSESGSYTYDILGGSPSLGALVFKN.
Q5W1L1_ONCMY/293-522LGGSIGISSPIGKT......KQVEVGGKLEVKGCKGTGSYEKEMY..GS.....SSLIKDIVTLVKGGSTGGSGGLL...
Q6DBQ7_DANRE/163-385IGGSFGLVFME............KIKATVKGKSCGKFTSNEKTSD..ES.....HSAIKDVFGFVKGGNTASSAGSL...
Q4SP15_TETNG/268-494AQAGLKVGANIYG.........VYVSAGVHGGSCNGLLNEMGENT..AR.....GSMVEDFVSVVRGGTSESITALLS..
Q6H965_ONCMY/224-445TKTKHRILF.................VSWTTEKCRKDEKEYTLPNPPSI.....SRSDTVKKVDVEGGATAHIAALKALD
Q4T1D8_TETNG/231-450WRKVKRRFL.................RKKVKTVCEKLTSSTAASY..GT.....SMRNVPIKVDVVGGNPGLKRFLSILD
CO9_ONCMY/242-472IKVGISANFDTNI........GIGGDAHIRPGHCKDTVNKNTAEK..EG.....KALVDKVITVVRGGTLEAAVAMRTQI
O84155_CHLTR/410-619LETA.......................AANSLLKGSVSSSTESGY..SS.....YSSTSSSHTVFLGGTVLPSVH.....
Q498V9_DANRE/220-439ITRVKRRLF.................YKKKTTKCVKLMKTIENFS..EN.....RNHKMPIKTDIIGGNSAYIAGLSLLD
Q23QV7_TETTS/139-349ASVGAS.....................LYGVQGKVSTDYSQQQLN..SF.....QSSLKSWSSYSMGATP..........
Q4XY78_PLACH/215-440VKAQIQAQF.................GFASVGGSTSVSSDNSSKN..DN.....SSYDMSEKLVVIGGNPIKDV......
A0SEH0_PIG/291-514IRIETKKRYFI.............VTKTKVEHRCTTNRMSEKYEG..SF.....LQGSEKSISLVKGGRSEYAAALAWE.
Q6DK87_XENTR/264-490FGASVRLSVQTEFE.......EIIPSLKLSGDFCTKFERENQDNS..SS.....SRAIKDVITYVIGGDSGSAGGIL...
Q4N9F0_THEPA/681-905VDAAVKASIS..............PVMVDSLQGGFASTSEKASLS..QS.....NNLKYDKQVLVIGGDGLVDS......
Q503Q0_DANRE/121-337VSASAGINFF...............N.KVNFNFGSKETEQTSETL..TY.....QQNITYSLVQSHGGALF.........
Q4MYP3_THEPA/129-351................................FKMSLNSNSKDKL..HD.....LDKNKSEKIIILGGNAMTTDRKTTNN
Q4SP14_TETNG/273-499FSASIGLSYPIGQ........GASVDLKLGVNPCSKDGTFNQGSD..AS.....SVMVEDIITLVKGGILDSTSGVM...
Q9JRT3_CHLPN/15-224ISVA.......................AASSLLKSKTSNATEKGY..SS.....YQSESSAQTVFLGGTVLPDLQ.....
Q4MYN1_THEPA/127-337.................................EASSEFSEIFRR..RI.....KGNKIKKHLWVIGGSFVNNLE.....
Q23I78_TETTS/118-326TQIGINFSY..................NVFQFKFGFNSTDLAQKL..DE.....NFKKNSNDIIIFSPEVDHI.......
Q653N7_ORYSJ/105-322TCTLP....PSHCKSRDHKFKVPEAFNVFDAQMTRQRIEGMTAPM..SC.....K.EGVTVIYSKRGGDT..........
Q22CA8_TETTS/139-351VSASAT.....................LFNVRGRTNTQLEQNSLN..SF.....SQSIQSWTSYSIGATP..........
Q1ENV5_MUSAC/18-204MEHQT..................................LNAPLN..YK.....E.KDVTVIFRRRGGDD..........
Q4Y6N1_PLACH/479-703MKTVFDFYF.....................HKMGLSARKNRRIQK..FI.....NKMHGSKTVSILGGHPGLNI......
Q4Y3F0_PLACH/139-383SGSKLGSFY..................FGSIISKKQNSTNQKDND..NM.....LTYIKEKNTIYDGGEDIKEYKDGE..
Q6I604_ORYSJ/118-331DSPES....LTARDD....KFLLGLNGSLLLGPGSAAWRSFRPSV..VS.....HKDDILSIHIRRGGVD..........
Q4N2L1_THEPA/109-327IEAEVRTEL.....................GSGNVKLNLDMGGKK..SR.....LDEIGQKKMSVLGGKMPNFP......
Q23QV5_TETTS/142-348LSVSAS.....................YFSSSGSASGAYNQTQIQ..NF.....TQAMTSWSSYSIGATP..........
Q32N46_XENLA/145-359REAEIMAAVVG.............PNNTMLSQICVPSTRKYIYVG..NF.....HQGFNERFREVAGGNAMFDLH.....
Q1MTI0_DANRE/134-352LSAEASAIIKG.............VKVSGQTAYCKSKQKQLERAN..SF.....SATFSDRVTDILGGNGEQQDILF...
Q8IB29_PLAF7/119-370KSGSLFQDLSINVDGHK.ENKKNNSNNNINIDEKKKNDAYIKNDV..LI.....EQYRDNINLEIRGGNNFDEK......
Q4MYP0_THEPA/120-344VGVGGKFEK.................DNKGVGIEGNVKFVFGNKR..GE.....SKNLSFKYTNILGGLPVSDI......
Q4XPE5_PLACH/64-292TSVSASVGF.................GLFKANASSSTDSKESSNE..ES.....SNSSIEKETVIIGGTTIYDP......
Q4RL61_TETNG/125-342ISAQAGLNFF...............D.KLKFDISSHNSQQSSTLQ..GY.....QSNIRYSLIQSHGGGIPF........
Q4SMI5_TETNG/282-498LSLGIGIGLGQ.............LKLSANQQSCRKVLNNQDVAT..SF.....GTGLFQHSTEVVGGADNF........
Q54I05_DICDI/30-225LSAGVNAAI.................GPVKVGGSVGGESATDEKK..SK.....QNEENSSKKDVIGG............
Q6INM0_XENLA/212-434TSSSKNFFF.................VKYSSKECKALNEVIRQSS..GS.....TDREVRGDVFVQGGEAKFVAGLSYFS
Q4Z2G1_PLABA/126-386KDRLLLQKILKIEKGEYAYRGGSQDNYMEDEQAEKNNDNLEKKAN..DVLNKYENSTSNKINLDIKGGTKLNED......
Q6RYF8_HALRU/131-348ITAGASASFL...............G.IFSIDVSYHSSTSNEVKT..AY.....EKSRSSSQIDTLGGPMFK........
PERF_MOUSE/145-366LNVEAQVSIGA............QASVSSEYKACEEKKKQHKMAT..SF.....HQTYRERHVEVLGGPLDSTHDLLF..
MACP1_ARATH/106-325SCLLSTRRLNKAYHHSHSQPKFPEAFNVFDDKQTVAFNNFSINSQ...........NGITVICAKRGGDG..........
A0BCZ0_PARTE/148-361IDLKQAATI.................TSALLKGVIGQQILPKEQE..AKAYSDVSKLSTQSFTIEIGPQ...........
A0SEG9_PIG/276-505LGFNLDLSLNFG..........VEIKGKIDSENCLKRGDGKTENI..MN.....DDFIDDVISFIRGGTRKYATELKEKL
Q4W1E5_SUBDO/94-327LSTAAGVEFY..............DMLKLRASAGFSSYSGDSDLK..AY.....RQNRTSSRLYTYGGPPY.........
A0SEH1_PIG/270-495FGGSFGIDYDYTD........NLQITGSLSGKHCKKLGGGHREDE..ES.....NMAVEDIISRVRGGSSGWGGGLT...
MPEG1_MOUSE/125-341VTASAGIAFL...............N.IVNFKVETDYISQTSLTK..DY.....LSNRTNSRVQSFGGVPF.........
Q4T0Y8_TETNG/194-450EETKYWILF.................FSFTRKTCRSGSSNSRFST..GT.....RSGNHLSRVDVVGGGVQHSAALSTMS
O76288_HELER/134-362VSVEGNYKIFSA..........SLSVDMDRFSQSASSEKKMGTEY..TRYTIGSEEFNEPITISLIGLEEALNDEYWSR.
Q4RL62_TETNG/147-365LNAELRMSLGF.............LPANVTLSNKCDNLLKGNMSM..GF.....YQGFMTHKIEVIGGERYFPDILY...
Q64VU4_BACFR/120-323AS.........................GIKNMFNLSVDGHYDQTL..VK.....DNSEQEIVYRTEGGDPSRALIGQLN.
Q4N2L3_THEPA/168-367VNAAIGAVI.................SGVSANIAVGVSKSEESEI..KQ.....LKKSSKLKFSVLGGIHPDRN......
CO7_HUMAN/230-448KSSGWHFVV..................KFSSHGCKELENALKAAS..GT.....QNNVLRGEPFIRGGGAGFISGLSYLE
Q5JN47_ORYSJ/106-319ANGHS....DISLAD....SYAKDNKVEAREQRLRFVESNPLNSY..SS.....N.EELVMMPKRRGGRD..........
Q4N5X6_THEPA/441-666VRAILSAKI.................KDTDIDSNVEVSTIKSKNA..GD.....FLLDTKKSTFVLGGDIYGH.......
Q6IR82_XENLA/294-518VFEEIRTRRFF............FFVKTTHRTTCTTNKMTERYSG..SF.....LQSSEKSISFIKGGRAEFAAKLAWQ.
Q969A3_BRABE/302-522LSAEAKASFFS.............FSGSSSGSRCKENALSQRNSG..SF.....TLSASESFSHVKGGSSESAGQLAF..
Q117U3_TRIEI/85-286VTKRK......................VGNWTGTSDVELTREEKD..IS.....EKMKSNSIVRVWGGDPKLGRDIERA.

PF01289

TACY_STRPN/2-468--TGKVDMVEDLIQEGSRFTADHPGLPISYT---------------------------------------------TSFL
TACY_STRP1/105-570--TKDFDVIRNVIKDNATFSRKNPAYPISYT---------------------------------------------SVFL
TACY_PAEAL/37-501--TKDFNVIQSVIKDNAQFSSKNPAYPISYT---------------------------------------------SVFL
TACY_LISIV/56-523--DGDLSKLRDILKQGANFDKKNPGVPIAYT---------------------------------------------TNFL
TACY_LISMO/57-524--DGNLGDLRDILKKGATFNRETPGVPIAYT---------------------------------------------TNFL

PF01823

A0T3F5_ACRMI/321-527......PADGSANTWASQTSQ.TP.MPINIE.....................................LTSI....SELL
A1E348_TOXGO/562-791......SDPAALAAWADTVEE.LP.MPVKFE.....................................VQPL....YHLL
A0SEH2_PIG/282-508...KDLPTADLMQEWGDAVQY.NP.DIIKIK.....................................AEPL....YELV
Q8IB27_PLAF7/139-408.LKDDVRKRNYYNSWKDTIEWEQA.KPVKLN.....................................LVPL....SEFI
Q6PFT2_DANRE/240-463.KKGVSPQSTVYTDWIKSTIE.NP.VVINYE.....................................LLPL....VNLV
Q4RWM0_TETNG/144-362...SSDKDPSAYKEWLNTLPL.IP.DIISYS.....................................LNSL....HELL
Q22CA7_TETTS/139-349......NANLDAAQWATQTLD.TP.MPIKTE.....................................LTPI....YTFI
Q4MYP2_THEPA/89-325......SNSKVISDWLEKVVH.NP.TPIDLE.....................................LVPI....KQII
TX60A_PHYSE/126-348....GELDPDQINKFLIEAET.DP.SPIQYK.....................................FEPI....WTIL
Q5M7M6_XENTR/258-494NKKEPVADVDDYIQWASSLKD.SP.TVINSK.....................................SNPI....ISLI
NSL1_ARATH/109-324......LGQ.SHERWLSTVSQ.AP.NVISMC.....................................FVPI....TSLL
Q4SUR7_TETNG/132-350....NSNGVAGFKKWLASIKR.VP.GLVWYQ.....................................ISPL....HLLV
A8GEE9_SERP5/117-324..NSQGSSDDNLKNWIQSISS.MP.VLTKFIDQ.................................TSLMPV....WLLC
Q5W1L1_ONCMY/293-522....AIKDPDTYRKWGLSLKY.NP.NLIEFE.....................................TLPI....FELV
Q6DBQ7_DANRE/163-385....GIKDAKSYKDWGKSLKY.NP.ALIEFE.....................................ILPI....YELL
Q4SP15_TETNG/268-494...KKLPTPELMRLWGEGVQF.NP.DFIRRT.....................................TQPL....YELV
Q6H965_ONCMY/224-445.LNTPGRNWDMYKNWAESVRT.FP.AVIKRK.....................................MRPL....YELV
Q4T1D8_TETNG/231-450.LENPEENGRKYDDWASSVKD.FP.QIIEQK.....................................VRPL....YELV
CO9_ONCMY/242-472.TKEGLMDVKTYQNWARTVGD.AP.ALLSSE.....................................PEPI....QTLI
O84155_CHLTR/410-619......DERLDFKDWSESVHL.EP.VPIQVS.....................................LQPI....TNLL
Q498V9_DANRE/220-439.LENPDNNKQMYTKWAGSVKE.FP.KVIKQK.....................................LRPL....HELV
Q23QV7_TETTS/139-349......NANLDASEWATQTLD.TP.MPIKTD.....................................LTPI....YEFI
Q4XY78_PLACH/215-440......TKEENLYEWSKTVSS.NP.MPIHIK.....................................LLPI....YKSF
A0SEH0_PIG/291-514.KGSSGPGEKTYSDWLESVKE.NP.AVIDFE.....................................LAPI....TDLV
Q6DK87_XENTR/264-490....NVFDGRMYRYWGRSLKY.NP.AVIDFE.....................................IQPI....YEGL
Q4N9F0_THEPA/681-905......KNANSLNNWAKELYK.RP.MPIKIK.....................................LESI....KSLL
Q503Q0_DANRE/121-337......YQGITMQKWQESTQN.NL.VAIDRS.....................................GLPI....HYFL
Q4MYP3_THEPA/129-351NGEINYDKKLDKQKWVETIKY.NP.VPIKFE.....................................LTPL....SYFI
Q4SP14_TETNG/273-499....VVRNPETYRTWGASLKY.NP.TLIEHE.....................................IMPI....YELV
Q9JRT3_CHLPN/15-224......QDKLDFKDWSESIPN.EP.IPLAIS.....................................VSSI....TDLI
Q4MYN1_THEPA/127-337.....QIDPKMFSKWVKTIDK.RP.MPIKAR.....................................FSEL....SMFF
Q23I78_TETTS/118-326......SDPKAWSTWESTVPE.KP.QPVNTT.....................................VSYI....SDLA
Q653N7_ORYSJ/105-322......AAS.NHSEWLPTVPL.MP.DAINFK.....................................LVPI....TSLL
Q22CA8_TETTS/139-351......DLNNDPANWATQTLT.KP.MPIKSS.....................................ITPY....HEAL
Q1ENV5_MUSAC/18-204......LVQ.NHAEWVHTISS.AP.DVINMT.....................................FLPI....VSLL
Q4Y6N1_PLACH/479-703......DDPSFFEKWINSIDK.NS.MPIRTK.....................................LLPF....SFFM
Q4Y3F0_PLACH/139-383..GKVLMINGMEDEWEKTINGKYA.KPIKLI.....................................LKPF....SDFI
Q6I604_ORYSJ/118-331......NGQ.GHSNWLSTISG.SP.DVISMA.....................................FVPI....TSLL
Q4N2L1_THEPA/109-327......MDDNEFAHWAETVAE.NP.MPIGVV.....................................STSL....KTLM
Q23QV5_TETTS/142-348......DANQDPLSWAQQTLD.TP.MPINIS.....................................ILSF....DDFL
Q32N46_XENLA/145-359......NHLSGENKWLKSTEK.DP.ALLNYS.....................................LMPI....HTLI
Q1MTI0_DANRE/134-352....TPSNVSGYGKWLGSLKK.IP.GVVSYT.....................................LSSL....HMLV
Q8IB29_PLAF7/119-370......WRNLTYLVWKNSIYS.NI.VPIHLD.....................................LYSL....NTFM
Q4MYP0_THEPA/120-344......SKESEYVKWIKSVYK.YP.MPIRTQ.....................................FAPI....SKIF
Q4XPE5_PLACH/64-292......NDPSNFEKWADSIKN.NP.MPIKGQ.....................................YEPL....SRIL
Q4RL61_TETNG/125-342......YPGMTLQKWQESTRN.NL.VAIDRS.....................................GLPL....QYFI
Q4SMI5_TETNG/282-498......RFESGGLGQGPEVGR.PP.RILY.......................................VVPAAGHTHSHL
Q54I05_DICDI/30-225......DPSKTGSEWVSSLSDINNWGIIGID.....................................VYPI....MDLI
Q6INM0_XENLA/212-434.LDNPLSNENRYAAWAGSVSN.LP.SVIKHK.....................................TTPL....YELV
Q4Z2G1_PLABA/126-386......WKQLTYEKWRNSIYT.NI.APIYLD.....................................LFSL....SSFM
Q6RYF8_HALRU/131-348......ASNFTANDWTNEVDH.EL.VAVDRS.....................................GDPL....FFLI
PERF_MOUSE/145-366...GNQATPEQFSTWTASLPS.NP.GLVDYS.....................................LEPL....HTLL
MACP1_ARATH/106-325......RAK.SHSEWLITVPD.KP.DAINFN.....................................FIPI....TSLL
A0BCZ0_PARTE/148-361......STENTPKDWLRETEL.EP.TPIRYT.....................................LKSI....SELV
A0SEG9_PIG/276-505LKGAKMINVTDFVNWASSLND.AP.VLINQK.....................................LSPI....YDLI
Q4W1E5_SUBDO/94-327......KLGMNLSRWENDLMN.NL.VATDRS.....................................GKPS....HSLS
A0SEH1_PIG/270-495....QNGSIITYRAWGRSLKY.NP.AVIDFE.....................................MKPI....YEIL
MPEG1_MOUSE/125-341......YPGITLETWQKGITN.HL.VAIDRA.....................................GLPL....HFFI
Q4T0Y8_TETNG/194-450.LDDPNKNWEMYSNWADSVRS.FP.QVTKQKVRETQPNGISKVMLDLPVNVPARLDLENVIPTPACVQLRPL....SELV
O76288_HELER/134-362.QSEYESSGECPSNWARSTIA.TN.ILTGLKEYA..............................NYRGVVPS........
Q4RL62_TETNG/147-365....QQDPSEAYDSWMNSLHD.NP.DVISYA.....................................IFPL....HQLV
Q64VU4_BACFR/120-323.YDSKNPSVIDISSWQQSCDDNNM.TLVDAEP..................................GSLIPI....YDLV
Q4N2L3_THEPA/168-367......ISPTSIRKWKSTVPR.YP.MPIKID.....................................VESI....STFL
CO7_HUMAN/230-448.LDNPAGNKRRYSAWAESVTN.LP.QVIKQK.....................................LTPL....YELV
Q5JN47_ORYSJ/106-319......KDIISHSEWLNTVQA.EP.DVISMS.....................................FIPI....TSLL
Q4N5X6_THEPA/441-666......GKTIEFAEWARSVAD.HA.MPIKAE.....................................FTPI....SHFI
Q6IR82_XENLA/294-518.KEGASPDEKAYKDWVASTVD.NP.DLINYK.....................................LAPI....LDLI
Q969A3_BRABE/302-522...ANGPNPEKYEAWIQDVKR.NP.AIISYE.....................................ITPI....SELV
Q117U3_TRIEI/85-286..IQGHTVSDIYQQWGQTVEE.RP.YISDFDHG.................................QGLVPI....YELA

PF01289

TACY_STRPN/2-468RDNVVATFQNSTDYVETKVTAYRNGDLLLDHSGAYVAQYYITWNELSYDHQGKEVLTPKAWDRNGQDLTAHFTTSIPLKG
TACY_STRP1/105-570KNNKIAGVNNRTEYVETTSTEYTSGKINLSHQGAYVAQYEILWDEINYDDKGKEVITKRRWDNNWYSKTSPFSTVIPLGA
TACY_PAEAL/37-501KDNSIAAVHNNTEYIETKTTEYSKGKIKLDHSGAYVAQFEVYWDEFSYDADGQEIVTRKSWDGNWRDRSAHFSTEIPLPP
TACY_LISIV/56-523KDNQLAVVKNNSEYIETTSKAYSDGKINLDHSGAYVARFNVTWDEVSYDANGNEVVEHKKWSENDKDKLAHFTTSIYLPG
TACY_LISMO/57-524KDNELAVIKNNSEYIETTSKAYTDGKINIDHSGGYVAQFNISWDEVNYDPEGNEIVQHKNWSENNKSKLAHFTSSIYLPG

PF01823

A0T3F5_ACRMI/321-527TDTFKTDLD....EKQIDYETLRP--------------------------------------------------------
A1E348_TOXGO/562-791PVE..............KQEAFKQ--------------------------------------------------------
A0SEH2_PIG/282-508TAADFAY.......SSTVKQNMKR--------------------------------------------------------
Q8IB27_PLAF7/139-408NSEE.............GKSAYYM--------------------------------------------------------
Q6PFT2_DANRE/240-463RGISCA.........VTKRRHFHR--------------------------------------------------------
Q4RWM0_TETNG/144-362PTSCP............VRKDLRS--------------------------------------------------------
Q22CA7_TETTS/139-349SQYQNNAD......IPLNSTTMAY--------------------------------------------------------
Q4MYP2_THEPA/89-325PEK..............YLKIYEN--------------------------------------------------------
TX60A_PHYSE/126-348KTRYV............GTEHFAK--------------------------------------------------------
Q5M7M6_XENTR/258-494PTDIKDA........YIKTRNLER--------------------------------------------------------
NSL1_ARATH/109-324SGLP.............GTGFLSH--------------------------------------------------------
Q4SUR7_TETNG/132-350PDNPV............LQETLSK--------------------------------------------------------
A8GEE9_SERP5/117-324.................EDKTKAD--------------------------------------------------------
Q5W1L1_ONCMY/293-522RLSTAGDH......VGARPAHLRR--------------------------------------------------------
Q6DBQ7_DANRE/163-385RLSTAAEQ......LSSKLPHVKM--------------------------------------------------------
Q4SP15_TETNG/268-494TSRDFSQ.......ASTLKRNLKR--------------------------------------------------------
Q6H965_ONCMY/224-445KEVQCA.........GMKRFHLKR--------------------------------------------------------
Q4T1D8_TETNG/231-450KEVECA.........GLKKLHMKQ--------------------------------------------------------
CO9_ONCMY/242-472PLSMPDA........NTRRLNMQR--------------------------------------------------------
O84155_CHLTR/410-619VPLHFPNIGA..AELSNKRESLQQ--------------------------------------------------------
Q498V9_DANRE/220-439KEVACA.........GLKKVHLKR--------------------------------------------------------
Q23QV7_TETTS/139-349SQYQNNPA......IPIDSATLTY--------------------------------------------------------
Q4XY78_PLACH/215-440DSEE.............LKESYEQ--------------------------------------------------------
A0SEH0_PIG/291-514RNIPCA.........VTRRNNLRR--------------------------------------------------------
Q6DK87_XENTR/264-490QQTGLSG.......IEAKRQNLKR--------------------------------------------------------
Q4N9F0_THEPA/681-905GK...............KRELFDE--------------------------------------------------------
Q503Q0_DANRE/121-337NPAVFPDLPV..PTLHKLAFSVQK--------------------------------------------------------
Q4MYP3_THEPA/129-351YQNF.............SDENLVN--------------------------------------------------------
Q4SP14_TETNG/273-499RFSTAADH......VGARLANLRR--------------------------------------------------------
Q9JRT3_CHLPN/15-224IPELFPSEDA..QVLSQKKSALGQ--------------------------------------------------------
Q4MYN1_THEPA/127-337PE...............KHETYMK--------------------------------------------------------
Q23I78_TETTS/118-326YEFPE............VQAHLRK--------------------------------------------------------
Q653N7_ORYSJ/105-322KGVA.............GVGFLSH--------------------------------------------------------
Q22CA8_TETTS/139-351KIFTQGGN......NILSSTQILQ--------------------------------------------------------
Q1ENV5_MUSAC/18-204NGQP.............GIQNLSR--------------------------------------------------------
Q4Y6N1_PLACH/479-703DDPN.............MIKAYND--------------------------------------------------------
Q4Y3F0_PLACH/139-383KTND.............GKVAYYK--------------------------------------------------------
Q6I604_ORYSJ/118-331TGVR.............GCGFLNH--------------------------------------------------------
Q4N2L1_THEPA/109-327HPA..............MHQSYDQ--------------------------------------------------------
Q23QV5_TETTS/142-348NKFSFSV.......NGLTSSQLNT--------------------------------------------------------
Q32N46_XENLA/145-359NSRSP............KRESLRI--------------------------------------------------------
Q1MTI0_DANRE/134-352RNDSA............RRSSLQQ--------------------------------------------------------
Q8IB29_PLAF7/119-370PIE..............KKESYDM--------------------------------------------------------
Q4MYP0_THEPA/120-344KSKA.............LKDSYDE--------------------------------------------------------
Q4XPE5_PLACH/64-292PER..............LTKIYDE--------------------------------------------------------
Q4RL61_TETNG/125-342SPNMLPDLPQ..PTVRKVSHLVRS--------------------------------------------------------
Q4SMI5_TETNG/282-498SHPEG............QRWFSDK--------------------------------------------------------
Q54I05_DICDI/30-225KK...............NDNTLYK--------------------------------------------------------
Q6INM0_XENLA/212-434KEVPCA.........SVKKHYLKI--------------------------------------------------------
Q4Z2G1_PLABA/126-386HIE..............KKESYNN--------------------------------------------------------
Q6RYF8_HALRU/131-348NSASLPELPN..SVLYQLQNLVEE--------------------------------------------------------
PERF_MOUSE/145-366EEQNP............KREALRQ--------------------------------------------------------
MACP1_ARATH/106-325KDVP.............GSGLLSH--------------------------------------------------------
A0BCZ0_PARTE/148-361SEGKGQLSSV..KEYQKIGQNLKK--------------------------------------------------------
A0SEG9_PIG/276-505PVKLNDA........HLKRQNLER--------------------------------------------------------
Q4W1E5_SUBDO/94-327TTQSLKPEVTTSQEVFLLRRLVKS--------------------------------------------------------
A0SEH1_PIG/270-495RHTNLGP.......LEAKRQNLRR--------------------------------------------------------
MPEG1_MOUSE/125-341KPDKLPGLPG..PLVKKLSKTVET--------------------------------------------------------
Q4T0Y8_TETNG/194-450KEVQCA.........GVKKMYLRR--------------------------------------------------------
O76288_HELER/134-362.................SDPDVTV--------------------------------------------------------
Q4RL62_TETNG/147-365PDSQ.............IAANLRD--------------------------------------------------------
Q64VU4_BACFR/120-323SDMG.............KKEQLKL--------------------------------------------------------
Q4N2L3_THEPA/168-367PRS..............YYNSFKE--------------------------------------------------------
CO7_HUMAN/230-448KEVPCA.........SVKKLYLKW--------------------------------------------------------
Q5JN47_ORYSJ/106-319NGVP.............GCGFLNH--------------------------------------------------------
Q4N5X6_THEPA/441-666DKN..............LRDAYNK--------------------------------------------------------
Q6IR82_XENLA/294-518TGIPCA.........VTKRRNLQK--------------------------------------------------------
Q969A3_BRABE/302-522VGIPYA.........DIKRRNMEK--------------------------------------------------------
Q117U3_TRIEI/85-286TGT..............RKEQLKE--------------------------------------------------------

PF01289

TACY_STRPN/2-468NVRNLSVKIRECTGLAW---EWWRTVYEKTDLPLVRKRTISIWGTTLYPQVEDKV
TACY_STRP1/105-570NSRNIRIMARECTGLAW---EWWRKVIDERDVKLSKEINVNISGSTLSPYGSITY
TACY_PAEAL/37-501NAKNIRIFARECTGLAW---EWWRTVVDEYNVPLASDINVSIWGTTLYPKSSITH
TACY_LISIV/56-523NARNINIHAKECTGLAW---EWWRTVVDDRNLPLVKNRNVCIWGTTLYPAYSDTV
TACY_LISMO/57-524NARNINVYAKECTGLAW---EWWRTVIDDRNLPLVKNRNISIWGTTLYPKYSNKV

PF01823

A0T3F5_ACRMI/321-527---------------KL...VEY--------------------------------
A1E348_TOXGO/562-791---------------AV...TFY--------------------------------
A0SEH2_PIG/282-508---------------AL...EEF--------------------------------
Q8IB27_PLAF7/139-408---------------AL...EFY--------------------------------
Q6PFT2_DANRE/240-463---------------AL...EEY--------------------------------
Q4RWM0_TETNG/144-362---------------AI...RHY--------------------------------
Q22CA7_TETTS/139-349---------------VVNAMQNY--------------------------------
Q4MYP2_THEPA/89-325---------------AL...KYY--------------------------------
TX60A_PHYSE/126-348---------------AVNLEQFY--------------------------------
Q5M7M6_XENTR/258-494---------------AI...EEY--------------------------------
NSL1_ARATH/109-324---------------AV...NLY--------------------------------
Q4SUR7_TETNG/132-350---------------AI...SHY--------------------------------
A8GEE9_SERP5/117-324---------------AL...KKY--------------------------------
Q5W1L1_ONCMY/293-522---------------AW...EEY--------------------------------
Q6DBQ7_DANRE/163-385---------------AW...EEY--------------------------------
Q4SP15_TETNG/268-494---------------AL...SEY--------------------------------
Q6H965_ONCMY/224-445---------------AI...EQY--------------------------------
Q4T1D8_TETNG/231-450---------------AL...EEY--------------------------------
CO9_ONCMY/242-472---------------AT...QEY--------------------------------
O84155_CHLTR/410-619---------------AI...RVY--------------------------------
Q498V9_DANRE/220-439---------------AL...EAY--------------------------------
Q23QV7_TETTS/139-349---------------VVNAMQNY--------------------------------
Q4XY78_PLACH/215-440---------------AV...LYY--------------------------------
A0SEH0_PIG/291-514---------------AF...REY--------------------------------
Q6DK87_XENTR/264-490---------------AY...NEY--------------------------------
Q4N9F0_THEPA/681-905---------------AL...KFY--------------------------------
Q503Q0_DANRE/121-337---------------AA...ERY--------------------------------
Q4MYP3_THEPA/129-351---------------SF...HYF--------------------------------
Q4SP14_TETNG/273-499---------------AW...DEY--------------------------------
Q9JRT3_CHLPN/15-224---------------VI...LNY--------------------------------
Q4MYN1_THEPA/127-337---------------AV...EYY--------------------------------
Q23I78_TETTS/118-326---------------TI...EFY--------------------------------
Q653N7_ORYSJ/105-322---------------AI...NLY--------------------------------
Q22CA8_TETTS/139-351---------------LYSKLRMY--------------------------------
Q1ENV5_MUSAC/18-204---------------AV...DLY--------------------------------
Q4Y6N1_PLACH/479-703---------------AL...MFY--------------------------------
Q4Y3F0_PLACH/139-383---------------AL...EYY--------------------------------
Q6I604_ORYSJ/118-331---------------AV...NLY--------------------------------
Q4N2L1_THEPA/109-327---------------AL...HQY--------------------------------
Q23QV5_TETTS/142-348---------------VISNLSQY--------------------------------
Q32N46_XENLA/145-359---------------AL...SEY--------------------------------
Q1MTI0_DANRE/134-352---------------AI...SKY--------------------------------
Q8IB29_PLAF7/119-370---------------AL...LFY--------------------------------
Q4MYP0_THEPA/120-344---------------AF...RFY--------------------------------
Q4XPE5_PLACH/64-292---------------AL...SFY--------------------------------
Q4RL61_TETNG/125-342---------------AI...ERY--------------------------------
Q4SMI5_TETNG/282-498---------------ALALSQHP--------------------------------
Q54I05_DICDI/30-225---------------KLEKIKNS--------------------------------
Q6INM0_XENLA/212-434---------------AI...EQY--------------------------------
Q4Z2G1_PLABA/126-386---------------AL...LYY--------------------------------
Q6RYF8_HALRU/131-348---------------TI...LHY--------------------------------
PERF_MOUSE/145-366---------------AI...SHY--------------------------------
MACP1_ARATH/106-325---------------AM...SLY--------------------------------
A0BCZ0_PARTE/148-361---------------AL...TDY--------------------------------
A0SEG9_PIG/276-505---------------AI...EDY--------------------------------
Q4W1E5_SUBDO/94-327---------------AV...SQY--------------------------------
A0SEH1_PIG/270-495---------------AL...DQY--------------------------------
MPEG1_MOUSE/125-341---------------AV...RHY--------------------------------
Q4T0Y8_TETNG/194-450---------------AI...EQY--------------------------------
O76288_HELER/134-362---------------PL....TW--------------------------------
Q4RL62_TETNG/147-365---------------AI...TEY--------------------------------
Q64VU4_BACFR/120-323---------------AV...ENY--------------------------------
Q4N2L3_THEPA/168-367---------------AL...SFY--------------------------------
CO7_HUMAN/230-448---------------AL...EEY--------------------------------
Q5JN47_ORYSJ/106-319---------------AI...NLY--------------------------------
Q4N5X6_THEPA/441-666---------------AY...LYY--------------------------------
Q6IR82_XENLA/294-518---------------AF...ATY--------------------------------
Q969A3_BRABE/302-522---------------AL...VEY--------------------------------
Q117U3_TRIEI/85-286---------------QW...EAY--------------------------------

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window