Sequence alignment for CL0294

PF07393

Q750R9_ASHGO/111-822---------------FKAIVSNYDALDEKLSS................VTQVVAPLGEKLEKSMRAKNS........YVK
Q6BHS9_DEBHA/103-810---------------VDRITRKFGSLDTKISE................VSNRIDPLGNSLNKITNSRDR........STE
EXOC5_ARATH/139-817---------------VDGLFESFARLDGRISS................VGQTAAKIGDHLQSADAQRET........ASQ
Q2HG63_CHAGB/108-854---------------LDQSMDQFEALDLTLNNPSTTTN...GNSRADGGGNIAVQIGEKLEELDRKRRK........AQD
Q7PQN8_ANOGA/88-705---------------HQVSVDYFHQLDEKINS................VAGKVIHLGEQLQNVNMPRSR........AVE
A1D556_NEOFI/126-876---------------LNTLSDGFDQIKLTTSVPSEEV.....HELEKDPVLGALKQVRSVRGEARVEYG........KVH
Q2URB8_ASPOR/132-879---------------LKTLSDGFDQITLSTPATTGKS.....NELEDDSVLGALQQVRSVRGEARNEYG........KVH
SEC10_YEAST/120-862---------------LHTTLLTFDKLDDRLTN................VTQVVSPLGDKLETAIKKKQN........YIQ
Q4RLZ1_TETNG/80-698---------------NQVAFQHFQELDEHISY................VATKVCHLGDQLEGVNTPRQR........AVE
Q55N90_CRYNB/170-1008---------------QQWGTSKEQNLLDFEDLPLPSRPTGSSSSHGRTTGFFALTPTMPLPSASFSSHSPGPYYLAYKTH
EXOC5_ORYSJ/117-800---------------VDGLFDSFARLDSRISS................VGQTAAKIGDHLQSAESQRET........ASQ
A2EZD8_TRIVA/69-728---------------LQETKDRSNELYASTNQ................ISVDFSKVTDQLDFAASLVQR........AED
Q2GXU3_CHAGB/166-960---------------VQEVADGFETMKVGGTTARAPHHPHQDPSTDPEALLRVIKNAKSVRGLARQEYG........KIY
Q2TVY5_ASPOR/116-891---------------LKQTIESFQQLDTSLNGTGAGPGP.TGSELSGSTGNMAVETGRKLEELDRQRRR........ALD
Q5BGH2_EMENI/123-870---------------VTPISDGFDQINLSASAANDVV......DLDTDPVLGALKLARSIRGEARQEYG........KIH
Q6CDC8_YARLI/101-777---------------VQSTVSEYTDMEQLMAE................VSKQTSSLGDKMDRISGQHQK........AIA
EXOC5_DROME/89-705---------------HQTAIDVFGQLDEKINS................VAGKIMHLGEQLENVNTPRSR........SVE
A1DAY7_NEOFI/117-893---------------LKQTIDSFQQLDTSLNGAGLSG.....GELPGATGNMAVETGRRLEELDRQRRR........ALD
EXOC5_CAEEL/46-659---------------NGEAIDKMKQLDHTMQA................VSTKVVHLGDQLESVDQPRSR........AHD
Q6FMF7_CANGA/102-810---------------LGKLVDNYNYLDNKLTS................INQMVSPLSEKLQNSIKKKKN........YIK
Q4PHT4_USTMA/134-1026---------------FVAVGNSFNSLEDRISE................VGRTAIRIGEQLETIDKQRNR........ASE
SEC10_SCHPO/101-799---------------FAQVLELSRHLEDNVND................MRSGLVDAGQELERAENNRKR........ILS
Q5KJ89_CRYNJ/95-875---------------FEAIGKSFSNLESKVTD................VGRTAVRI........................
Q5AS51_EMENI/111-841---------------LKQAIESFQQLDTSFQSAGPG.......DTALGSGNMAVETGRRLEELDRQRRR........ALD
Q6CQC0_KLULA/109-807---------------LKDIVQNYDQLDHKLSA................VTQVVSPLGTKLEKSIKQKNA........YIK
Q5A111_CANAL/103-782---------------IDEATKKFDILDTQISD................VSTRINPLGNTLNKITNSRDR........SLE

PF10191

Q7QA49_ANOGA/2-731DVSAFSGDDFDVSSWINASYERSQKTATGSVGKE.AFVSSLVSKMQLYVQQINVALEQTGGQVLKNIPKVISDANMLQIE
Q29C94_DROPS/2-737DVSALSEATFSPADWINANYKKYIEENGSKDGDATSFIQSYVAKLQLYVQQVNYAVEESSRQVVSSMPRIAKESTTLHSD
Q172R1_AEDAE/2-704DLSCFSQDSFDVVQWTNDYFKSNGNADNKEAM.....VSSLVSRLQLYVEQMNYSLEKSSQQLIVTMPHVIKDVKMIQTE
COG7_RAT/2-767DFSKFLADDFDVKDWINAAFRAGPKDGAAGKADG..HAATLVMKLQLFIQEVNHAVEETSLQALQNMPKVLRDVEALKQE
Q5FW35_XENTR/2-765DFSRFLADDFEVKDWVNAAFKSVQKD.APAKVDA..HASTLVMKLQLFIQEVNNSVEEISHQALQNMPRVLRDVEAVRQE
Q08BK1_DANRE/2-764DFSKFLADDFDVKDWVNGAFKVAQKD.APGKADA..HASTLVMKLQLFIQEVNNSIEESSNQALQNMPRVLRDIEALKQE
Q0WQF0_ARATH/4-832DLGPFSDEKFDAKRWVNSSCQARHPQDSLEKH.....LVDLEMKLQIASEEIGASLEEQSGGALLRVPRATRDVLRLRDD
Q655R9_ORYSJ/5-868DASEFGAEGFDPKRWINAALDARHPSEPLDRF.....LADAEERLRSAADDAAAALERDSADALRRVPLACRDALRLRDD

PF08318

Q6BTT0_DEBHA/227-569--------------------------------------------------------------------------------
Q5TNE6_ANOGA/167-492--------------------------------------------------------------------------------
COG4_ARATH/176-480--------------------------------------------------------------------------------
Q6FTK7_CANGA/185-532--------------------------------------------------------------------------------
COG4_YEAST/190-526--------------------------------------------------------------------------------
COG4_SCHPO/163-482--------------------------------------------------------------------------------
Q6CKT8_KLULA/180-481--------------------------------------------------------------------------------
Q59T37_CANAL/195-552--------------------------------------------------------------------------------
Q5ZMU8_CHICK/174-484--------------------------------------------------------------------------------
Q5AW68_EMENI/201-532--------------------------------------------------------------------------------
Q758T0_ASHGO/188-513--------------------------------------------------------------------------------
Q57XU9_TRYB2/282-627--------------------------------------------------------------------------------
Q6CAF9_YARLI/156-431--------------------------------------------------------------------------------
COG4_DROME/166-497--------------------------------------------------------------------------------

PF07393

Q750R9_ASHGO/111-822SAELISFYKDFHLEGT.............................SANLESL.RTSSDWREKAQAAIL---VKQLLVLTR
Q6BHS9_DEBHA/103-810TIFLIRAYHGFYTKEK.............................YDPLEKL.RTSKVYEDKIKCAKT---VSNLLTLAK
EXOC5_ARATH/139-817TIDLIKYLMEFNGSPG...............................DLMELSALFSDDSRVAEAASI---AQKLRSFAE
Q2HG63_CHAGB/108-854ANFLIQCWMEVMETGQ.............................LTSLEEI.QRQGGAENKVRCAVI---ARQLMRISQ
Q7PQN8_ANOGA/88-705AQLLLNHMAEFLTPGP..................................IVNDIYSDKSKLYEAADI---IQKLFQISQ
A1D556_NEOFI/126-876AA.LAPFYDDIVTSGP..............................SPDNLLFKEYPDP...EHQAQI---LSQLRLFAQ
Q2URB8_ASPOR/132-879AA.LAPFYNDITTEGA..............................SPDNLLFKKYTDP...QHQARI---LFQLQSFAK
SEC10_YEAST/120-862SVELIRRYNDFYSMGK.............................SDIVEQL.RLSKNWKLNLKSVKL---MKNLLILSS
Q4RLZ1_TETNG/80-698AQRLMTYFNEFLDGD...................................LRSDVFNNPDKIKEAADI---IQKLHLIAQ
Q55N90_CRYNB/170-1008HLSLLPFCKHLRSSPS............................PSSTLSLLFPPSPTTALPPSLSHQ---SSVLLSLIR
EXOC5_ORYSJ/117-800TIDLIKYLMEFNSTPG...............................DLMELSPLFSDDSRVAEAASI---AQKLRSFAE
A2EZD8_TRIVA/69-728MSIIITYIQEFNKPLEDPPMVRAPNQPPPDPNNPDNPPQEVLVPAFDPLDILLKSIKFPPTLYQCAEL---CAKLFKIVT
Q2GXU3_CHAGB/166-960GA.LAPFYFDLVRAKT..............................HTDPLVFKVFRDP...ERQAQM---LANLRTFAK
Q2TVY5_ASPOR/116-891AHFLLECWDSVSNRGE.............................LTLLENL.RRSGTGEAKVRSAQI---ARQLLRISQ
Q5BGH2_EMENI/123-870AA.LAPFYDDIATLGP..............................SPENLLFQRYTEP...QQQAQI---LSQLQAFAR
Q6CDC8_YARLI/101-777SHFLINCYLSFVKKSS.............................CLELERMWKDGPSG..QRKCATY---VRQLLILSS
EXOC5_DROME/89-705AQKLLNFMSEFLAAGP.................................VIVNDIFADAARLSEAADV---IQKLYAISQ
A1DAY7_NEOFI/117-893AHFLIQCWDGVSNRGE.............................ITLLENL.RKSGTGEAKVRSAHI---ARQLLRISQ
EXOC5_CAEEL/46-659AHQLMQHFDEFLSDQP..................................LNSMIFTDPDKLLESADL---VHKLYSISQ
Q6FMF7_CANGA/102-810SIELIIQYNTFLKNGK.............................SEYVDNM.LNSKKLANRLNAAVL---IKNQLLLAR
Q4PHT4_USTMA/134-1026AHDLIEFYY.MFARGD.............................TTKLEHL.RKEGGREGRIKTAVI---ARRLAAISR
SEC10_SCHPO/101-799SAELLRYYLE.FRSGK.............................PQTLMDF.FRTNNHDKMLLCAQR---TRQLLALAN
Q5KJ89_CRYNJ/95-875..........ATTGEN.............................TSPLEQLFATRTSRQGREKLAVV---LRRLMAISK
Q5AS51_EMENI/111-841AHFLLECWDGVSNRGE.............................IILLENL.RRSGSGEAKVRSAHI---ARQLLRISQ
Q6CQC0_KLULA/109-807SVELISFYASFLEEGD.............................CPELNKL.LESSDKRDICQGALI---LKSLLILTK
Q5A111_CANAL/103-782TIFLIRAYHGFFMKEQ.............................YLPLETL.KNSKKLDDKLKCAKT---VRNLLNLAK

PF10191

Q7QA49_ANOGA/2-731SGLLKQRMNQVQREIAHLQTETGDCMVSLERLDDIKQRLQSSKQCLQEADGWGKLAGELDDLLEKSDIDASSGKLLSLQK
Q29C94_DROPS/2-737VSQLQEKMSAMRQEVAAVQNETGECMATLERLNTLQTKLQAAKESLQESDGWGNLLAELEDGFERNDLKGVCEKLIALQK
Q172R1_AEDAE/2-704VATLTDKMRQLQSDISHVNRDTGVYMHQLERLEGVYQKISIAKHGMKESDGWGKLTAELDDLLERNDIFGSKNKFIDLKK
COG7_RAT/2-767ASFLKEQMILVKEDIKKFEQDTSQSMQVLVEIDQVKSRMQLAAESLQEADKWSTLSADIEETFKTQDIAVISAKLTGMQS
Q5FW35_XENTR/2-765ASFLKEQMILVKEDIKKFEQDTAQSMQVLVEMDKVKSRMQLAADSLQEADKWSTLSADIEETFKTQNITVISEKLTSMQV
Q08BK1_DANRE/2-764ASFLKDQMILVKEDIKKFEQDTVQSMQVLVEIDQVKSRMQLAAEALQEADKWSTLSADIEETFKTQDVAVISSKLTAMQG
Q0WQF0_ARATH/4-832AVSLRGSVAGILQKLKKAEGSSADCIAALARVDNVKQRMEAAYKTLQDAAGLTQLSSTVEDVFASGDLPRAAETLASMRN
Q655R9_ORYSJ/5-868AVSLRSHLASVLQSLSQAEGSSAESITALARIDTVKQRMEAAYATLQDAAGLAQLSQSVEDVFSSGDLPKAAETLATMRH

PF08318

Q6BTT0_DEBHA/227-569--------------------------------------------------------------------------------
Q5TNE6_ANOGA/167-492--------------------------------------------------------------------------------
COG4_ARATH/176-480--------------------------------------------------------------------------------
Q6FTK7_CANGA/185-532--------------------------------------------------------------------------------
COG4_YEAST/190-526--------------------------------------------------------------------------------
COG4_SCHPO/163-482--------------------------------------------------------------------------------
Q6CKT8_KLULA/180-481--------------------------------------------------------------------------------
Q59T37_CANAL/195-552--------------------------------------------------------------------------------
Q5ZMU8_CHICK/174-484--------------------------------------------------------------------------------
Q5AW68_EMENI/201-532--------------------------------------------------------------------------------
Q758T0_ASHGO/188-513--------------------------------------------------------------------------------
Q57XU9_TRYB2/282-627--------------------------------------------------------------------------------
Q6CAF9_YARLI/156-431--------------------------------------------------------------------------------
COG4_DROME/166-497--------------------------------------------------------------------------------

PF07393

Q750R9_ASHGO/111-822KIDT.......................................KSLPKTIETTSALEEYASAMETELLDSFNLAYRNND.
Q6BHS9_DEBHA/103-810KIAS.......................................PDLPKTDHCVTVIEKFSETMEKELLKKFDVYYECDE.
EXOC5_ARATH/139-817EDIGRQGAS............................AAAGNATPGRGLEVAVANLQDYCNELENRLLSRFDAASQRRD.
Q2HG63_CHAGB/108-854RLDLASWGQSTNG....................FRGNGVTNGVTGTNRRHNTREALEKFSELLEQDLLKQFNNSYRRQN.
Q7PQN8_ANOGA/88-705DL..........................................PAQRFANAKKKIESKYDDVEMQLIEEFATAQKMEN.
A1D556_NEOFI/126-876CD..........................................TTEGWRERNARLQSAISMFETAAMKEFRQGYESED.
Q2URB8_ASPOR/132-879CD..........................................LTEGWHERLSHLQEAISMFETAAIKEFRHGYETED.
SEC10_YEAST/120-862KLET.......................................SSIPKTINTKLVIEKYSEMMENELLENFNSAYRENN.
Q4RLZ1_TETNG/80-698EL..........................................PFDRFPDVKAKIASKYHDLERQLIQEFTAAQRRGE.
Q55N90_CRYNB/170-1008FLSPQ.....................................LQPLRDWGFLRQALLAAADRFDSTCLVAFEVSDGKKD.
EXOC5_ORYSJ/117-800EDVGRHGVP............................SAVGSANASRGLEVAVANLQEYCNELENRLLARFDTASQRRE.
A2EZD8_TRIVA/69-728SA..........................................ERDYLQNARINLIQYRERLKDQLLEQFVANSKINK.
Q2GXU3_CHAGB/166-960SD..........................................WSQGAQKREEKVDTMTGIFESAVLREFEQGYEFWD.
Q2TVY5_ASPOR/116-891RLDQKSWNNSGGKNNG..............ASGHGAAEEGTVEETGLTRLNTREIIEKFSETLEKDLLKQFDDFYRKAN.
Q5BGH2_EMENI/123-870CD..........................................TTTGCENRHENLRAAVSMFETAALKEFRHGYETDD.
Q6CDC8_YARLI/101-777KID.........................................TVEACRRAQSDIEKFAEKIEKDLLDVFDQAYRNAD.
EXOC5_DROME/89-705DL..........................................PPGNFAESKRKIEKKYDEVERRLIEEFATAQKSED.
A1DAY7_NEOFI/117-893RLDPRSWDELRAKKDDL............YRNDDISVDEGTRGNINGIHRNTREIIEKFSETLEKDLLKQFDDFYRKAN.
EXOC5_CAEEL/46-659EL..........................................NKDKFANVQARIGQRYKVVEDLLIEEFVRSQRDEK.
Q6FMF7_CANGA/102-810KIET.......................................NSIPATKSTTSTIEKYAEEMENEMLTKFNNAYRENN.
Q4PHT4_USTMA/134-1026EV..........................................DVAGAEQTRDSIDRYCERFERDMLKLFDKFYRRSD.
SEC10_SCHPO/101-799EV..........................................DLPDSSETLARIEKFSEFLETNFLKFFNNEYRKPN.
Q5KJ89_CRYNJ/95-875DVADNAATLLSDAEAGAVPKEVTNGDGESQEPIVNQKVISKRRMEKEKAEKVRDEIEGYCERFEKELLKLFDRSYRKGD.
Q5AS51_EMENI/111-841RLDPKSWNESRSTEPY..............NDGHLAPNSNNMEGTNGFRWNTREIIEKFSETLEKDLLRQFDDFYRKAN.
Q6CQC0_KLULA/109-807KLDT.......................................KSVPKTQEVTQIIEQLATDFEVRILQGFNAAYREND.
Q5A111_CANAL/103-782KVSD.......................................EKSPKSMKCITTIEQFGETMEKELLRKFEIASEDEDD

PF10191

Q7QA49_ANOGA/2-731SLAAQV--------------------------------------GLHGHSERENLVEYFKNRLEALVSPSVVVALRSMD-
Q29C94_DROPS/2-737SLHAQE--------------------------------------QLPGHAERLTQVEDFKNRLEALASPSVVQCFAESN-
Q172R1_AEDAE/2-704SISAQE--------------------------------------GLPGQTERTQQFEYFTNRMEALASPSVIQYIQQGD-
COG7_RAT/2-767SLMMLV--------------------------------------DTPDYSEKCVHLEALKNRLEALASPQIVAAFTSQS-
Q5FW35_XENTR/2-765SLTMLV--------------------------------------DTPDYSEKCVYLEALKNRLEAMCSPQIVAAFNSQS-
Q08BK1_DANRE/2-764SLAMLV--------------------------------------DTPDYSEKCVQLEALKNRLEALTSTQIVSTFNSLA-
Q0WQF0_ARATH/4-832CLSAVG--------------------------------------EVAEFANVRKQLEVLEDRLEAMVQPRLTDALTYHK-
Q655R9_ORYSJ/5-868CLSAVG--------------------------------------EVAEFANVRKQLEVLEERLDDMVQPRLVDALSNRK-

PF08318

Q6BTT0_DEBHA/227-569-------------------------------------------------------VQKWIELLTEEFQKGFNEASKNRN-
Q5TNE6_ANOGA/167-492-------------------------------------------------------LEQATVQMQQMVNQKFDEAVKRDD-
COG4_ARATH/176-480-------------------------------------------------------LHASKEQLEGIAKKKLLAAIDQRD-
Q6FTK7_CANGA/185-532-------------------------------------------------------LQQWCDELTEKFKERFQKATEEQN-
COG4_YEAST/190-526-------------------------------------------------------IKNWCKELTSLFQEQFMEATRTQD-
COG4_SCHPO/163-482-------------------------------------------------------LKEITESLHTLFWREFHKAARNQD-
Q6CKT8_KLULA/180-481-------------------------------------------------------IDKWKTHLCKVFSDRFTRATRDVD-
Q59T37_CANAL/195-552-------------------------------------------------------IANWIDKLTQVFKEKFTEAAKAKN-
Q5ZMU8_CHICK/174-484-------------------------------------------------------LQESEQRLKTIVTEKFDTAMKQGD-
Q5AW68_EMENI/201-532-------------------------------------------------------LDNAAESLCGLFLREFDKAVKESN-
Q758T0_ASHGO/188-513-------------------------------------------------------LKDWTSRLSEVFTEQFQHAAKAQD-
Q57XU9_TRYB2/282-627-------------------------------------------------------IVNARQTVREKLMKRFYSAKVVND-
Q6CAF9_YARLI/156-431-------------------------------------------------------LDEICESLGKLFLREFDKAIQSRD-
COG4_DROME/166-497-------------------------------------------------------LEDATEKTRVLIAKRFDEAVKADD-

PF07393

Q750R9_ASHGO/111-822..F-------DKLNEIALI...LKHYNGGV....NVIQSFINQHEYFA.DAELIKQ.NEADVAVFSNSALTEKLTN..AE
Q6BHS9_DEBHA/103-810..Y-------DRMKEVASI...LHQFNGGA....TVVQLFLNKHDFML.DTENL.....DDNSLLDNEAIWNKLSD..PD
EXOC5_ARATH/139-817..L-------STMSECAKI...LSQFNRGT....SAMQHYVATRPMFI.............DVEVMNSDIRLVLGDHGSQ
Q2HG63_CHAGB/108-854..F-------DDMMECARV...LHDFNGGA....SVIAAFVNQHQFFI.DRDQLI...TDEVTTDG..ETWDQLAD..PD
Q7PQN8_ANOGA/88-705..I-------ERMKELSDI...LSQFKGYT....QVIDVYIEQSQATT................................
A1D556_NEOFI/126-876.ID-------GTMRKYAHV...LFTLNGGD....SAIEFFINHNHLIT.QKSDLGR.VADCIDG..............LN
Q2URB8_ASPOR/132-879.ID-------NRMRQYAHV...LYTLNGGA....AAVELFIHHNHLVT.RRSDYGK.PGDCIDA..............SS
SEC10_YEAST/120-862..F-------TKLNEIAII...LNNFNGGV....NVIQSFINQHDYFI.DTKQIDLENEFENVFIKNVKFKEQLID..FE
Q4RLZ1_TETNG/80-698..I-------GRMREVAAV...LLHFKGYA....HCVDVYIKQCQEGA................................
Q55N90_CRYNB/170-1008..E-------EGMKEAAESSWKVWEAGGGDREKWECGRVWVEKREVFY............DTSRWDSLENIIKVQTQSGA
EXOC5_ORYSJ/117-800..M-------STMAECAKI...LSQFNRGT....SAMQHYVATRPMFI.............DVDIMSIDIQVVLGEEGPQ
A2EZD8_TRIVA/69-728...-------YEQAKCASA...LGLLSHEY....EAMEAFIKSTPIMTDAGKKY..................HFKEKYLF
Q2GXU3_CHAGB/166-960.VD-------GRMNKYAHV...LALLNGSS....AAVELFIQKHPVFT.DREVLAN.SMDCVNQ...............A
Q2TVY5_ASPOR/116-891..F-------EGMKDCATV...LQDFNGGS....SVIALFVNQHQFFI.DRSQLV...TEEVGGDL..EAWEQLAD..PD
Q5BGH2_EMENI/123-870.ID-------GRMKNYAHV...LYTLNGGG....SASELFTHHNHIIT.RKAELGQ.TNDCIDT..............LT
Q6CDC8_YARLI/101-777..M-------LMMKDSADV...LTDFNGGT....NVIMAFVNQHDFFIAQDKVV......AANSEPDEAVLKELAD..PN
EXOC5_DROME/89-705..I-------ERMKTLAQI...LSQFKGYT....QCVDAYIEQSQMQP................................
A1DAY7_NEOFI/117-893..F-------EGMRDCATV...LQDFSGGA....SVTALFVNQHQFFI.DRSQLV...TEELGGDL..DSWEQLAD..PD
EXOC5_CAEEL/46-659...-------.KMAEVAKI...LSEFKGYS....GCVDRYVD....................................FL
Q6FMF7_CANGA/102-810..F-------TQLNEIALI...LNHYNDGI....NVIQSFINQHNFFL.DSDEVNKSMTGESPYLSED.VRDKLMD..PN
Q4PHT4_USTMA/134-1026..P-------KMMSHIAKV...LQGFNGGA....SCVQIYVNQHDFFI.SKDRV.....GEANGIELSQIWTHMAD..PD
SEC10_SCHPO/101-799..W-------KGMASFGTI...LQEFNGGA....SVVREFVNQHEFFI.AADKV.....QSRQGLEQDPIWLILPD..PT
Q5KJ89_CRYNJ/95-875..P-------RMMAHCAKT...LQEFNGGA....SCIQIYVNQHDFFIKDHSQIE...KDEQDGVRV.DIWATIGN..PD
Q5AS51_EMENI/111-841..F-------EGMKDCATV...LQDFNGGA....SVVALFVNQHQFFI.DRSQLV...TEEVGGDP..ESWEKLAD..PD
Q6CQC0_KLULA/109-807..Y-------SRLHQLAWI...LDTFNNGV....NIIKNFTDKHQFFE.ESSNFS...AKESALFTDDVFKAELMN..PD
Q5A111_CANAL/103-782IDF-------DMMNQIAQI...LFEYNEGI....NVIQTFVIKNDIVIENEEKS...........LDEQEWALLAD..SR

PF10191

Q7QA49_ANOGA/2-731--T.......AACRRYVGI---FEGIGRLA----QLKQYYRTVLKTFV-------------------QEQWSSAIEGSES
Q29C94_DROPS/2-737--L.......EQAQHYVQI---FASIQRLP----QLQQYYRAVQKNLW-------------------QQQWKQTLELQGT
Q172R1_AEDAE/2-704--V.......TQCLKYVEI---FRIIDRLP----QLKQCYRTVHKNAL-------------------VEKWSKIAEAEDS
COG7_RAT/2-767--V.......DQSKVFVKV---FTEIDRMP----QLLAYYYKCHKVQL-------------------LATWQELCQRD..
Q5FW35_XENTR/2-765--V.......DQAKMFVKV---FSEIDRMP----QLLAYYYKCHKVQL-------------------VTVWQELCQSD..
Q08BK1_DANRE/2-764--T.......DQAKLFVRV---FTEMDRMP----QLLAYYYKCHKAQL-------------------LTVWESICQSD..
Q0WQF0_ARATH/4-832--V.......DVAQDLRVI---LIRIGRFK----SLELQYSKVRLKPI-------------------KQLWEDFDTKQRA
Q655R9_ORYSJ/5-868--PTNFGWKVDAVQDLRGI---LIRIGRFK----SLEVQYTKIHVKPL-------------------KKLWEDFDLKQRA

PF08318

Q6BTT0_DEBHA/227-569--V-------SELTKYFQL---FPLIQKEE----IGLNCYSK--------------------------------------
Q5TNE6_ANOGA/167-492--L-------ASVERFFKI---FPLLGMHD----EGLEKFMT--------------------------------------
COG4_ARATH/176-480--H-------PTILRFVRL---YSPLGMET----EGLQLYVG--------------------------------------
Q6FTK7_CANGA/185-532--I-------EELTLIFKM---FPMVGQDN----LGLDLYSK--------------------------------------
COG4_YEAST/190-526--I-------KELTLMFKM---FPMIGQDV----LGLDLYSK--------------------------------------
COG4_SCHPO/163-482--Q-------KEITRYFKL---FPLIGKEK----EGLEAYWH--------------------------------------
Q6CKT8_KLULA/180-481--V-------GTLTECFKL---FPKIGASD----LGIDLYSK--------------------------------------
Q59T37_CANAL/195-552--V-------EQLTKFFQL---FPLINQEE----IGLNCYSK--------------------------------------
Q5ZMU8_CHICK/174-484--L-------PQVERFFKI---FPLLGLHE----EGLSKFSE--------------------------------------
Q5AW68_EMENI/201-532--G-------AKITRFFKL---FPLIGRSE----VGLDVYGR--------------------------------------
Q758T0_ASHGO/188-513--V-------EQLTSYFEL---FPKIGYAE----LGLEVYSK--------------------------------------
Q57XU9_TRYB2/282-627--K-------QTIMDTVRL---LTLLGFRD----ECCCMYCS--------------------------------------
Q6CAF9_YARLI/156-431--V-------HELTRYFKL---FPLVDRTE----LGLSTYAS--------------------------------------
COG4_DROME/166-497--L-------ASVERFFKI---FPLVGCHR----TGIEKFSL--------------------------------------

PF07393

Q750R9_ASHGO/111-822EHD----------------------MFYPKTLVESLSSMEEIVKAEAEIVRRVF...EERAPV-VMKLFLKQLMAKRVEP
Q6BHS9_DEBHA/103-810FGE----------------------NIKDESTEALLDGLKISIKGQARIVQQVF....EDATP-VLKIFIQRIYAQIIQN
EXOC5_ARATH/139-817PSP----------------------SNVARGLSALFKEITDTVRKEAATITAVF....PTPNE-VMAILVQRVLEQRVTG
Q2HG63_CHAGB/108-854SDP----------------------PGVEPSLQSLVDEVKIVMQEESFIIKRAF....PYYET-VLIKFIQRVFQQSIQQ
Q7PQN8_ANOGA/88-705...----------------------....YGGRDVFEGIVPLCHKHYKIIQQVF....NAPDK-VISKFILNIYQLKINQ
A1D556_NEOFI/126-876Q..----------------------RVKLEHTQAFFTRLSVAYNEEVSIINRAF....PPSMN-VGPTFVEKVAQDVLYP
Q2URB8_ASPOR/132-879Q..----------------------SVKLDQTQAFFTRLSVAYNEEVAIINRAF....PPSLK-VALPFIAKVGQDVLYP
SEC10_YEAST/120-862NHS----------------------VIIETSMQNLINDVETVIKNESKIVKRVF...EEKATH-VIQLFIQRVFAQKIEP
Q4RLZ1_TETNG/80-698...----------------------....YLRNDVFEDTAILCQRVNKQVGEVF....SSPET-VMAKLIQNIFENKLQS
Q55N90_CRYNB/170-1008TIR----------------------QLDFTPMDAFMSHVLEAFRIDAEIAHSVF....PSKAK-VVLSFCDRLSNEVIGE
EXOC5_ORYSJ/117-800ADH----------------------ICIAEGLSVLYKEIADTVRREATTIMAVF....PSPNE-VMSILVQRVLEQRVTA
A2EZD8_TRIVA/69-728EDE----------------------SILLDHYKGLCSFFVTDCKKSWDLIDVIFTGSQQPKTV-LVTTVFNTVFDAFISR
Q2GXU3_CHAGB/166-960LAD----------------------SITLEPSRRFFEVLTRKVNEQAGIIERIF....PNPVH-VFWVFVDKVREDVVME
Q2TVY5_ASPOR/116-891SEP----------------------LKVEPSLQSLIDEVKVVVQEESAIIKRAF....PYYEQ-VLGKFLQRVFQQSIQQ
Q5BGH2_EMENI/123-870Q..----------------------KVKLHQTQAFFTRLSVAFNEEVSIINRAF....PPALQ-LAQPFVEKVGRDVLYP
Q6CDC8_YARLI/101-777NSD----------------------PQFDHVTEELCSEVVSVVNTETEIIKRVF....KEPVV-VLQVFLQRVFAQRIQQ
EXOC5_DROME/89-705...----------------------....YSGKDIFIGIVPLCKHHYEIIQKVF....ANPQQ-VMSKFILNIYQLKLHQ
A1DAY7_NEOFI/117-893AEP----------------------LKVEPSLQSLVDEVKVVVQEESAIIKRAF....PFYEQ-VLGKFLQRVFQQSIQQ
EXOC5_CAEEL/46-659CQS----------------------IHPRGDGGEILADCLQLCRTQQPRISAIF....PSPHT-VMQKLVLNIFTGRMKE
Q6FMF7_CANGA/102-810YHI----------------------IVYSQELVDMLKNIEEVIKNESKIVKRVF...EDSASY-VLQLFIQRTFAQKIEP
Q4PHT4_USTMA/134-1026HAP----------------------PKSEPSLTALFNEIRQTVEIEAQIISAVF....PNPLV-VMQTFLQRVFAQSVQG
SEC10_SCHPO/101-799QKI----------------------PPLIQTLSSLFSELCSVIEGDCAVIKRVF....PNPEL-VLQTFFQRIFGQSIQN
Q5KJ89_CRYNJ/95-875EPP----------------------PTTEPGLEALCKSIRSTISQESQIMKAVF...YPNSSA-VMEGFLQRIFAQVIQQ
Q5AS51_EMENI/111-841AEP----------------------SGVEPSLQSLVDEVRVVVQEESAIIRRAF....PNYEQ-VLGKFLQRVFQQSIQQ
Q6CQC0_KLULA/109-807SHI----------------------LKYDEKVVEYIQSVFNAIENESKVVATVF...ENKAPN-VMHLFIEKVFELKLRP
Q5A111_CANAL/103-782RSD----------------------FKIDE..QATFDTLKFEIKSRARISKKVF....ADPTP-VIKIFIQRMYAQIIRN

PF10191

Q7QA49_ANOGA/2-731..........................GGSDVLKEFYDHLVELLKSHLRWSCQCF----GE.AT.DCVLAVADALENLDPT
Q29C94_DROPS/2-737ETQP.....................QQQQQFLTLYYDQLLEHCQRQVKWCSNLF----SEEST.QPFLVIAELLPALQPT
Q172R1_AEDAE/2-704.........................YDMNSVLSEFNNVILEFLQNQQKWCKQVF----QSHLE..PLETVVDSLTNLQSL
COG7_RAT/2-767.........................LPLDRQLTGLYHALLGAWHTQTQWATQVF----KNPYE.VVTVLLIQTLGALVPS
Q5FW35_XENTR/2-765.........................MPLDRQLTEFYDTLLSAWHTQLQWVSQVF----KKPQE.VVTVLMIQTLAAMVPS
Q08BK1_DANRE/2-764.........................APLKQQLSEFYDTLLSTWHTQLQWSSQVF----RNPCE.VLTVLMIQTLGAMVPS
Q0WQF0_ARATH/4-832NKLANERSESQRLSSGDEFQSTSSQTSFASWLTSFYDELLLYLEQEWKWCMVAF----PDDYMTLVPKLLVETMGVLGAS
Q655R9_ORYSJ/5-868KRVEMEKYG..........GESINSLSFASWLPNFYDETLLYLEQEWKWCLTAF----PEEYKSLVPKVLVETMSELNSS

PF08318

Q6BTT0_DEBHA/227-569----------------------------------------------------------------FICQIITDTSRSLINS
Q5TNE6_ANOGA/167-492----------------------------------------------------------------YICGKLQVKAAKELRS
COG4_ARATH/176-480----------------------------------------------------------------YLKKVIALRGRMEYEN
Q6FTK7_CANGA/185-532----------------------------------------------------------------YVCDIIADESRKLMSS
COG4_YEAST/190-526----------------------------------------------------------------YVCDIIADESRKIMSN
COG4_SCHPO/163-482----------------------------------------------------------------FFGGIIASKARATLDE
Q6CKT8_KLULA/180-481----------------------------------------------------------------YICDNIAQQSRTLMTH
Q59T37_CANAL/195-552----------------------------------------------------------------FICEIINETSKSLTAG
Q5ZMU8_CHICK/174-484----------------------------------------------------------------YLCKQVAKKAEENLQL
Q5AW68_EMENI/201-532----------------------------------------------------------------YVCQGVAAKARSNLNT
Q758T0_ASHGO/188-513----------------------------------------------------------------YVCDIIAGQSRKIMTG
Q57XU9_TRYB2/282-627----------------------------------------------------------------WMCEHTIVALNKMVER
Q6CAF9_YARLI/156-431----------------------------------------------------------------FVCSIITEESRKLLQG
COG4_DROME/166-497----------------------------------------------------------------YICQKLANKAQKELRN

PF07393

Q750R9_ASHGO/111-822KATLFLNTSMTI...............................SNLAY------------------------LRTLHSVY
Q6BHS9_DEBHA/103-810KISTLLQYSLSV...............................STLAH------------------------VRVLHSLY
EXOC5_ARATH/139-817ILDKILAKPSLMSPPP.......................VQEGGLLLY------------------------LRMLAVAY
Q2HG63_CHAGB/108-854RLEMVLDKATTI...............................SSLAF------------------------LRSLHSSR
Q7PQN8_ANOGA/88-705FVQTKLDDRK.................................DENKY------------------------LKTLSELY
A1D556_NEOFI/126-876FLTAIFDELHRS...............................NLESY------------------------LIAVSGTF
Q2URB8_ASPOR/132-879FLTAIFDELHRI...............................NKESY------------------------LTAVSSTF
SEC10_YEAST/120-862RFEVLLRNSLSI...............................SNLAY------------------------VRILHGLF
Q4RLZ1_TETNG/80-698HVKDRLDGTRHS...............................DVEQY------------------------LKNLYDLY
Q55N90_CRYNB/170-1008YIHPLLSQARAV...............................SQDLF------------------------LRAAAATF
EXOC5_ORYSJ/117-800ILDKLLIKPSLANLPP.......................IEEGGLLHY------------------------LRVLAVAY
A2EZD8_TRIVA/69-728VLNHYLETPS.................................KQNRF------------------------CDMFYKLH
Q2GXU3_CHAGB/166-960YATPLFDETHER...............................SIPSY------------------------LRAVSGIF
Q2TVY5_ASPOR/116-891RLEMVLEKANSI...............................SSLAF------------------------LRSLQSSR
Q5BGH2_EMENI/123-870FLTAIFDELHRS...............................NKEEY------------------------LVSVSSTF
Q6CDC8_YARLI/101-777RIELFLSSAEAM...............................STLAY------------------------VRSLHLAY
EXOC5_DROME/89-705YAMTKLEDKK.................................DEEKY------------------------LRTLYELY
A1DAY7_NEOFI/117-893RLEMVLEKANGI...............................SSLAF------------------------LRSLQSSR
EXOC5_CAEEL/46-659TITARLRECKDT..............................DDQEHY------------------------LRDLAYLY
Q6FMF7_CANGA/102-810QLEFLLNSALSF...............................SHLAY------------------------VRTLHSLY
Q4PHT4_USTMA/134-1026FVEVIMDKAADINAPSFVGAGGNIDTKTAALELNPPSNSQPTTSHLAF------------------------LRALHMAR
SEC10_SCHPO/101-799RLEEVMEIAKGK...............................SNLAY------------------------LRTLQTVV
Q5KJ89_CRYNJ/95-875HLEGLVQRASSI...............................STLAI------------------------LRILHLTH
Q5AS51_EMENI/111-841RLEMVLEKANSV...............................SSLAF------------------------LRSLQSSR
Q6CQC0_KLULA/109-807LVVFLLNSALSL...............................SSLAY------------------------VRSLQSYF
Q5A111_CANAL/103-782KVTSLLQKSLSV...............................SPLAH------------------------VRVLHSLY

PF10191

Q7QA49_ANOGA/2-731RESVVRSALKRA-------------------------------TDK..........................FWTLTQFS
Q29C94_DROPS/2-737RDAHILQLLKTS-------------------------------NER..........................LELLGLFS
Q172R1_AEDAE/2-704KQAFVMNHLKKS-------------------------------VGK..........................FEYLALIA
COG7_RAT/2-767LPMCLSEAVERA-------------------------------GPELE........................LTRLLEFY
Q5FW35_XENTR/2-765IPVCLSTAMERA-------------------------------SPEDK........................LSTLLELY
Q08BK1_DANRE/2-764IPDCIAETLKRC-------------------------------SGDCR........................LDVLLELH
Q0WQF0_ARATH/4-832FVSRLNLATGDA-------------------------------VPETKALAKGVMDLLSGDLPKGINIQTKHLEALIELH
Q655R9_ORYSJ/5-868FVSRVNLATGDA-------------------------------VPETRSVAKGILDVLSGDLPKSTKLQNKHLGALIDLH

PF08318

Q6BTT0_DEBHA/227-569ASGGSNA...AT-------------------------------KHGMY------------------------LTISMKLF
Q5TNE6_ANOGA/167-492SMDIAKA..EKR-------------------------------AAVAY------------------------ADTLTILL
COG4_ARATH/176-480VVELMEQ...GL-------------------------------GQVNF------------------------VGCLTNLF
Q6FTK7_CANGA/185-532SANADVDATITR-------------------------------RSGFF------------------------AQVLLHLF
COG4_YEAST/190-526SMENS.....TK-------------------------------FQGFF------------------------SQVLLHLF
COG4_SCHPO/163-482P.........PT-------------------------------HALFF------------------------AQAFTGLV
Q6CKT8_KLULA/180-481T.........SG-------------------------------DPLFY------------------------SKSTLHLF
Q59T37_CANAL/195-552LENAH.....DL-------------------------------KPAIF------------------------SNVVMQLF
Q5ZMU8_CHICK/174-484VMGTDMS..DRR-------------------------------AAVIF------------------------ADTLTLLF
Q5AW68_EMENI/201-532GTG.......QQ-------------------------------DGFFY------------------------ANTLTKLF
Q758T0_ASHGO/188-513ST........ER-------------------------------RHMFY------------------------SKALLHLF
Q57XU9_TRYB2/282-627ELRKIDD..PNE-------------------------------AGMSH------------------------LALVSAGL
Q6CAF9_YARLI/156-431APA.......TP-------------------------------PSAFY------------------------GLITSRLF
COG4_DROME/166-497AQDIAKA..ESR-------------------------------LQLAY------------------------ADRLTAIL

PF07393

Q750R9_ASHGO/111-822SLINQFIKDLSEF.FIEMNW...................................DTNNS..LASALDQC..FTEIFSKI
Q6BHS9_DEBHA/103-810VLVGDFTKDVKEF.LTTNEL...................................DMSNE..LCPTLDQC..YYDLFIEY
EXOC5_ARATH/139-817ERTQELAKDLRAV.................................................GCGDLDVEDLTESLFSSH
Q2HG63_CHAGB/108-854AYISALVEDLKTH.GLTEHP...................................EPCSA.QISQTLDQQ..LEELFVPY
Q7PQN8_ANOGA/88-705SRTMKLSAELQEFFKGS.............................................EDDLLQKL..TANIFDRH
A1D556_NEOFI/126-876AQSLNLSEALLPIQNTTDT...........................................LDEFLHHI..VAKVYEPH
Q2URB8_ASPOR/132-879AQCMNLSDTLLPIQSSAVN...........................................FEEFLEHV..IAKVYEPH
SEC10_YEAST/120-862TLFGKFTKSLIDY.FQLLEI...................................DDSNQ.ILSTTLEQC..FADLFSHY
Q4RLZ1_TETNG/80-698TRTTALATKLTEFNLGSD............................................KHTFLSKL..IKSIFSTY
Q55N90_CRYNB/170-1008VQAWKLVDVAMEVLGDEQNV..................................I.......KKEQVEDS..VFHMFEEH
EXOC5_ORYSJ/117-800DKTKELAKELQSI.................................................SCGDLDIEGLTESIFVSH
A2EZD8_TRIVA/69-728NETDEMLKSIWAL.................................................DGQTFSNQNIMENTFHNF
Q2GXU3_CHAGB/166-960EQTLQFLRTLTPPKGADVD...........................................QEARAKEL..VLKAFEPH
Q2TVY5_ASPOR/116-891SYIGALVEDLKAH.GLTEHP...................................DTISA.QTALILDQQ..LEDLFVPY
Q5BGH2_EMENI/123-870AQCMNLCDNLLPIQNSLDT...........................................FEDLLHQT..IAQVYEPH
Q6CDC8_YARLI/101-777NVVSSLVKKLKDF.FSSENL...................................DTHDS..LAALLDQN..FADIFIPH
EXOC5_DROME/89-705SRTLKLSTDLQIYMSTI.............................................DDDLLQKL..TQQIFIKH
A1DAY7_NEOFI/117-893SYISGLVDDLKAH.GLTEHP...................................DPVSS.QTALILDQQ..LEDLFVPY
EXOC5_CAEEL/46-659SSTLKMCKELEKLHISP.............................................DSAFLSTL..TDSIFQRY
Q6FMF7_CANGA/102-810SLLGKFVKDLTDY.FQLLEV...................................ENEAN..LQAALEQC..YTDFFSRW
Q4PHT4_USTMA/134-1026SSALSLVNDLKLYDYRGAGIIGPAYASAHTANGDGVVSDSIRLLGNDFAAGASQLAGASASPLATMLDQS..VEELFVPY
SEC10_SCHPO/101-799SSLRKLVADLKTI.LENRGF...................................SVSDNSPLSLALNQY..MEDLLVPF
Q5KJ89_CRYNJ/95-875SICSSLVEDLKTYDSTLTTPPASS..........................SRAPAPAGSGGSFSAFLDRA..LEEMYVPW
Q5AS51_EMENI/111-841SCISTLVDELKAH.GLTEHP...................................ETISS.QTSLILDQQ..LEDLFVPY
Q6CQC0_KLULA/109-807SITNNSVKQLAEF.LSNLKM...................................DSDGK..VSACLEKC..WKNLFIDI
Q5A111_CANAL/103-782TLVGDFTEQIKDY.LTTEEL...................................DKDQE..LSAILDQS..HSDLFVEY

PF10191

Q7QA49_ANOGA/2-731KVNVSMGSLIEGWVRGGPQQDIR---------------------------------------CDDETTIDRLANSLFVFF
Q29C94_DROPS/2-737QVNHSFVLHLNSLLEQSHITL..---------------------------------------SDELHRQ..LGEAVFEYF
Q172R1_AEDAE/2-704ASDCQFTNALEKILIELPAD...---------------------------------------.....KAEDLSAALFSYF
COG7_RAT/2-767DTTAHFAKGLEMALLPHLQD...---------------------------------------.HNLVKVVELVDAVYGPY
Q5FW35_XENTR/2-765NATGHFAKSMETAILPNMGE...---------------------------------------.YNLVKLIELVDAVFGPY
Q08BK1_DANRE/2-764QTSANFSRSLEAAMQPQLGE...---------------------------------------.CNLLKVAELVSCVYSPY
Q0WQF0_ARATH/4-832NVTGSFARNIQHLFAE.......---------------------------------------.SELRILIDTLKAVYSPF
Q655R9_ORYSJ/5-868NMTGTFARNIQHLFSE.......---------------------------------------.SDLLVLLNTLKAIYSPY

PF08318

Q6BTT0_DEBHA/227-569ENISMMLSQHGPL-----------------------------------------------------------IKKYYG..
Q5TNE6_ANOGA/167-492ENIARVIEVNQAI-----------------------------------------------------------IENCYG..
COG4_ARATH/176-480KDIVMAIEENDEI-----------------------------------------------------------LRGLCG..
Q6FTK7_CANGA/185-532KIVSTIINDHSKI-----------------------------------------------------------IAASYG..
COG4_YEAST/190-526KIVSTIINDHSKV-----------------------------------------------------------IATCYG..
COG4_SCHPO/163-482EHVASIIRAHTPL-----------------------------------------------------------VQKYYK..
Q6CKT8_KLULA/180-481KIVSTMINDHSKI-----------------------------------------------------------ILQSYS..
Q59T37_CANAL/195-552ENISMMLSQHGPL-----------------------------------------------------------IKKYYS..
Q5ZMU8_CHICK/174-484EGIARVVETHQPI-----------------------------------------------------------VETYYG..
Q5AW68_EMENI/201-532EHIAQIIDGHGGL-----------------------------------------------------------VERHYG..
Q758T0_ASHGO/188-513KTVSTIINSHSQV-----------------------------------------------------------ISGCYG..
Q57XU9_TRYB2/282-627DLVVATFENEEEF-----------------------------------------------------------VLETFG..
Q6CAF9_YARLI/156-431ENVATIVVQHGKV-----------------------------------------------------------VDKHYG..
COG4_DROME/166-497ENFARVVEVNQPI-----------------------------------------------------------IEAFYGQA

PF07393

Q750R9_ASHGO/111-822VFD---RVKYFDVEKKCLESILIHMTSDFN----------.TY....HEREIRARHLT.......AKLSASGDVKAELTT
Q6BHS9_DEBHA/103-810TSE---.SIYFNREKKNLEDTIYSIVQKFN----------.TY....NEKALSNKYLSTKLENLDNLEYNEKAPQEHHDR
EXOC5_ARATH/139-817K..---.DEYPEHERASLKQLYQAKMEELR----------........................................
Q2HG63_CHAGB/108-854LIG---.NSYIDRERRSLEEMYNSLLFKFT----------.IY....HSR..................RKKTPTGFMAAI
Q7PQN8_ANOGA/88-705L..---.ATYIEVESRTLDAKCQVELKKFY----------........................................
A1D556_NEOFI/126-876I..---.DLYLAEELDHFRKNSAAVVDEWD----------RQL....SEQAASTESFLMSN.VNRQADKRDFLTSFKKVI
Q2URB8_ASPOR/132-879M..---.DLYLAEELDHFRKCSEAAVDEWD----------RQL....SEQAASTESFLMSN.INRQADKKDFLTSFKKVI
SEC10_YEAST/120-862LYD---RSKYFGIEKRSLEAILVDMTSKFT----------.VN....YDKEINKRVLL.......DKYKEKLSTNVDAFM
Q4RLZ1_TETNG/80-698L..---.ESYIDMEKEYLRNRGAMILQRYY----------........................................
Q55N90_CRYNB/170-1008L..---.DDYLDDETERVKHHLEDICRIWE----------QQLGTSDSEQLSKSHTPTFLISANPDQVKRNVLASFKDAL
EXOC5_ORYSJ/117-800K..---.DEYTEFEQASLRQQYQSKMAELR----------........................................
A2EZD8_TRIVA/69-728Q..---.TSYETLETQALTNIMLEQVVP..----------........................................
Q2GXU3_CHAGB/166-960L..---.DLYLQDEIDEFARQAEEEVGEWE----------KKL....SEQDASAESFYMANFTNRQADKKDFLTSFKKVV
Q2TVY5_ASPOR/116-891FVG---.SSYIEREKKTLEELYTSLLFKFT----------.TF....HAR..................RKKAATTFMASL
Q5BGH2_EMENI/123-870M..---.DLYLAEELDFFRKGSEASVAEWD----------RQL....SEQAASTESFLLSN.VNRQADKRDFLTSFKKVI
Q6CDC8_YARLI/101-777IDK---.NRYFESEKKSLSELISAALWKFA----------.EF....HEKKSSHKEGG......LLGR............
EXOC5_DROME/89-705L..---.AGYAEMETKCLTAKCSTELEKFY----------........................................
A1DAY7_NEOFI/117-893FVG---.SSYIEREKKSLEELYTSLLFRFT----------.TF....HAR..................RKRAATTFMASI
EXOC5_CAEEL/46-659I..---.ATYCSEELKYLNDQCSNLLQRFY----------........................................
Q6FMF7_CANGA/102-810LFD---RSKYFDIEKRSLEIILIEMTSRFN----------.TL....HEKDIRQRLLT.......NKFKASTNDSPETRI
Q4PHT4_USTMA/134-1026MEG---.IRYIDRESRSLADLYAGLLFKFI----------.SF....HRTSAAAKRDKASGNTIFNRMRNQITATSDASS
SEC10_SCHPO/101-799IEV---.DDYLKREEHSLRSLFRLSLYKYT----------.SY....KIR..................LETPEPGLLRSL
Q5KJ89_CRYNJ/95-875LEG---.TRYLECESKNLVELYAGLLSRFT----------.RY....HETVLQAKPNSL.....LNKVVHQLASSSSAAT
Q5AS51_EMENI/111-841FVG---.SSYIEREKRTLEELYTSLLFKFT----------.TF....HGR..................RKKAATTFMASL
Q6CQC0_KLULA/109-807LFD---RSKYFEVEKRTLENVLVQKASDFN----------.IS....FDSDIRPRSLA.......NKLNEVTDFKSSPEL
Q5A111_CANAL/103-782IGD---.NVYFNREKKNLEETIYGIIHQFN----------.TA....NENIIANKSLAARLENLDNVQKPEKDRFSFAS.

PF10191

Q7QA49_ANOGA/2-731GIF---LKEYPTLENSQLEASLQGLTIVGT..........APADSVHNLESANAKIIRWALEAVTRCQDITQNCALLSLG
Q29C94_DROPS/2-737HKF---IQQYPRLEETQLSTQVDRLLSNQS..........TPSDAVRHLEESTRKLYEWLKEACERCSAITSDLALCKLI
Q172R1_AEDAE/2-704DVF---VEQYPSLERSFSNKMLEEMKMNAA..........SVVENVSTLDACNAKVSKWFTDATNRCINITQNKSLPQLV
COG7_RAT/2-767KPY---QLKYGDLEESNLLIQISAVPLEHG..........EVIDCVQELSQSVHKLFGLASAAVDRCAKFTNGLGTCGLL
Q5FW35_XENTR/2-765KPY---QLQYGDLEESNLLIQISAMPLERG..........EVLDCVQELSHSVSRLFSLASGAMDRCIKFTDGLGLCGLL
Q08BK1_DANRE/2-764KTY---QIQYGGLEETNLLIQLSAVPLERG..........EVLDCVLELTHSVQKVFGLAAAAVDRCVKFTDGLAVCGLI
Q0WQF0_ARATH/4-832ESF---KQKYGKMERAILSSEIAVVDLRGAVTRGVGAQGIELSETVRRMEESIPQVVVLLEAAVERCIGFTGGSEADELI
Q655R9_ORYSJ/5-868ETF---KARYGQMERALLSAEMAGIDIRGAIARGVGAQGIELSETVRRMEESIPQIIVLLEAAVERCISLTGGSEADELV

PF08318

Q6BTT0_DEBHA/227-569STYDNAISYVVTKIQHEIDSQIGLISDTFY--------------------------------------------------
Q5TNE6_ANOGA/167-492PGR...LVQICRILQRECDDEVTKCVQEFC--------------------------------------------------
COG4_ARATH/176-480EDG...VAYAICELQEECDLRGSLILKKYM--------------------------------------------------
Q6FTK7_CANGA/185-532VSH...MLHVMGKVQKEADLEAGLVFDIFS--------------------------------------------------
COG4_YEAST/190-526KKH...MVHVMEKVEKEADLQASLILDIFM--------------------------------------------------
COG4_SCHPO/163-482AKN...TITVIEKLQGDCDRQGSIIVNTMF--------------------------------------------------
Q6CKT8_KLULA/180-481TDF...MLEIMQKVQLETDLQACLIWDTFT--------------------------------------------------
Q59T37_CANAL/195-552ATYPSALSYVISKIQREIDLQVGIIADTFY--------------------------------------------------
Q5ZMU8_CHICK/174-484PGR...LYTLIKHLQGECDQQVEKVVEKFV--------------------------------------------------
Q5AW68_EMENI/201-532PRK...MNRVIERLQLEADVQGGIVVDTWS--------------------------------------------------
Q758T0_ASHGO/188-513AKY...MVHIMDKVQKEADLQAGIIWDTFM--------------------------------------------------
Q57XU9_TRYB2/282-627DAG...LLLLLTELHSRSTSQCVPVLKDFL--------------------------------------------------
Q6CAF9_YARLI/156-431KGH...MLLVIQNIQKEADVQAGIIVDTWF--------------------------------------------------
COG4_DROME/166-497SSS...LIDMVSILQHECDTEVKNLLMEFN--------------------------------------------------

PF07393

Q750R9_ASHGO/111-822.........................YSIQG.........SNSKLSKVNSFIRSHLERDKKNAA..............RSP
Q6BHS9_DEBHA/103-810F........................SFHFS.........EKKRLNQFTNFMKTHLSERNAR...................
EXOC5_ARATH/139-817.........................AESQQ.........VSESSGTIGRSKGASISSSLQQ...................
Q2HG63_CHAGB/108-854AQ......................QGTQLI.........ASAKDAYMERLDSSDLTPTQKRIM.............LRVA
Q7PQN8_ANOGA/88-705.........................ETKNH.........QKKQIERFQELRRDMQALIGSR...................
A1D556_NEOFI/126-876MAPVN...............ILPSFSSSKS.........SETKSDQESIGSEPSS..ALKS..................P
Q2URB8_ASPOR/132-879MAPVN...............LLPSFSGTKT.........NESKSDEETSAGDAS...ALKG..................Q
SEC10_YEAST/120-862HSPRG................NTHSRQDST.........SRSKLSQFNSFLKTHLDKDHLSLN..............RTN
Q4RLZ1_TETNG/80-698.........................DSKNH.........QKRSIGT..GSIQELKERIRQR...................
Q55N90_CRYNB/170-1008LLPVTIVPRTVTFGVNAIVSGGTQAVSGLAMLNPQKWTGKGGVVKEVKDGEEVVFEVTDVDEKTAEDMTNDDIMEGVRVT
EXOC5_ORYSJ/117-800.........................AEAKQ.........QSESTGTIGRSNGAAVTTSLQQ...................
A2EZD8_TRIVA/69-728.......................................HLKKLRQIIENAKKWLTRKEEV...................
Q2GXU3_CHAGB/166-960MMPVTVLPTTLTTFSLPGLPLGSPFASKPA.........AASANGSIAAADL......SQQ..................D
Q2TVY5_ASPOR/116-891SK......................SGTELL.........SSARDAYINRLESSDFSPTQRRML.............LQVA
Q5BGH2_EMENI/123-870MAPVN...............ILPSFSNKSS.........EQQKPDRDSLAGD.SG..STPR..................A
Q6CDC8_YARLI/101-777.........................ITHSL.........DNEDNKGIGNFMRNFRDRNERH...................
EXOC5_DROME/89-705.........................ASKKH.........QKTATTK..GFRRNMEVLIATR...................
A1DAY7_NEOFI/117-893SK......................SGTELL.........SSARDAYVNRLESSEFTPTQKKML.............LQLA
EXOC5_CAEEL/46-659............................ES.........KKHVKKQIGGGLHELKRDVAAR...................
Q6FMF7_CANGA/102-810NE......................LSTTNT.........ANSKLSQITTFMKSRIDKDILPVS..............RSR
Q4PHT4_USTMA/134-1026S........................TSSLG.........GSSNTAQTSTAASSTVSTSKTSFFKLS.......NLADRVR
SEC10_SCHPO/101-799MTP....................LQGNMVA.........PTGVHSQFNTKTEG........FL.............LRIA
Q5KJ89_CRYNJ/95-875TS......................STAQTA.........AAAISKYANLFTSSTNNPKTGTATPVLPPSFQKPGLAGQMR
Q5AS51_EMENI/111-841SK......................SGSELL.........ASAREAYINRLDSSEHSPTQKRVL.............IQVA
Q6CQC0_KLULA/109-807K........................ILTSR.........SGGRFSQLNLFLKNKFEKRFEH...................
Q5A111_CANAL/103-782.......................................EKKRMNQFKQYVTAKLKDRTRN...................

PF10191

Q7QA49_ANOGA/2-731SVL------------------------------------QNYLLTYLDQYNKVQKQLAASQ-------------------
Q29C94_DROPS/2-737TLL------------------------------------NGIFKRQLENFGRIQRQLGLSL-------------------
Q172R1_AEDAE/2-704KVF------------------------------------RSFVALYVEKYSTVQKQLMLNQ-------------------
COG7_RAT/2-767TAL------------------------------------KSLFTKYVSHFTNALQSIRKKC-------------------
Q5FW35_XENTR/2-765QAL------------------------------------QSLFKKYVTDFTLTLQSIRKKC-------------------
Q08BK1_DANRE/2-764KAL------------------------------------RALFNKYVSDFSVTLQSIRKKY-------------------
Q0WQF0_ARATH/4-832LAL------------------------------------DDIMLQYISMLQETLKSLRVVC-------------------
Q655R9_ORYSJ/5-868LAL------------------------------------DDIMLQYISNLQETLKSLRIVC-------------------

PF08318

Q6BTT0_DEBHA/227-569---------------------------------------DIKRIDKVIQDISLYNFPVLSK-------------------
Q5TNE6_ANOGA/167-492---------------------------------------RNRQTGRRIAQINDYI...KNA-------------------
COG4_ARATH/176-480---------------------------------------DFRKLAILASDINNSPNLNILP-------------------
Q6FTK7_CANGA/185-532---------------------------------------DTRKVKSVVREISEWNIAQKNK-------------------
COG4_YEAST/190-526---------------------------------------ETRKIERTIHDINEWEHSQKNE-------------------
COG4_SCHPO/163-482---------------------------------------DVRRIDNLVSSIASYKYILLHA-------------------
Q6CKT8_KLULA/180-481---------------------------------------DDVSLDKVFASLQDNN......-------------------
Q59T37_CANAL/195-552---------------------------------------DLRRLDKHFQDIKLYSFPVLTR-------------------
Q5ZMU8_CHICK/174-484---------------------------------------KERDYHRQFQQVQNSMMRSSSA-------------------
Q5AW68_EMENI/201-532---------------------------------------DERHIDRKLMDIKSYAFTFLVQ-------------------
Q758T0_ASHGO/188-513---------------------------------------DVRRIEYLLAEIREWHEAQAQA-------------------
Q57XU9_TRYB2/282-627---------------------------------------KKR..QEVLQAVDCTNNSPSPR-------------------
Q6CAF9_YARLI/156-431---------------------------------------DERRV.EKMVEMGDYD......-------------------
COG4_DROME/166-497---------------------------------------KNRQIQYRSKQVNESTQRSAGG-------------------

PF07393

Q750R9_ASHGO/111-822PLRQPTDNS............................PPPDYTDLTHDEDPLFTLSCLDTMLKCAVESLARMMELI....
Q6BHS9_DEBHA/103-810........N...........................STDFEKHEAESEKYSTLNINEVETVIKSAVESVARVLELA....
EXOC5_ARATH/139-817....................................................ISVTVVTDFVRWNEEAITRCTLFSS...
Q2HG63_CHAGB/108-854GVQDNSS................................NKNDIEVSEQDGILSVAYAKRMIGWLAESVRRTLEMGS...
Q7PQN8_ANOGA/88-705....................................ANINIAQIEDYGGETFLSEELAINLLQQSSHAFERCCLLSK...
A1D556_NEOFI/126-876NRFSTIASPALTPTVEA............PPTTELAAKAAVMKSKLEGIRSLFSIEIALSLVHSAKSSLDRAAQFVKIGG
Q2URB8_ASPOR/132-879NRFSTISMPTTPVTEA..............PTTELAAKAAIMKSKMEGIRSLFSIEVALSLVHAAKSGLERAAQFVQIGG
SEC10_YEAST/120-862TLSDSFNNSSSSTQYDVA.........NNSSSLVNSSFTASDIDNSPNSPANYSLNDVDSMLKCVVESTARVMELI....
Q4RLZ1_TETNG/80-698....................................TNLSLGPVIDTHGETFLSPELVVNLLQETRHAFERCHRLSD...
Q55N90_CRYNB/170-1008ENVENVKEALEPSHASSSNDSHARSAAGSLESSHPSTPSPKNNKSFDRLQLLVSLDTALELIQVDRDSLKRAETFVKYPG
EXOC5_ORYSJ/117-800...................................................QISVTVVTEFVRWNEEAISRCTLLFS...
A2EZD8_TRIVA/69-728.............................................SYDIFSEFNPQMPITILTNGAAAWERCVVLCD...
Q2GXU3_CHAGB/166-960SRAQSPAPSIQAAVDRSSSP.....MPGKAPTDELAAKAALMTSRLEGIKSLFSIEVALSLVHSAKASLGRVAVFIQLGG
Q2TVY5_ASPOR/116-891GLRDANDLL..............................RRTEIKLTEEDGLPSISHAKRMLKWLAEGVSRGLELSV...
Q5BGH2_EMENI/123-870NRFSTISSPGTPPIQE.............APTTELAAKAAIMKSKLEGIRSLFSIEVALGLVHAAKSSLERAARFMAIGG
Q6CDC8_YARLI/101-777.....................................STPDSPVPLEPEDGEIKIDVVQMCLKCLAESIQRVLELAH...
EXOC5_DROME/89-705....................................ANINIAAIEDYGGETFLSEELAINMLQEAKASLKRCRLLSN...
A1DAY7_NEOFI/117-893GLKDQSDSM..............................KPTEIKLMEKDGLPNITYAKRMLKWLAEAVGRGLELGA...
EXOC5_CAEEL/46-659....................................LMN....VETYGGETFVAEDVAISILQETKNAFGRANQLCD...
Q6FMF7_CANGA/102-810SVKENENGS..................................PIDHAGDDGYNLETVDAIIKCIVEAIARVMELI....
Q4PHT4_USTMA/134-1026GTHNTAATSSTLSVTAGSTATA.SAESSVDGQHVAGG..AHVEDELDDTDGDLSLDIAEKMLRWHAESIGRCVDLSS...
SEC10_SCHPO/101-799DIQENLIQSG..........................SFITEDYITIEKNHSHLNSEKVYSFIGWHAEALNRASILIS...
Q5KJ89_CRYNJ/95-875GA.NGADTATWGTGTSTPVI.....RSVTGQELKGDLVNKGLEDKVWSTDGILAPTMAERMLKWHAEAVGRAVELSN...
Q5AS51_EMENI/111-841DLKESTDLA..............................RPNDLIFTEEDGQPSISYAKRMLKWLAEAVGRGLELNM...
Q6CQC0_KLULA/109-807.........E..........................NPAQLNITSKKIDRDYFTLSYIDLMIKCSVESLARVTELV....
Q5A111_CANAL/103-782........................................SEPEPTFMECKSLNVGNVETVLKSVIESVARLLELV....

PF10191

Q7QA49_ANOGA/2-731------------------PSQT............................DWNLLQLSVVLLQYLGSFRQAAYEL-----
Q29C94_DROPS/2-737------------------GSSSYAAQS......................ENWSLLQYTMSQLQCLADFQVQLHQF-----
Q172R1_AEDAE/2-704------------------NDE............................INWSLMQLNLNLLQHLGDFMQIIEQC-----
COG7_RAT/2-767------------------KLDDIPPNSLFQ...................EDWTAFQNSVRIIATCGELLRQCGDF-----
Q5FW35_XENTR/2-765------------------KLDNIPADSLFL...................EDWSAFQNSVRIIGACGELLRQCGDF-----
Q08BK1_DANRE/2-764------------------KLEDTPTSEVFT...................EDWTAFQNSVRVIATCGELLRQCGAF-----
Q0WQF0_ARATH/4-832------------------GVDGTGDGVGSKKDASAEKRESSRKMDLTSNEEWSIVQGALQILTVADCLTSRSSVF-----
Q655R9_ORYSJ/5-868------------------GVDNTAHSDSSKKEAGLEKKEAQRLVDVSEEEEWSIVQGALQILTVADCLTSRTSVF-----

PF08318

Q6BTT0_DEBHA/227-569--------------------------------------------------------------------------------
Q5TNE6_ANOGA/167-492--------------------------------------------------------------------------------
COG4_ARATH/176-480--------------------------------------------------------------------------------
Q6FTK7_CANGA/185-532--------------------------------------------------------------------------------
COG4_YEAST/190-526--------------------------------------------------------------------------------
COG4_SCHPO/163-482--------------------------------------------------------------------------------
Q6CKT8_KLULA/180-481--------------------------------------------------------------------------------
Q59T37_CANAL/195-552--------------------------------------------------------------------------------
Q5ZMU8_CHICK/174-484--------------------------------------------------------------------------------
Q5AW68_EMENI/201-532--------------------------------------------------------------------------------
Q758T0_ASHGO/188-513--------------------------------------------------------------------------------
Q57XU9_TRYB2/282-627--------------------------------------------------------------------------------
Q6CAF9_YARLI/156-431--------------------------------------------------------------------------------
COG4_DROME/166-497--------------------------------------------------------------------------------

PF07393

Q750R9_ASHGO/111-822..PTNSSDFCVELVEVMLLGLISSYVESALE.AAY........................SQLISSDPAQTTN.LNLS.YM
Q6BHS9_DEBHA/103-810..PNKTPEYTLEIIEILLFDFGKLYISAGLE.VAYDT....................LKQESSNSKINSNQP.IDLS.YL
EXOC5_ARATH/139-817.QPATLAANVKAIFTCLLDQV.SVYITEGLERARDSLSEAAALRE....RFVLGRRVAAAAASAAEAAAAAGESSFKSFM
Q2HG63_CHAGB/108-854..ASETPKDVNVLLNLLLTTMGQVYVETALD.AAL........................DQATSQE.NAKNE.PDLS.YL
Q7PQN8_ANOGA/88-705..ETDLPRNILKLTDTLLRYLLHEHCDYALD............................LGLQAIPIAECKSVPQIY.FF
A1D556_NEOFI/126-876ETGAAAKQQCEAIFVSLLRILGHQHLIVGFNKAVDHL....................SNYRPREQGERDQAGVEPLVTFL
Q2URB8_ASPOR/132-879DTGALAKQQCEAIFVALVRILGHRHLIVGFNKAVDHL....................SNYRPREQGERDQSGVEPLVTFL
SEC10_YEAST/120-862..PNKAHLYILEILKIMFLGIVDSYMEIALE.VAY........................WKICKVDINKTAGVVNLN.FL
Q4RLZ1_TETNG/80-698..PSDLPKNAFSIFLLLVEHLCVEHIDYALE............................IGLSAIPSSDAKN.ANLY.FL
Q55N90_CRYNB/170-1008KVGTKVREAIEEIFIFLLKAVGDRHIAPGFKIATNQM....................STYKPAEHE..ETTSVAPLLQFF
EXOC5_ORYSJ/117-800.QPATVAANVRSIFACLLDQV.SQYLTEGLDHARESLNHAATQRDRYVIGTSVSRRVATAAANAAEAAAAAGESSFRSFM
A2EZD8_TRIVA/69-728..PQRKHQVLKSLIDLVIQANLREYLITYLE..............................ACRICMMKENDINTVPRFL
Q2GXU3_CHAGB/166-960QAGGEAREQCEAIFVALLRILGSKHVKPGFDRAVAHL....................SQYNPREVSEHDKGGVAPLVTFI
Q2TVY5_ASPOR/116-891..SSETPKDMLALLTLLLSIMGEGYIEVCLD.AAL........................ETATSQE.LGKTE.PDFA.YL
Q5BGH2_EMENI/123-870ETGAAVKQQCEAIFVALLRILGHGHLIKGFDKAVDHL....................SDYRPREQGDRDQSGVEPLVTFL
Q6CDC8_YARLI/101-777..QNEINDCVVSLHDLLIESVGKSYIETGLD............................DAIVSRDMKTISFV.....HL
EXOC5_DROME/89-705..ETELPGNAIKLNDILLRFLMHEHVDYALE............................LGLQAVPLAEGRVFPQLY.FF
A1DAY7_NEOFI/117-893..TSETPKDVSALLSLLLSLMGEGYVEVCLD.AVL........................ESATSQE.SARAE.PDFG.YL
EXOC5_CAEEL/46-659..KEELPRHVENIVDVLLKYLYGEHLDYAVE............................TGLAGISLAESKTEPPAY.FF
Q6FMF7_CANGA/102-810..PNKATSCIYEILELASMGIIGSYVKNALE.VAY........................CSISKPEQNKVDE.IDLS.SM
Q4PHT4_USTMA/134-1026..PSEVPKATFALLRVLTSAYIKTYVETALD.SAL........................AAVTAQDIRGAVM.PDPSAAM
SEC10_SCHPO/101-799..SQDLSVVISSLVNLLDKLIREDYVFKELS.SIQ........................SYISSHD...KSKNLDLH.YL
Q5KJ89_CRYNJ/95-875..SGDVGKNALALLKVLSEAIGRSFIETALD.STL........................ARLEQQD..NKTE.PDLQ.PL
Q5AS51_EMENI/111-841..NNETPKDMATFLNLLLSIMGEGYLEVCLD.AAL........................EAAATQE.SGRTE.PDFA.FL
Q6CQC0_KLULA/109-807..PAIADDFTYELVETSLIGVIDSYIESALE.VAH........................AQLNSIDIHRETS.IELK.FL
Q5A111_CANAL/103-782..PTKSADYALEVLEILIIDFGKLYIGAGLE.VVY................................DECKKNASLD.YL

PF10191

Q7QA49_ANOGA/2-731--EQTFLQQVLTKHSQL.................-------------------------...TAGSARARF.EYRLNTKG
Q29C94_DROPS/2-737--EHDLHARMATLAAKL.................-------------------------...TKQSSRGNITIFQTCDHA
Q172R1_AEDAE/2-704--EKKIFVSL........................-------------------------......EPREVDSGNSTICNQ
COG7_RAT/2-767--EQQLANRILSTAGKYLSDSYSPRSLAGFQDSI-------------------------LTDKKSPAKNPWQEYNYLQKD
Q5FW35_XENTR/2-765--EQQLASRFLSIAGKHLSDTYSPRSLTGIQETS-------------------------YSDRKSS.RNPWHDYNYLQKG
Q08BK1_DANRE/2-764--EQQLSNKILGRAGRFLWEGFNPRSLTGLQEGV-------------------------..AERRSQKNPWQEYNYLQQS
Q0WQF0_ARATH/4-832--EASLRATLARLNSSLSISLFGTNLDHNLSHLK-------------------------SEQTAGDLSMAGRASMDVPAI
Q655R9_ORYSJ/5-868--EASLRATLARIGTNFSISGFGSSLDKS..TAA-------------------------NGDENAEVPITGRAALDIAAI

PF08318

Q6BTT0_DEBHA/227-569--.....RFSDHEDPS-------------------------------------------GVDQANVNPEEDELVSIVEIG
Q5TNE6_ANOGA/167-492--......GGGSTMGH-------------------------------------------YRKPSGGGGGSIDKLNAKDID
COG4_ARATH/176-480--..............-------------------------------------------........GGASEGPDPREVE
Q6FTK7_CANGA/185-532--NKTQAYKDSGTDQN-------------------------------------------ASQERKSMDNKLPSISTGDLS
COG4_YEAST/190-526--......DVNIDSNQ-------------------------------------------SDIETDGETEKSSIISIHDLA
COG4_SCHPO/163-482--............KL-------------------------------------------KNRAFVSDQKELERVSLQTLH
Q6CKT8_KLULA/180-481--..............-------------------------------------------...............DMRTLQ
Q59T37_CANAL/195-552--RL..AELKDHPNQD-------------------------------------------QESRRTSFDTSDDLLPIRLIG
Q5ZMU8_CHICK/174-484--..............-------------------------------------------............EKIEPRELD
Q5AW68_EMENI/201-532--SF.LPPQRTATPHA-------------------------------------------NSPATQQSAAEDEGVDMKEID
Q758T0_ASHGO/188-513--............NK-------------------------------------------NHLHGAKPNSRPPPSSINELT
Q57XU9_TRYB2/282-627--GE.SNDNSGRSAVT-------------------------------------------SPRQPRALQSRGTTLDPRRTD
Q6CAF9_YARLI/156-431--..............-------------------------------------------...............DLKHVS
COG4_DROME/166-497--GN.LGSNSIQALGH-------------------------------------------YRKPS...GGSVDKLNPKEID

PF07393

Q750R9_ASHGO/111-822KYVSKTTEMLSLISASIKA-----------------------------------IIL.PLLNNSPQAKKDIIKLANAYLK
Q6BHS9_DEBHA/103-810STFKLTSEILYLLSSCIKK-----------------------------------IML.PCAVNSPTIKNRMSSLSNSYIS
EXOC5_ARATH/139-817VAVQRCGSSVAIVQQYFAN-----------------------------------SIS.RLLLPVDGAHAASCEEMSTALS
Q2HG63_CHAGB/108-854PNLRPAVTITNLMSRFITT-----------------------------------VLI.RLAEANTTVRRSMEAQSKMAIE
Q7PQN8_ANOGA/88-705DVAQKCNAIVHLLEKTYNA-----------------------------------SVI.PNVIGTPQYT.DCIQKKRSYLE
A1D556_NEOFI/126-876ELVNVGDLILQMMDVFYEQ-----------------------------------ELVGAKITDRNDFLDPAVKEKKKFEQ
Q2URB8_ASPOR/132-879ELVNVGDLILQMIDVFYEQ-----------------------------------ELIGKKLTDRNDFVDPAVKEKKKFEQ
SEC10_YEAST/120-862KFISMSTEILDLLSISIKS-----------------------------------IFL.PLLNNSPEIKAQIIEMTNSQIQ
Q4RLZ1_TETNG/80-698DVVQQANSIFHLFDKQFHD-----------------------------------QLM.PLISSSPKLA.ECLHKKKEVIE
Q55N90_CRYNB/170-1008ELVHIGDTIQSMVQVYFDK-----------------------------------ELS.PYV.DKTDFLNAVMREKKRFES
EXOC5_ORYSJ/117-800IAVQRCASSVAILQQYFSN-----------------------------------TIS.RLLLPVDGAHPSACEDMGSAVS
A2EZD8_TRIVA/69-728AITSVINMSILTIEAKYSQ-----------------------------------ILK.PHLMQKPQYHEMFLRDRESLIS
Q2GXU3_CHAGB/166-960ELVNVGDLISQMIDVFYEQ-----------------------------------QLAGPKIADRNDFLDPAGLAKKKFEQ
Q2TVY5_ASPOR/116-891PAVRSAIGIANLMVMCINT-----------------------------------LLI.PLATGSITVRREMEKKTNLTTM
Q5BGH2_EMENI/123-870ELVNVGDLILQMIDVFYEQ-----------------------------------EMIGSNITDRNDFLDPAVKEKKKFEQ
Q6CDC8_YARLI/101-777KTIRRVLTAIRLMSVVINS-----------------------------------VIV.PLTDSHGQGRRYIVMQTNNFFT
EXOC5_DROME/89-705DVVQKTNIIVHLLDKLCHT-----------------------------------SVI.PCVSNTPKYS.DYVFKKRILME
A1DAY7_NEOFI/117-893TVVKSIVSITNLMVMCIQT-----------------------------------LLI.PLATPSITIRREMEKKTNTATL
EXOC5_CAEEL/46-659SVVAKCTSVILLMIKQFED-----------------------------------PIF.PIIKETIVEP.SVAKKWQQSLR
Q6FMF7_CANGA/102-810KYISITTEILSLLSTLIKS-----------------------------------VCL.PLLSNYPDVKKKVIIATNSQVK
Q4PHT4_USTMA/134-1026SVVRSVELLISLWQHYVNT-----------------------------------ALL.PLASTSVTSRREMMIFNNHNLL
SEC10_SCHPO/101-799VDIRECKKIMGYFSAYLMS-----------------------------------IVI.PFTGVTASSRRETVNILSSSIS
Q5KJ89_CRYNJ/95-875AVLKPADQICHLWQRYTTT-----------------------------------ALF.PLAGSNVPIRREMTTLNTHNVV
Q5AS51_EMENI/111-841RAVRDSISIANLM......-----------------------------------..........................
Q6CQC0_KLULA/109-807KYISTATEMISIVSAYIKS-----------------------------------IVL.PLLQNCPSIKRKVIALSNAYFK
Q5A111_CANAL/103-782SSFNTISELLFLMSSCIKR-----------------------------------IIL.PIATNIPSIKTRMSNMVNGFVA

PF10191

Q7QA49_ANOGA/2-731EFNELHKLATTFQQPSSES..........................................GRE..YFSEFHQRMKRTCE
Q29C94_DROPS/2-737ARTQLLNAIADYQQKKAEA..........................................TESLGIFPQIYAALKLQFS
Q172R1_AEDAE/2-704RIIRHNTKARDLLAPSVDA............................................GNSVFSKELQTLQKVAI
COG7_RAT/2-767NPAEYANLMEILYTLKEKG..........................................SSNHNLLSVSRTALTRLNQ
Q5FW35_XENTR/2-765DPAQYANLMETLYMLKEKG..........................................AVSTSLLAASRSAFTRQNQ
Q08BK1_DANRE/2-764NTAEYNNLLETLHSLKEKG..........................................TGNSSLLAETRAALTRLNQ
Q0WQF0_ARATH/4-832RLVDVPEKAHKLLNLLEQS.........................................KDPRFHALPLASQRVAAFAD
Q655R9_ORYSJ/5-868RLTDLPDKSKKLFTVLEQASYIFLNYLASVTTLELSHVSLICLNSLIANLGGSIKLDYLSKDPRFHALPLTSQRVAAFSD

PF08318

Q6BTT0_DEBHA/227-569DLVSELAGILHNWALYCKF-------------------------------------------------------------
Q5TNE6_ANOGA/167-492SLIGEITIMHSRAELYVKF-------------------------------------------------------------
COG4_ARATH/176-480LYVEEILSLMQLGEDYTEF-------------------------------------------------------------
Q6FTK7_CANGA/185-532GLIGEFSQILQNWSMYLKF-------------------------------------------------------------
COG4_YEAST/190-526LLIMEFSQILQNWSMYSRF-------------------------------------------------------------
COG4_SCHPO/163-482PILNEMSAIVSKWNISKIF-------------------------------------------------------------
Q6CKT8_KLULA/180-481AIILQFSNFLQNWSMYCQF-------------------------------------------------------------
Q59T37_CANAL/195-552DLIQELSSIFENWTLYCRF-------------------------------------------------------------
Q5ZMU8_CHICK/174-484PILTEVTLMNARSELYLRF-------------------------------------------------------------
Q5AW68_EMENI/201-532GLLNEMTVMLSRWSLYTRF-------------------------------------------------------------
Q758T0_ASHGO/188-513MLISEYSAIFQHWSMYCRF-------------------------------------------------------------
Q57XU9_TRYB2/282-627QILEEMSHLVSCYHLYWTF-------------------------------------------------------------
Q6CAF9_YARLI/156-431DLLAECGMILNRWALYRKF-------------------------------------------------------------
COG4_DROME/166-497AIIAEITVMHARVELYFRF-------------------------------------------------------------

PF07393

Q750R9_ASHGO/111-822RAELAINIILEDTVQMVDQRFTIVLL.KQNKKDFVPRSQELLD.........................QDTVTGSELVTM
Q6BHS9_DEBHA/103-810RCEISLNIIIGDTIAMICNRVAYLLT.RQKKKDFLC..ENIV.......................E..DDTEACEEVSEF
EXOC5_ARATH/139-817KAEAAAYKGLQQCIETVMAEVDRLLSSEQKSTDYRSTDDGIA.......................SDHRPTNACIRVVAY
Q2HG63_CHAGB/108-854ATERKANAVIKSTLDVAVNWTTKLLA.QQKKADFRPKDNDLE.G....................VVEALQTPTCQAISTF
Q7PQN8_ANOGA/88-705TVENKIETGLERTLNAIFGWVKTYLSSEQKKSDFKPDTDVDT.......................V...ASNACLAVVQY
A1D556_NEOFI/126-876ILDERVAAGLNKGIDVLMEEVDYILATRQQATDFNP.DVSTD.PYR.................KTMDVAVSEAAAAVVDV
Q2URB8_ASPOR/132-879NLDERVAAGLNKGIDVLMEEVDYILATRQLATDFNP.SVSTD.PYR.................QTMDVSVSEAAVAVVDV
SEC10_YEAST/120-862KMEILINIILQETITVISTKFSAILC.KQKKKDFVPKSQELL.......................D..QDTLPAIEIVNI
Q4RLZ1_TETNG/80-698QMEVKLDTGIDRTINCMVGQMKYILATEQKKTDFKPEDENNV.......................M.IQYTTACSKVCVY
Q55N90_CRYNB/170-1008VLDDAVAAGLNAGIEVLMNQVEHIILVKTGPREYYP.......VEG.................TPMELGPTQGCKEAIMC
EXOC5_ORYSJ/117-800VVEAAAHKGLLQCIDTVMSEVERLLSSEQKATDYRTPDDGAA.......................PDHRPTNACIRIVAY
A2EZD8_TRIVA/69-728SLEDGITKNLQICINIITDRVKSIVATKNFKNSFLQQNVDGS...........................VSQSCKEICQI
Q2GXU3_CHAGB/166-960MLDESVAAGLNKGIDVLMDEVEYLCATTQLPTDYNPGAATASTPDPASSTTSFEKRASTLPGTLDMDIGPTRTAQRIREL
Q2TVY5_ASPOR/116-891RIEEKVNTIEQKIIDASLVWINKLLS.GQRKNDFRPKEGDNA.A....................WLEKLQTPTCSSICTF
Q5BGH2_EMENI/123-870NLDERVAAGLNKGIDVLMEEVDYILATRQLATDFNP.DVSTD.PHR.................KTMDVSVTEAAAAVVDV
Q6CDC8_YARLI/101-777KCEEKINSILQVTLDIVSARVTVLLS.KQKKRDFLPKEDTPT.......................H..QPTSTCLELISF
EXOC5_DROME/89-705QIETKLDQGLDRSISAVIGWVKVYLQYEQKKTDYKPETDVDT.......................I...SSAACLQVVQN
A1DAY7_NEOFI/117-893RIEDKINAIEQKVIDTALMWISRLLS.GQKKNDFRPKEGDNA.A....................WLEMLHTPTCASICAF
EXOC5_CAEEL/46-659SLESKMSLGLERQLNSIVGYVKFLFS.EQKKTDFRPDSQQID.......................I..RVSPQCQLASRF
Q6FMF7_CANGA/102-810NCEVMINLIMEEVFQQFSNKFIASLS.KQKRKDFLPKSLDLL.......................D..QDTQPAVEIVNL
Q4PHT4_USTMA/134-1026RVEGKCDALMQKIADNVVGFLSNRLS.TQRKNDFTPKNDDLA.......................FARQNTEPCVACSEA
SEC10_SCHPO/101-799VIECAVNDVFYATVHALGDHLEIILS.PYRQISYAMTEEQID.SS..................TELRQSMTRNVQNYLDY
Q5KJ89_CRYNJ/95-875RMEGKANNVIQKAIDNVIGWLSYLLT.KQKKNDYKPKNDELS.......................FARTITEPCELCCEF
Q5AS51_EMENI/111-841.........QQGALPFVERWKRRPTWQLQKKNDFRPKEGDST.A....................WLEKLQTPTCASLCAF
Q6CQC0_KLULA/109-807KCELLMNLLIVETSKLLNQKFTLILS.KQKRKDFLSKSQDFL.......................D..QDTETTTELVNV
Q5A111_CANAL/103-782QCEISLNVILNDTLDHFRVKLQSQLA.KQKKRDFNCNNIE............................DDTEACELVSNY

PF10191

Q7QA49_ANOGA/2-731DIHDTMLQIAFSPITKHFKQIEPAATGPTGAAGGTTAMDTLP----------------------DYSYAPQEYITLISQY
Q29C94_DROPS/2-737ETHDITLNILLQPIETHLAHIRPAAETHPSTGI......DMP----------------------SFSFAPQESITQIGQY
Q172R1_AEDAE/2-704EIHDCVLKHIFVYIEAQFKQMEFTIKQHSE.......NYDLP----------------------DYSYAPQEYVTQIGQY
COG7_RAT/2-767QAHQLAFDSVFLRIKQQLLLV.SRMDSWNTAGIGETLTDDLP----------------------AFSLTPLEYISNIGQY
Q5FW35_XENTR/2-765VAHQLAFDSVFLHIKQQLLLV.PKMESWSCEGSGEMLTEDLP----------------------TFSLTPLEYISNIGQY
Q08BK1_DANRE/2-764QANQLAFDSVFLQIKQQLFLL.NKPEARGSASLGETLTDDLP----------------------AFSLSPQEYITNIGQY
Q0WQF0_ARATH/4-832TVNELVYDVLISKVRQRLGEV.SRLPIWSS..VEEQTAFPLP----------------------NFSSYPQSYVTSVGEY
Q655R9_ORYSJ/5-868TVNELVYDVLISKVRQRLNEV.ARLPIWSS..VEEPGGLPLP----------------------SFSAYPQAYVTSVGEY

PF08318

Q6BTT0_DEBHA/227-569---------ITLKYYQ..............SNDGTDNDE..G--------------------------LKLPKLIMDSNF
Q5TNE6_ANOGA/167-492---------IKRRCANDL..........EKSSLPAEVKQERL--------------------------AELQTLLQKSRL
COG4_ARATH/176-480---------MVSKIKS..............LTSVDPELL...--------------------------PTATKAFRNKSF
Q6FTK7_CANGA/185-532---------FSVRWNE..............FSNENPSV....--------------------------LTLPSSLETSKF
COG4_YEAST/190-526---------YSVKWNE..............FSDLHPHV....--------------------------LQPPPPIADGKF
COG4_SCHPO/163-482---------ISRLVLRLS.........QSDGTSNDPSVQD.N--------------------------LICASIFNSSKM
Q6CKT8_KLULA/180-481---------FSMKWLQ..............FTNGSVDP....--------------------------IKIVPCLTSGKF
Q59T37_CANAL/195-552---------ITVKYLQEPKHRQNGKEVVTGKSPTEDKDA...--------------------------LLLPDLIRKSTF
Q5ZMU8_CHICK/174-484---------IKRRIVADFE........VGDSMASEEVKQEHQ--------------------------KYLDKLLNNCLL
Q5AW68_EMENI/201-532---------LAET.................CNANEEQK....--------------------------FELPQFLKESAL
Q758T0_ASHGO/188-513---------FALKWDE..............FSQNTATE....--------------------------LELPSLISEGKF
Q57XU9_TRYB2/282-627---------AQSKQQECTQR......VREKEGGAREQNDGMN--------------------------QSADSLWSSRDN
Q6CAF9_YARLI/156-431---------LAGF.............................--------------------------EGGDKVTEKSMF
COG4_DROME/166-497---------MRRRLQVH...........VETCVPEKEQFDIM--------------------------ERYEKIMKNSDL

PF07393

Q750R9_ASHGO/111-822L.YSIHSQASRHLN..NA..............................................................
Q6BHS9_DEBHA/103-810L.THSHEKLALYLN..NS..............................................................
EXOC5_ARATH/139-817L.SRVLESAFTALE..GL..............................................................
Q2HG63_CHAGB/108-854LASKVALSARQAVD..GH..............................................................
Q7PQN8_ANOGA/88-705L.NPLIGLIQKTID..GE..............................................................
A1D556_NEOFI/126-876V.SSHTQMLVGSTD..KS..............................................................
Q2URB8_ASPOR/132-879V.SSHTQMLVGGTD..KS..............................................................
SEC10_YEAST/120-862L.NLIFEQSSKFLK..GK..............................................................
Q4RLZ1_TETNG/80-698V.SRQVEHVRKSMD..GK..............................................................
Q55N90_CRYNB/170-1008L.EMHCNLLKGSTS..KE..............................................................
EXOC5_ORYSJ/117-800L.SRVLEVAFSALE..GL..............................................................
A2EZD8_TRIVA/69-728L.TGPNSVIQEATALSGD..............................................................
Q2GXU3_CHAGB/166-960V.ASHTSMLVGSTD..KS..............................................................
Q2TVY5_ASPOR/116-891L.SRVHNMTATSLPPGGS..............................................................
Q5BGH2_EMENI/123-870V.SSHTQMLVGSTD..KS..............................................................
Q6CDC8_YARLI/101-777L.TEVHDAGAIFLI..EQ..............................................................
EXOC5_DROME/89-705L.QPVIVQIKKCVD..GE..............................................................
A1DAY7_NEOFI/117-893L.TRLHDTIAATLSSSGS..............................................................
EXOC5_CAEEL/46-659L.ANQVAAMELGCD..GE..............................................................
Q6FMF7_CANGA/102-810L.NSTYSQVSQHLK..SQ..............................................................
Q4PHT4_USTMA/134-1026L.EKVQQAARVHLSLSSSRMVSSTSGSINVRGSPGPVQRPGSSRAIRGAASIDTDEAVARVSWNANNPRADADAADDDDD
SEC10_SCHPO/101-799I.KNLYHRLGPY....DP..............................................................
Q5KJ89_CRYNJ/95-875L.ATVRDAVNEGLS..GK..............................................................
Q5AS51_EMENI/111-841L.ARVHDVAVSSLPASGA..............................................................
Q6CQC0_KLULA/109-807L.SSVYSQSALYLK..NG..............................................................
Q5A111_CANAL/103-782L.VEIHSSIVSAMN..GA..............................................................

PF10191

Q7QA49_ANOGA/2-731L-LTLPQHLEPLLLSPAA----------------------------------------------ALKAVLEVADHRYASN
Q29C94_DROPS/2-737L-LTLPQHLEPLLLAPSA----------------------------------------------LLKQALEVCNVKYTQA
Q172R1_AEDAE/2-704L-LTLPQHLEPLLLSPSP----------------------------------------------ALKFIMEFCEDKYKGE
COG7_RAT/2-767I-MSLPLNLEPFVTQEDS----------------------------------------------ALELALHAGKLPFPPE
Q5FW35_XENTR/2-765L-MSLPLHLEPFVTPEDS----------------------------------------------TLELALHAGKLPFPPE
Q08BK1_DANRE/2-764I-MSLPLHLEPFVTQEDP----------------------------------------------ALELALHTGKLPYPPE
Q0WQF0_ARATH/4-832L-LTLPQQLEPLAEGI..----------------------------------------------.............STN
Q655R9_ORYSJ/5-868L-LTLPQQLEPLAEGI..----------------------------------------------..............SG

PF08318

Q6BTT0_DEBHA/227-569TGKI.HKKFLPAFE------------------------------------------------------------------
Q5TNE6_ANOGA/167-492NTQM..QELLSTYL------------------------------------------------------------------
COG4_ARATH/176-480SKAI..QDVTRYYV------------------------------------------------------------------
Q6FTK7_CANGA/185-532SNKLREERYLDDFL------------------------------------------------------------------
COG4_YEAST/190-526ALKLKQDKVFDEFQ------------------------------------------------------------------
COG4_SCHPO/163-482ELLL.KKQLLPSLL------------------------------------------------------------------
Q6CKT8_KLULA/180-481NSKL..QDNIDTFH------------------------------------------------------------------
Q59T37_CANAL/195-552TRKI.NEKLLPSFE------------------------------------------------------------------
Q5ZMU8_CHICK/174-484SCTM..QELIGYYI------------------------------------------------------------------
Q5AW68_EMENI/201-532SKKI.EDRVISPFN------------------------------------------------------------------
Q758T0_ASHGO/188-513SAKV..TDSMSGFE------------------------------------------------------------------
Q57XU9_TRYB2/282-627PLMTAVQEILAIFV------------------------------------------------------------------
Q6CAF9_YARLI/156-431QQKI.DSRVLPVFA------------------------------------------------------------------
COG4_DROME/166-497RRQM..QEILSTYL------------------------------------------------------------------

PF07393

Q750R9_ASHGO/111-822..........NLKSFLTEVGNTLYERLLQHYKKFYVSS.IGGVIVTKDIIGYQNAIEEW....GIEELDEKFALLRELAN
Q6BHS9_DEBHA/103-810..........NLTNVLVKIGMNFLNQLLEHYKKFVVNS.TGGIILTKDVIRFQSVIDEW....QISELSEHFLLLKEIGN
EXOC5_ARATH/139-817..........NKQAFLTELGNRLEKLLLTHWQKFTFNP.SGGLRLKRDLNEYVGFVKSF....GAPSVDEKFELLGIIAN
Q2HG63_CHAGB/108-854..........NLEIFSSELALAVHRLLFEHFKKFQVNA.TGGLMVTKDIAKYVSTVKDWPLPKEVE...QTLELLTEVGY
Q7PQN8_ANOGA/88-705..........NLAAVLTEFGIRYHRVVFEHLQQFQYNT.AGAMCAICDVNEYRKSARVL....QSPLVTQLFDVLHALCN
A1D556_NEOFI/126-876..........TLDVFNQEVGLRLFTALCKHLKRQRVSI.EGSLKLISDMNHYFKFIQSL....KNNDLLLYFKAFRELAQ
Q2URB8_ASPOR/132-879..........TLDVFNQEIGLRLFTALCKHLKRQRISV.EGSLKLISDMNHYFKFIQRF....KNNELLVYFKAFRELSQ
SEC10_YEAST/120-862..........NLQTFLTLIGEELYGLLLSHYSHFQVNS.IGGVVVTKDIIGYQTAIEDW....GVASLIDKFATLRELAN
Q4RLZ1_TETNG/80-698..........NVDTVLTELGVRFHRLIHEHLQQYSYSS.MGGMLAICDVAEYRRCAKDF....RVPLVLQLFDTLHALCN
Q55N90_CRYNB/170-1008..........VLEVFYQEVGIRLEAIIQRHIKRQIISL.EGGFQVIADLNAYYDFVSSL....KQQRITDDFSDLKMLGN
EXOC5_ORYSJ/117-800..........NKQSFLTELGNRLHKGLLNHWQKFTFSP.SGGLRLKRDITEYGEFVRSF....NAPSIDEKFELLGIMAN
A2EZD8_TRIVA/69-728..........NNISFCSVLAKELIDTICNALFEVRYDFPEGTMQLSMDLNEYRNAFIKF....NLDFVNIKFEDLDIAAK
Q2GXU3_CHAGB/166-960..........MLDVFNGEVGLRLFTAVCKHLKRQRVST.EGAIKLIADMNLYFEYVRTL....RNQDLLAYFKALRELSQ
Q2TVY5_ASPOR/116-891..........NLRQLLTEIAMGTRSLLLEHFKRFAVNG.PGGLMVTKDMTQYTDLLKSWDIDEQVKGPGGALDVLLEVGS
Q5BGH2_EMENI/123-870..........TLDVFNQEVGLRLFTALCKHLKRQRISI.EGSLKLISDMNHYFKFIQRL....KNNELLIYFKAFRELSQ
Q6CDC8_YARLI/101-777..........TLKQFLFHVGIEFRDALLEHLKKFTVSV.AGGSILSMDMANYTKMVNSW....GISELSEAFVIVNDLAG
EXOC5_DROME/89-705..........NLQNVLTEFGTRLHRVIYDHLQTMQFNT.AGAMCAICDVNEYRKCIREL....DSPLVTQLFDILHALCN
A1DAY7_NEOFI/117-893..........NFRHLLTEIALGTRSHLLEHFKRYAVNG.AGGLMVTKDMTQYADLLKSWDIDEHIKGPGGSLDVLLEVGS
EXOC5_CAEEL/46-659..........NLEALQSDLATRLFKFMLTHIQQFTYNS.TGAVLLLCDVGELRTLVSKW....RVQNALTQWESLQALTN
Q6FMF7_CANGA/102-810..........NLTTFLSTIGEDLYRLLLDHYGKFQVNS.TGGIIVTKDIIGYQTTVDDW....DIPDLSEKFATLRELAN
Q4PHT4_USTMA/134-1026DQHGRSHLSRNAESFLTEIGVAFHGLLLEHLRKYTVSA.TGGIMLTKDLAVYQDAIGTF....GIPVLSDRFEMLRQLGN
SEC10_SCHPO/101-799..........SLLALKQKTATMLAAMLISFAFRSKVTA.AGALLLQNDINFFHSTLTSW....GIDTVDAKFKLILQLLS
Q5KJ89_CRYNJ/95-875..........NAEAFLTEIGVSFHTLLLDHYKKFPVNP.TGGLMLTKDLASYQDVMASY....SVPAINDRFDMLRQLGN
Q5AS51_EMENI/111-841..........NLPQLLSEIALGTRSLLLEHFKRFVVNG.PGGLMVTKDMTQYANLLKSWEIDEQIRAPSGMLDVLLEVGS
Q6CQC0_KLULA/109-807..........NLKAFLTKLGDNLFEQLLNHYKKFQVSS.TGGVIVTKDIIAFQTAVEDW....DVEELNEKFATLRELSN
Q5A111_CANAL/103-782..........NLEKILIKIGMEVLHQLLEHYKKFTVNS.IGGIVLTKDVIRYQSVIDGW....KIPELSEQFQILREIGN

PF10191

Q7QA49_ANOGA/2-731R........PCADVFLALVVEESEALYVEQIENICSLSVSGAKQLATDIEYFGSVLEEM----GQSLGGN----LQQTVK
Q29C94_DROPS/2-737I........PCADVLLSLVVEQCCILYQAQILQIKTLPASAAKQLSVDIEYLSNVLEEL----GLSINLQ----LSQILT
Q172R1_AEDAE/2-704K........ACADVLLFLIVEETTAMYQEKIDEILSLSASSAKQLATDIEYFGNVLEEM----SLTLSTN----LQQIIV
COG7_RAT/2-767QGEELPELDNMADNWLGSIARATMQTYCDGILQIPAVTPHSTKQLATDIDYLINVMDAL----GLQPSRT----LQNIAT
Q5FW35_XENTR/2-765QGEETPELDNMADYWLGSLARATMQTYCDVILQISLLTPHTTKQLATDIDYLINVMDAL----GLQPTRT----LQHIVT
Q08BK1_DANRE/2-764QGDDVPELENTADYWLGSIARATMQTYCDVILQLPELSAHHTKQLATDIDYLSNVMDAL----GLQTSRT----LQNIVT
Q0WQF0_ARATH/4-832GDSNNEDAQFFATEWMFKVAEGATALYMDQLRGIQYISDRGAQQLSVDIEYLSNVLSAL----SMPIPPV----LATFQT
Q655R9_ORYSJ/5-868GEAGNEEAQFFATEWIFKVAEGATALFMEQLRGIHYITDRGAQQLAADIEYLSNVLSAL----SMPIPPF----LATFHT

PF08318

Q6BTT0_DEBHA/227-569----------SLYSYYFRRSLEKAITIEELPSLEPHLIMT.SSSDPPDQVPCSSVIEDA-----------TLVLNTTLRN
Q5TNE6_ANOGA/167-492----------LFERYFMEESVLKAIGLDKL................EEGQQCSSMLDDV-----------FFIVRKCIRR
COG4_ARATH/176-480----------ILEGFFMVENVRKAIRIDE................HVPDSLTTSMVDDV-----------FYVLQSCLRR
Q6FTK7_CANGA/185-532----------SLTIYHLQSSFARSRTIEELPDLNHLVIPTPIKTNDGLAYPVSSVVEDL-----------TLLLRKGLVL
COG4_YEAST/190-526----------VFVLNHLQRSFRNSISLEELPSLNDLITAVPLNDHDNISYPVTSVLDDL-----------ILLVRKNLIS
COG4_SCHPO/163-482----------QLETYYFRRSIETSLELEEYY..............TKVSPWMSSIVDDV-----------MYVTKQVFQR
Q6CKT8_KLULA/180-481----------ALTIHYTTYCFKSSLKTSCMPNLNDSLDITLSQNTESNQQIISPVLEDL-----------AILIKSYLVW
Q59T37_CANAL/195-552----------TLYKFYFRRSIEKSITIEELPSLDAYLVLSNEPGVHPEQVPISSVVEDL-----------TLVLNNTLRN
Q5ZMU8_CHICK/174-484----------TMEQYFMRETVNKAVAMDSY................EKGQLTSSMVDDV-----------FYIVKKCIGR
Q5AW68_EMENI/201-532----------TMTTFFFRRSVEKAFQLDEQPTGLTLNLQ...RPLKADPPHITSAVDDI-----------MYIVNKVLQQ
Q758T0_ASHGO/188-513----------QLVRHQLYRSFANAVDLEELPSLNDYLGPTPYDHEDLSSYPISSILEDL-----------VLLIRVNLIA
Q57XU9_TRYB2/282-627----------PLQTHYFEAAFHQVLQIQLDAINASSH........EHPMPSTTAAVTAG-----------NNSTKQQVGY
Q6CAF9_YARLI/156-431----------ELTRAFFQASIQKAVELEV................VNEDTHVTSLVEDT-----------MYILKTVLGH
COG4_DROME/166-497----------LLERYFMEESVLKAIGLDTY................ESGQQCSSMVDDV-----------FFILRKSIRR

PF07393

Q750R9_ASHGO/111-822LFTV.QPELLESLTKEGRL...........................VNIGRNIISEYISRREDFN....NDSF
Q6BHS9_DEBHA/103-810LFTV.HPNLINSLVTEGQL...........................ANLKPYAIRQYISKRTDFNPSYLEKFF
EXOC5_ARATH/139-817VFIV.APDSLPTLFEGSPS..............................IRKDAQRFIQLREDYKSAKLATKL
Q2HG63_CHAGB/108-854LFII.GPEALKERSRNLAAGSSA..................GAGGGKRLGKADFKAFVQKREDASSAGVQGVL
Q7PQN8_ANOGA/88-705LLLV.KHENLQEVCGGETL...........................NYLDKSVVMNFIQLRSDYKTIKISNSL
A1D556_NEOFI/126-876IYLI.DPSDAKELATIIADAD......................RFYGIWRVEEVYEFAERRADWFQVKRDVER
Q2URB8_ASPOR/132-879IYLI.DPSDAKELATIIADSG......................RFQGIWTVEDVCEFAERRADWYQVKRDVER
SEC10_YEAST/120-862LFTV.QPELLESLTKEGHL...........................ADIGRDIIQSYISNREDFN....HDNF
Q4RLZ1_TETNG/80-698LLVV.APDNLKQVCSGEQL...........................TNLDRNLLHAFVQLRVDYRSARLGRHF
Q55N90_CRYNB/170-1008VYIVSDAKDLAQIVRDVSRY.........................GGAFTPEDIYEFIQRRSDWKKIEKTVDK
EXOC5_ORYSJ/117-800VFIV.APESLASLFEGTPS..............................IRKDALRFIQLRDDYKTAKIASML
A2EZD8_TRIVA/69-728IMCT.PADRIQMVKKDLQM...........................TPKSIDLAKKLLPLRTDAKDEDLANAL
Q2GXU3_CHAGB/166-960IYLI.DARHAKEMATIIADGD......................RFGGIFRAEEVYEYAERRADWYQVRKDVER
Q2TVY5_ASPOR/116-891LFVV.GSEALRERVWSGAASSSSRPGNNTGT...SSGRGAGGGQVEAGLSVQEVRAYVSRREDSNTAAMQNVL
Q5BGH2_EMENI/123-870IYLI.DSSDAKELANFIADAG......................RFSGIWRVEEVYEFAERRADWYQIKRDVER
Q6CDC8_YARLI/101-777IFAA.ELAMVNSLVKEGPL...........................SKTKPFILKEYLSKRSDYQGGTVNKMF
EXOC5_DROME/89-705LLLV.KPQNLQEVCTGDTL...........................NYLDKSVVRQFIQLRTDFRIIKNTNYL
A1DAY7_NEOFI/117-893LFVI.GPEALRERIRAGASSNASRRPGTNRTETERGQELVGTGQIEPGLSVQEIRAYVSRREDSSTTAMQNVL
EXOC5_CAEEL/46-659LLAV.LPDQVNETAHSSLL...........................ENVDRQLIHDFVRLRTDFRSIKNFQI.
Q6FMF7_CANGA/102-810LFTV.QPDLLDSLTKEGHL...........................AHMSRGIIQTYIANREDFN....QDNF
Q4PHT4_USTMA/134-1026LFIV.QASVLKSYMREGHL...........................AKIDERLLRPYLLRRADYAKEVRDLDD
SEC10_SCHPO/101-799LLMV.KIDVLPAVMQDKRK...........................AGFSEMNIHEVLRLRFDLP.ENLKLQL
Q5KJ89_CRYNJ/95-875SFIV.QPNVLKSYLTESHL...........................GRIDARLLRPYLAQRSDYSQFSRSLQL
Q5AS51_EMENI/111-841LFVI.GPEALRERMRGPGGSSSGKTSSNPGA...TSARGPGVTSTEAGLSIQDVRAYVFRREDSNTPAMQQML
Q6CQC0_KLULA/109-807LFTV.QPELLTSLTKEGRL...........................VNVDREIIDEYISKREDYN....QDGF
Q5A111_CANAL/103-782LFTV.QTDLVNSLVTEGQL...........................ANMKPYTVRQYITKRADFNPSYADKFF

PF10191

Q7QA49_ANOGA/2-731LLRA-PLESYASAAT....---------------------------.GCDPELVAAIRQKRN-----------
Q29C94_DROPS/2-737LLKA-APDQYLTLSS....---------------------------.GCEPRLVTAIRQMRN-----------
Q172R1_AEDAE/2-704LLRA-PLDQYNAVSA....---------------------------.GYNPRVVASIRQKRN-----------
COG7_RAT/2-767LLKA-KPEEYRQVSK....---------------------------.GLPRRLAATVATMRG-----------
Q5FW35_XENTR/2-765LLKA-KPEEYRPVAK....---------------------------.SLPRKLSSSIAAMRS-----------
Q08BK1_DANRE/2-764LLRV-KPDEYRQTAK....---------------------------.TLPRRLSATIANIRG-----------
Q0WQF0_ARATH/4-832CLAT-PRGELKDVMKSEAG---------------------------NELDCPTANLVCKMRR-----------
Q655R9_ORYSJ/5-868CIST-PRDQVRDLIKSDGG---------------------------SQLDLPTAHLVCKIRR-----------

PF08318

Q6BTT0_DEBHA/227-569IIDTAQPITLKRFINE.DF---------------------------KVIQRDLINGFFIKNLN----------
Q5TNE6_ANOGA/167-492SNGTQSLDGVCAVINN.AA---------------------------SCLEEDY.MKALKAPLK----------
COG4_ARATH/176-480AISTSNISSVIAVLSY.AG---------------------------SLLGNDY.HEALQQKIR----------
Q6FTK7_CANGA/185-532TVNSGNFEVVSQFLEN.LV---------------------------RFIQNDFLVRFMQDRFK----------
COG4_YEAST/190-526VVNTGQFKLLASFLNE.LV---------------------------KFFQNRFLVKFMQNKFK----------
COG4_SCHPO/163-482AFFTVSSLFFTRFVNESLI---------------------------PILRNDY.YVYLSHNLL----------
Q6CKT8_KLULA/180-481TLNSGQTELVTKSLDS.IS---------------------------QMIQNEYLISFVQSSLT----------
Q59T37_CANAL/195-552IIQSGLPTAVKSFINE.SF---------------------------GIVQQDLLNGFFIKNLN----------
Q5ZMU8_CHICK/174-484ALSSSNIDCLCAMINH.ST---------------------------TELESDF.REVLCNKLK----------
Q5AW68_EMENI/201-532SLSTSQIAVVTSVVPT.LS---------------------------RVLGSDF.IGMTQRKMR----------
Q758T0_ASHGO/188-513TVNTGQKALLYKFSEA.LM---------------------------RFIQTEFLIKVLQSRFK----------
Q57XU9_TRYB2/282-627GSTTSNKAAATLMTG..LA---------------------------AAIYNSTTSGSSANTGG----------
Q6CAF9_YARLI/156-431IVGTGVESHVSSQLTM.LR---------------------------KVLDSAY.ISHFQTRIR----------
COG4_DROME/166-497ALTTQSINGTCAVINN.VA---------------------------ACLDGDF.VNALKAPLK----------

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window