Sequence alignment for CL0298

PF10458

SYV_OCEIH/818-883----------------------------------------DFDKEIKRLENELAKWTKEVERVQKKLSN-----------
A0NQJ6_9RHOB/908-973----------------------------------------DLGAEKTRLQKEAGKLEGEITKIEKKLSN-----------
SYV_THET2/797-862----------------------------------------DVEEWRRRQEKRLKELLALAERSQRKLAS-----------
SYV_BACCZ/815-880----------------------------------------NLDEERARLEKELEKFDKEVERVQKKLSN-----------
A3DC83_CLOTH/816-881----------------------------------------DIEKEIERLEKELSNLQKELDRVNSKLAN-----------
SYV_LEPIC/816-881----------------------------------------DVAKEKARLEKELQKSELEKEKLEIKLSN-----------
B1YJU7_EXIS2/812-877----------------------------------------NIEEEIARLNKELVKYTKEVERVEKKLNN-----------
A6NZ53_9FIRM/832-890----------------------------------------DMEKEKARMEKELKKNQAELDKLDTKLNN-----------
A7NGB2_ROSCS/839-904----------------------------------------DLEAERARLLKELESALAEAARREARLAT-----------
Q2KY84_BORA1/893-958----------------------------------------DVAAERVRLDKEIARLEGEIAKANGKLNN-----------
Q28LL8_JANSC/961-1026----------------------------------------DVDEEKARLEKTLGKLAKELGGLRGRLNN-----------
A3M8B2_ACIBT/42-107----------------------------------------DPKAELARLQKDLDKIQKQHDQIANKLAN-----------
SYV_PROMT/868-933----------------------------------------DIASLRSRLEKDLNKAQKEIESLSGRLAN-----------
Q39X26_GEOMG/819-884----------------------------------------DVEEEEKRLLKEIGKLDKDIEFLAKKLAN-----------
Q587B4_TRYB2/907-972----------------------------------------DVQKEVAKLEKQLAGLQKQIEGVNKKISM-----------
Q3Y009_ENTFC/813-878----------------------------------------NIEEEIKRLEKELEKWTSEVKRVQGKLSN-----------
A5ZW53_9FIRM/833-894----------------------------------------EIE....RLKKEQERLAKEIARCQGMLSN-----------
SYV_DEIRA/848-913----------------------------------------DIADWVKKQQKRLAELDKQIKQAQGKLNN-----------
A3JNR7_9RHOB/949-1014----------------------------------------DVAEEKARLENTMKKLEKEIGGMKGRLNN-----------
Q1Q8T8_PSYCK/917-982----------------------------------------DPTAELARLGKSYDKLKGQAEGIARKLGN-----------
Q2RTE9_RHORT/814-879----------------------------------------DLDRERARLGKELLRLDGEVARIDKKLSN-----------
A1HP49_9FIRM/816-881----------------------------------------DVEKETARLSKELAGIEKEIARIAGKLAN-----------
A4J7L1_DESRM/814-879----------------------------------------DLDKEIARLNKELKTIQGDLARVQGKLNN-----------
SYV_NITMU/860-925----------------------------------------DIAAERERLTKELDRVQTEMEKAQTKLAN-----------
Q2RL27_MOOTA/814-879----------------------------------------DLEKEQARLEKELQKARAELEKVEKKLAR-----------
A5D455_PELTS/817-882----------------------------------------DVEKEIARLQKELAVTEKELARVRGKLAN-----------
SYV_CARHZ/810-872----------------------------------------DLEKEKERLNKELKKVLAEIERLNQKLNN-----------
A3IL87_9CHRO/842-907----------------------------------------DIGSLRAKLEKNLGKIEAEIKSLSGRLNN-----------
A2CDT4_PROM3/882-947----------------------------------------DLDALRGRLEKDLAKAEKEIAGLAGRLAN-----------
Q0YUH0_9CHLB/837-902----------------------------------------SFEKERARLQKEIANVSNYVGALTKKLSN-----------
SYV_PROMP/853-918----------------------------------------NLEALKDRLTKDLKKVNSDIETLNKRISN-----------

PF02403

SYSM_SCHPO/49-157ILNYKYIYQ....NAEAVQRNCINRNL..QAIAETVPKIRSLIDEKESLKNEFFPLLSLKKEITLQIERCSDPN......
SYS_SYNE7/1-112MLDLRLLRE....NPEATQARLDRR.....HSSYDIQPLLSLDQQVRQWEQERTQLQARSNEIGRSVGQKMREGADPQSE
SYSC_MOUSE/2-113VLDLDLFRVDKGGDPALIRETQEKRF....KDPGLVDQLVKADSEWRRCRFRADNLNKLKNLCSKTIGEKMKKK......
SYSC_SCHPO/1-112MLDINLFQVEKGGNPEIIRESQRKRG....ADVGVVDKVIEMYKEWVSLRFELDNTNKSINRVQKEIGLKMKAK.....E
SYS_CORGL/1-106MIDLKFLRD....NPDVVRASQITRG....EDPALVDELISADESRREAIKAADDLRAEQKAFGKKIGQASPED......
SYS_STAAW/1-108MLDIRLFRN....EPVTVKSKIELRG....DDPKVVDEILELDEQRRKLISATEEMKARRNKVSEEIALKKRNK.....E
SYS_BORBU/1-106MLDLKFIRD....NLDLVKRSIKARG.....LVLDIDKLIYLDDKRKKLITKIGELNAKRNENSSKMQENLDK......V
SYS_STRP8/1-108MLDLKRIRT....DFDTVAAKLKNRG....VSEDTLTHLKELDEKRRTLLVQSEELKAERNIASAAIAQAKRQK.....E
SYS_PYRHO/1-110MLDIKLIRE....NPELVKNDLIKRGE..LEKVKWVDEILKLDTEWRTKLKEINRLRHERNKIAVEIGKRRKKG.....E
SYS_XANCP/1-108MLDPALLRQ....HPADLAERLRSTR....GFDLNTAELESLESERKRIQVRTQELQSLRNSKSKAIGQAKAKG.....E
O65395_ARATH/76-181AIDFKWIRD....NKEAVEINIRNR.....NSNANLEAVLQLYENMVNLQKEVERLREERNNVAKKMKGKLE.P.....S
SYS_AQUAE/1-109MIDINLIRE....KPDYVKERLATRD...KELVSLVDKVLELDKRRREIIKRLEALRSERNKLSKEIGKLKREG.....K
SYS_METMA/1-108MLELKFVRN....NPDIVGRALISRN....MGTELIDSLLEYDAAWRECLIEGDDLKHKRNVVTREIAQLKKEN.....K
SYS_HELAN/1-112MLDINLFREEKGGNPEIVRESQRRRG....ASVEIVDEIIKLDKEWRQRQFELEQLRKDFNRINKEVAKLRISG.....G
SYS_THETN/1-107MLDIKFIRS....NPDVVRRAIELKG.....EKADLDRLLLLDEKRREMLVELEALKNKRNTESDNIARLKREG.....K
O82108_MAIZE/1-113MLDINLFRTDKGGNPDLIRESQRSRF....ASVELVDEVIALDKAWRERQFELDKIRQAQ.RTSKKIGKLKASKQ...EE
SYS_FUSNN/1-107MLELKFMRE....NVEMLKEMLKNRN.....SNVDMDAFVELDSKRREVLSEVENLKRERNNASAEIANLKKEK.....K
O82110_MAIZE/51-156AIDFKWIRD....NRDAVADNIRTR.....NSTANLDLVFELYDQYLTLQKEVERLRAERNAVANKMKGKLD.P.....S
SYS_TREPA/1-106MLDYRFIRE....NVDAVKENVKVRN.....VHADVDAIVHLYDQRVKLLAELQELQRARNENAQTMKSSLDAL......
SYS_CHLTR/1-107MLDIRLIRK....EPKECESRLQ.KK....DPAISLERLLDLDKTVRQLKADSEALLAKRKVLSGQIHKAKVAN.....E
SYS_ENCCU/1-115MIDINLIRDP..KTREKVVESEKKRF...R.DGLAVGKAYELDRKRIEMNFRLDQINTRINQLNREIKSGYRQGKNKEDG
SYSC_YEAST/1-112MLDINQFIEDKGGNPELIRQSQKARN....ASVEIVDEIISDYKDWVKTRFELDELNKKFNKLQKDIGLKFKNK.....E
SYS_SHIFL/1-107MLDPNLLRN....EPDAVAEKL.ARR....GFKLDVDKLGALEERRKVLQVKTENLQAERNSRSKSIGQAKARG.....E
SYS_AGRT5/1-109MHDIKWIRE....NPEAFDAALARR.....SVEPAAAGLIALDEKRRSVIQSLQDMQSRRNAASKEIGAAMAQKN...ME
SYS_THET2/1-105MVDLKRLRQ....EPEVFHRAIREK....GVA.LDLEALLALDREVQELKKRLQEVQTERNQVAKRVPKAP.......PE
SYS_CLOPE/1-110MLDLKKLRS....NTEEVKKALSNRGE..DFDVNVIDEVIALDEERRKILVDVEALKKQRNEVSAEIPKRKKAG.....E
SYS_BACSU/1-108MLDTKMLRA....NFQEIKAKLVHKG....EDLTDFDKFEALDDRRRELIGKVEELKGKRNEVSQQVAVLKREK.....K
SYS_RALSO/1-107MLDIQLLRK....DIDAVAARLN.DR....GYELDVAGFAALEAERKAIQTRTEELQARRNSLSKQIGMLKGKG.....E
SYS_COXBU/1-107MLDPKILRQ....NLEHVVEKLR.RR....GFEMDSDTFLQLENKRKEAQLAIQSFQTKRNQLSKTIGMAKSKG.....E
SYS_LISMO/1-108MLDVKLLRN....NFDEVKQKLQNRG....EDLGEFEKFGELDKRRRTLIVETEALKSQRNEVSQEIAKLKREK.....Q
SYS_HAEIN/1-108MIDPNLLRN....NLAEVAEKLKVKR....NFMLDTEKLTALEDQRKNLQVTTENLQAERNARSKAIGAAKARG.....E
SYS_BRUME/1-109MLDIKWIRE....NPETLDKALAKR.....GAAPLSSELIALDEKRREHVGKVQAAQERRNAASKEIGKAMAAKD...MG
SYS_MYCGE/1-104MLDPNKLRN....NYDFFKKKLLERN....VNEQLLNQFIQTDKLMRKNLQQLELANQKQSLLAKQVAKQKDNK......
SYS_NOSS1/1-112MLDIKQIRE....NPQLIQERLNSR.....NGTYDIQPILQLDKQQRELEATRSQIQARSNEIGKIVGQKIKSGINPQDP
SYS_HALMA/1-110MLSRQFVRE....HPETVRDAIERK....GVTGVDLDEILDIDEEWRELKAEGDGLRQERNEVSSKIGELKQDGK...DE
SYS_HELPY/1-109MIDRKLLLQ....DFDKVALSLKKRN...NAMDDELERLREVITHYKKRLIELEGLQAFQNKVSKEFGIKMAQK.....V
SYS_BUCAI/1-107MLNPYLLRN....ELHLTAKKL.LKK....GYKLNISKISSMEEKRKTLQIQTENLQFKHNALSNLFKENKNIK.....N
SYS_RICCN/1-107MLNIKWIRE....NKELFDEKLSQR.....FIEPMSSKIAMLDGEKRKITSLIQEFQHARKVKSKILGNMASKS....GE
SYS_PASMU/1-108MIDPNLLRN....NLEEVAEKLKVKR....NFVLDVALLSELEEQRKSLQVKTESLQAERNARSKNIGQAKARG.....E
SYS_RHIME/1-109MLDIKWIRE....NADALDEALAKR.....GAEPLSASLIALDERRRAVLQSLQDMQSRRNAASKEIGAAMAQKN...SE
SYS_BUCBP/1-107MLNPNLLRN....HIEFVFKNL.ARR....GFSLDVKQFTEMEKKRKILQTKVEELQSRHNTLSKHIGRIKLIH.....P
SYS_SYNY3/1-114MLDLKQIRE....NPTAIQNRLNQRG...GGASYDLEPILAIAAEQKAKESERTVLQSRSNEIGKLIGQKIGQGADPKGE
SYS_MYCPN/1-104MLDRNKLRN....NLDFFKKKLVERG....VSESQFEAYVQADKAMRKLLHQIELANQKQTLLAQQVAKKKGDP......
SYS_THEVO/1-108MIDVKLLRS....NRELFEKNCEYRG....VDKAIIDQFFKLDEEWRSVNRELNGQRAEKNRMTRAIAESLK.RG...KI
SYS_BUCAP/1-107MLNPYLLRN....QIDAISKKL.LKK....KFKLDISLISSLEKKRKKLQIKTDNLQYKHNTLSALFKKEKKIQ.....E
SYS1_CLOAB/1-110MLDLKRIRT....NPEEIKKALTNRGE..DFDISVIDELVSLDEERRKNLVEVENLKSKRNKDSGEIAKLKKSG.....Q
SYS2_CLOAB/1-108MLDLDLIRN....DTEKVKKALLKK.....IDNVDFTELLKLDDERRKLIHEVEVLKNKKNEASKQISNIKSQG....GK
SYS_MYCTU/1-106MIDLKLLRE....NPDAVRRSQLSRG....EDPALVDALLTADAARRAVISTADSLRAEQKAASKSVGGASPEE......
SYS_STRPN/1-108MLDIKRIRT....DFEAVAEKLATRG....VDAAVLNEMKEIDAKRRNILVKVETLKAERNTVSAEIAQAKRNK.....E
SYSC_CAEEL/2-114VLDIDMFRTEKGGNPEIIRKSQQDRF....KDPKLVDEVIELDEKWRKERFVADQLNRQKNAISKAIGEKMKKKE...PQ
SYS_RHILO/1-114MLDIKWIRD....NPKALVEALAKRSWSAGEAQSTVDDLIARDEARREHVTELQTKQERRNAASKEIGNAMRSGD...AA
SYS_ARATH/1-112MLDINLFREEKGNNPEIIRESQRRRF....ASVEIVDEIIKLDKEWRQRQFEVDSFRKEFNKLNKQVAQLKIKK.....E
SYS_MYCPU/1-107MLDLKKILN....NPDYYRNILLNKK....ANISLFDELVKIGKKRGELMQKSQSLKAKINELSKSFIKLKTN......E
SYS_XYLFT/1-108MLDPTLLRQ....QLAKLAECLLTVR....GFTLDVAALEALESERKRIQVHTQELQSLRNSKSKAIGQARSKG.....E
SYS_VIBPA/1-109MLDSKLLRT....ELDETAAKL.ARR....GFKLDVETIRKLEEQRKSIQVEVENLQSTRNSISKQIGQKMAAGD...KE
SYS_PSESM/1-107MLDSKLLRT....QLQDVADRL.ASR....GFTLDVARIESLEAQRKVVQTRTEQLQAERNARSKSIGQAKQRG.....E
SYS_CAUCR/1-109MHDIKAIRE....NPKAYDRHWSGK.....GRSGAADEAVRLDAELRAAQTTLQEAQAKRNESSKLIGMAKAKKD...EA
SYS_BURCE/1-107MLDIQLLRK....DLDGVAKRLA.DR....GYTLDVAAFSALEAERRAIQTRTEELQARRNTLSKQIGAMKAKG.....E
SYS2_LACPL/1-108MLDVKMIRQ....NPDFVKEQLGHRG....VAASDIDDLLAADEKRRELIAKSEQLKSTRNQVSGEISQKKRNK.....E
SYS_MYCLE/1-106MIDLQLLRE....DPDVVRRSQLSRG....EDPALVDALLTADTARRAAISAADSLRAEQKATSKSLGAASAED......
SYS1_LACPL/1-108MLNPKFVRN....NPELVKTKLQTRK....VDPAEVDEYLQLDQQNRDAITKVEGLKKQKNQLTEQIGQSDPQS.....E
SYS_LACLA/1-108MLDIKKIRA....DFDGVAAKLATRG....VEKEKLEKLHDLDIKRRELIVKSEALKAERNSVSDEISQVKRAK.....G
SYS_CLOTE/1-110MLDLKRIRS....NPEEIKKALAGRGE..DFDVSVIDKVLQLDEERRNILVEVESLKNKRKQESAKIPQFKKEG.....K
SYS_BRAJA/1-109MHDIKSIRD....NPQAFDAGLARR.....GLKPLSASLLAIDERRRAAILASEQAQARRNAASKEIGDAKKAKD...EA
SYSC_CANAL/1-112MLDINAFLVEKGGDPEIIKASQKKRG....DSVELVDEIIAEYKEWVKLRFDLDEHNKKLNSVQKEIGKRFKAK.....E
Q89ZR4_BACTN/1-112MLTIKQITE....NTEAVLRGLEKKHF..KNAKETIDEVIALNDKRRTTQNLLDKNLAEVNSLSRTIGQLMKEGK...KE
SYS_THEAC/1-108MIDVKLLRS....NRELFEKNCEYRG....VDKAPVEDFFRLDEEWRSINRELNGLRSQKNRETRKIAELIK.NN...GD
SYS_HALSA/1-109MLSRQFVRE....HPEKVRDALDAK....GVD.ADLDRILEVDEEWRELKARGDELRHDRNEVSSKIGELKQAGD...ED
SYS_NEIMA/1-109MLDIQLLRS....NTAAVAERLA.RR....GYDFDTARFDALEERRKSVQVKTEELQASRNSISKQIGALKGQGK...HE
SYS_WIGBR/1-107MIDHKLIIK....NIEEVCKKLILRN.....FYLDKKKILLQDQKRKILQIEVEKLQNKRNLQSKIISKIKINN.....K
SYS_BACHD/1-108MLDIKRLRK....DFAGIREKLQTRG....EDISGLEKFGSLDEKRRQVIVKVEELKSRRNQVSQEVAQLKREK.....K
SYS_THEEB/1-112MIDLKQLRE....NPQAFGDRLRRR.....GGDFDLDRILELDAQQRQLEQQRSQLQARSNEIGALVGKKIKSGIAPTDP
SYS_STRMU/1-108MLDIKRIRN....DFDQIAEKLARRG....VDEKTLHDLKELDFKRRQLLIKSEEAKAERNTASAAIAQAKRNQ.....E
SYS_CAMJE/1-104MLDLKNLQN....NFDEVAKKLKNKK....VDENILKKLAELFASLKKEKIALEEFQAFQNKFSKELATAE.........
SYS_STRA5/1-108MLDLKRIRT....DFDVVAKKLATRG....VDQETLTTLKELDIKRRELLIKAEEAKAQRNVASAAIAQAKRNK.....E
SYS_SHEON/1-107MLDPKFLRN....ELAVTAERL.ATR....GFILDVAHLTQLEEKRKSLQVATEELQASRNAISKSIGQAKARG.....E
SYS_UREPA/1-109MFDINLIRK....DIATTKEKMLNKK....VPSNLFDQIFDLDVLVRSLMQQEQNLNAKKNQLSKEIGILAKNK....DP
SYS_OCEIH/1-108MLDMKYLRQ....NFEEVQQRLQHRG....EDLADLDKFGELDTNRRQLIAETEKLKAQRNEATKKISELKREK.....K
SYS_DEIRA/1-105MLDLKFIRE....NPDAVREAIRVK....NVA.LDLDDLLQRDRDLVALKQRVEAMQTERNANAKLVPKAS.......PE
SYS_MYCPE/1-109MINKSIIRN....DFKTLETSLKNRN.....SKLDISSLKDLDKKQSELLLIIESCNKKRNEISKSIGIYIGKKD...NK
SYS_LEPIN/1-109MLDLRYITE....NTEDLKKVLELRG...FKEIGIIDELKSIIQRKREFQKEADILREERNKASKEVGKIKQSG.....G
Q9VQL1_DROME/2-115VLDLDLFRSDKGGNPDLVRENQKKRF....KDVALVETVIAKDTEWRQCRHRADNLNKVKNVCSKVIGEKMKKKE...PV
SYS_BIFLO/1-106MLDIQFIRE....HTDIVKESQRKRG....ESVELVDEVLSSDTARREALKAFEEARAQQKEIGKKVASAPAD.......
SYS_THEMA/1-110MIDIKLIRQ....NPDFVKEALRKRG....EDPAIIDEILKIDADWRATITKTNELRSRRNEISKNVARLKKEGK...NA
Q8GE42_HELMO/1-107MLDTKFVRA....NPQVVEEALKNRG.....ANLSLDDFLELDRRRRSILVEVEKLKAQRNAVSAEIARKKKAK.....E
SYS_CHLPN/1-107MLDIKIIRK....TPEECETRLR.KK....DPKISLEPVLSLDKEVRQLKTDSETLQAQRRLLSQDIHKAKTQG.....V
SYS_STRCO/1-106MIDLRLLRE....DPDRVRASQRARG....EDVALVDSLLSADERRRSSGVRFDELRAEQKGLGKLIGKAAGDE......
Q8IBS3_PLAF7/2-115VLDINLFRKEKGGNPDKIKESERKRY....HDENNVDKVIEYDDKWRKCIFELEELKKNINMINKEIGNKKKVDK...NA
SYS_CHLTE/1-111MLDITYIRQ....NPDDVKEMLRRRQQ..QGDAPKVDRLLERDAERKAMVQRTDDLKALRNRVSKEIANIKRTG....QG

PF02912

SYFA_STRPQ/21-93---------------------------------LTGNHTKELQDLRVAVLGKKGSLTELLKGLKDL.SN----------D
SYFA_LACLA/19-91---------------------------------LSVADEKTLNNLRTVMLGKKGELTEILKGMKDL.TN----------E
SYFA_BUCAI/16-88---------------------------------QNSKKISELDKIRIKYLGKKGVLTAFMKKLKDF.SY----------E
SYFA_PSESM/16-88---------------------------------QSAEDINALEQIRVHYLGKKGELTQVMKTLGNL.PA----------E
SYFA_BACHD/17-89---------------------------------EQAQEKKVVQEIRVKYLGKKGPVTEVLRGMGKL.SP----------E
SYFA_BACSU/17-89---------------------------------EAASSLKVVNDIRVQYLGKKGPITEVLRGMGKL.SA----------E
SYFA_NEIMA/16-88---------------------------------EAAQDFNALEQIKARYLGKTGELTGLLKTLGQM.SP----------E
SYFA_MYCTU/19-90---------------------------------ALADTLDVLARVKTEHLGDRSPLALARQALAVL.PK----------E
SYFA_THETH/10-82---------------------------------QNARDLEELKALKARYLGKKGLLTQEMKGLSAL.PL----------E
SYFA_THETN/17-89---------------------------------LKAKSLQEIESLRVKYLGKKGELTQILRGMGSL.SP----------E
SYFA_BIFLO/24-96---------------------------------QNASNLEELKAIKTTYAGADSAMTKASKAIGSL.PA----------D
SYFA_HELPY/9-81---------------------------------EKVTNSKELEEARLNALGKKGVFADKFNQLKHL.NG----------E
SYFA_CHLTR/19-91---------------------------------SLAHSSKDLFDVKVKYLGKKGIFRGFADQLRKY.PI----------E
SYFA_VIBPA/16-88---------------------------------EAAESLVALDEVRVQYLGKKGELTAQLQSLGKL.PP----------E
SYFA_NOSS1/21-93---------------------------------AAADTLERLEELRVSYLGKKGQLGALLRSMGQM.SA----------E
SYFA_RHIME/16-88---------------------------------DAAADEGAIEAVRVGALGKKGSISELLKTLGSM.SP----------E
SYFA_CLOPE/19-91---------------------------------KEAKDSTTIDTIRVKYLGKKGELTTILRGMGSL.SK----------E
SYFA_STRPN/22-94---------------------------------ITAGNEKEMQDLRVSVLGKKGSLTEILKGMKDV.SA----------E
SYFA_AGRT5/16-88---------------------------------AAAADEPAIEAVRVSALGKKGSVSELLKTLGSM.TP----------E
SYFA_AQUAE/16-88---------------------------------SSVSSLKELQEVRSKFLGSKGVIKELLKKIKEV.PS----------E
SYFA_LACPL/19-91---------------------------------KSADVLKKVNQVKVDLLGKKGPITEVLRGMRDL.SP----------E
SYFA_FUSNN/17-89---------------------------------KESKTLQRLEEIRVNYMGKKGIFTELSKKMKDL.SV----------E
SYFA_RICCN/16-88---------------------------------LLVQNLKALQEYKVEFLGKNGIVTGELKKLGSL.NE----------Q
SYFA_RALSO/17-89---------------------------------ASVEDNASLENEKARFLGKSGVLTDLLKGLGKL.DP----------Q
SYFA_RICPR/16-89---------------------------------VLVHNLKDLQEYKVEFLGRNGIVTSELKKLGSLING----------Q
SYFA_DEIRA/10-82---------------------------------QGAETLEALQAVKTKYVGKSGLVTKELGSLGKL.PP----------E
SYFA_MYCLE/19-90---------------------------------ALAVNLDALALIKAEHLGDRSPLALARQALASL.PK----------I
SYFA_LISMO/17-89---------------------------------NEASDLKTLNDLRVKYLGKKGPMTEIMKQMGKL.SA----------E
SYFA_BUCAP/16-88---------------------------------KNSHTIDKLDHIRIKYLGKKGIFSNLIKDLKNF.SL----------E
SYFA_STAAW/19-91---------------------------------NEANDERALQEVKVKYLGKKGSVSGLMKLMKDL.PN----------E
SYFA_CLOAB/17-89---------------------------------KSAVDKKNIEEIRVKYLGKKGELTQILRGMGAL.SS----------E
SYFA_COREF/18-89---------------------------------DGADNLEELAALRRDHLGDNAPIPQARRSLGTI.PK----------D
SYFA_SYNY3/21-93---------------------------------SGCDDLDGLDKLRVQYLGKKGELSLILKGMGKL.SA----------E
Q8RPZ8_AZOVI/16-88---------------------------------QHSEDVNALEQLRVHYLGKKGELTQLMQTLGKL.SA----------E
SYFA_THEMA/15-87---------------------------------SKISNVQELESFRIEFLGKKGKITGLMKNLKNL.PP----------E
SYFA_HAEIN/18-90---------------------------------IQDKSLTALDEIRVEYFGKKGHFTQLMQELRNV.SA----------E
SYFA_CHLPN/19-89---------------------------------DQVNSSQALADLKVRYLGKKGIFRSFSEKLKQC...----------T
SYFA_XYLFT/18-90---------------------------------AAAQNLDHLEFLRVALLGKNGSITLQLKQLGKL.PV----------E
SYFA_CLOTE/17-89---------------------------------NNVVDKETIESIRVKYLGKKGELTKILRGMGGL.SA----------E
SYFA_CAUCR/16-88---------------------------------AAASDLQALDAVRVAAVGKTGSISGLLKTLGAM.SP----------E
SYFA_XANAC/16-88---------------------------------AAAQTPDQLEALRVALLGKSGSITAQLKQLGTL.PA----------E
SYFA_LEPIN/19-91---------------------------------GSSISEEDLDKNKNDFIGKKGKLTAVLKNVASL.SI----------E
SYFA_OCEIH/17-89---------------------------------EEAKDMKSLQDLKVKYLGKKGSLTSVLRGMGKL.SK----------E
SYFA_RHILO/20-92---------------------------------ASAADEPAIEAVRIAAFGKKGTVSEMLKTLGAM.TA----------E
SYFA_PASMU/16-88---------------------------------ARAEDGKALDAIRVEYFGKKGPFTALMQGLRDV.SP----------E
SYFA_BRAJA/16-88---------------------------------AAAGDEAALEAVRVAALGKKGSISALLATLGKM.SP----------D
SYFA_THEEB/27-99---------------------------------ATASTLDALEQLRVAYLGKKGELSQILALMGKL.PA----------G
SYFA_ECOLI/16-88---------------------------------SQASDVAALDNVRVEYLGKKGHLTLQMTTLREL.PP----------E
SYFA_STRCO/18-89---------------------------------AAADSLDALQEAKVAHTGGASPLALANREIGAL.PP----------Q
SYFA_BRUME/16-88---------------------------------AAAVDEQGIEAVRVAALGKKGTVSEKLKTLGGM.SP----------E
SYFA_SHEON/16-88---------------------------------DQASDLKALDDIRVDYLGKKGKITDMMKMMGSL.SP----------E
SYFA_CAMJE/9-81---------------------------------QKCENLNDLEAIRISVLGKKGILTEGFTKLKEL.ED----------E
SYFA_PSEAE/16-88---------------------------------RHTEDVNALEQIRVHYLGKKGELTQVMKTLGDL.PA----------E

PF10458

SYV_OCEIH/818-883-----QGFVSKAPESVVEEEKRKEKDYLDKQAKVKTRLSELK
A0NQJ6_9RHOB/908-973-----PAFVAKAPEEVVDGEREKVAESKEKLEKVQTALSRLA
SYV_THET2/797-862-----PGFREKAPKEVVEAEEARLRENLEQAERIREALSQIG
SYV_BACCZ/815-880-----QGFVAKAPAAVIEGERAKEQDYLEKREAVRQRLADLE
A3DC83_CLOTH/816-881-----EGFVSKAPQKVVEEEKKKKEKYQEMYDKVVERLNGLK
SYV_LEPIC/816-881-----PGFLSKAAPEVVEKERDKLKTLIDKVEVLKKGIQNLA
B1YJU7_EXIS2/812-877-----PGFVGKAPAHVIEEEQAKAQDYKEKRAAVEVRISELA
A6NZ53_9FIRM/832-890-----PGFVNKAPANVVEAERERAV.......KLRELVTKLQ
A7NGB2_ROSCS/839-904-----PGFVDKAPAAVVQRERDGLAAVRETIARLQDRLAQQG
Q2KY84_BORA1/893-958-----PSFVERAPAAVVEQEKARVAQFNETLNKVRDQRSKLG
Q28LL8_JANSC/961-1026-----PKFAESAPAEVVEETKANLKAREEEEARLKQALARLA
A3M8B2_ACIBT/42-107-----EGFVSKAPAAVVEGEKAKLAEFAAQLDKVKANMEQIA
SYV_PROMT/868-933-----KNFVDKAPKDVVEECRANLTESEAQVRLVKERLMGLD
Q39X26_GEOMG/819-884-----PSFVERAPADVVAKEREKLTEFSQKKEVLLASLDKIR
Q587B4_TRYB2/907-972-----PGYETKVPADVREANKVKLESLVEQEAQLTEGLTKMK
Q3Y009_ENTFC/813-878-----ERFVSNAPEEVVEAERAKEKDYLEKQTAVKERIESLR
A5ZW53_9FIRM/833-894-----PNFVNKAPEAKVNAEKEKLQKYEEMMEKVKTQLTQMD
SYV_DEIRA/848-913-----EGFVARAPAEVIEEEKRRVADFGAQKERLEGVLAQLG
A3JNR7_9RHOB/949-1014-----PNFVASAPDEVVDETRANLASKEEEAAKLKIALGQLA
Q1Q8T8_PSYCK/917-982-----EGFVSKAPAEVVDAEKAKLAELEGQLTAMTAQMEQLK
Q2RTE9_RHORT/814-879-----PAFMAKAPDEVVEEQRERRAEYESQRDKVRDALTRIA
A1HP49_9FIRM/816-881-----PGFLAKAPADVVEKERAREREYQEKRAAILERLAYLA
A4J7L1_DESRM/814-879-----QGFLAKAPAEVIEKEKAKEQELSVKADALKDRLSMLS
SYV_NITMU/860-925-----SNFVDRAPAKVVEQEKERLAGFSTTLGKLKEQLQKLG
Q2RL27_MOOTA/814-879-----PDFRAKAPAAIVAKEEARAAELKSTITALTKRLSYLG
A5D455_PELTS/817-882-----PGFLAKAPAEVIEKEKAREEELSGKQAAVRERLGMLA
SYV_CARHZ/810-872-----PGFLAKAPAEVVNKEREKLTAFYREKEVLEQR...IG
A3IL87_9CHRO/842-907-----PGFVNKAPEEVVQGARDALAEAEKQAEILRERLKRLQ
A2CDT4_PROM3/882-947-----PNFAIKAPPNVVEECQSNLAEAEAQAELARQRLSDLG
Q0YUH0_9CHLB/837-902-----SGFADHAPKEVVEQEQQKLKDTVDNLEKLKSNLEVLS
SYV_PROMP/853-918-----KNFIDKAPKEIVDECFAKLKEGNLQSEIINKKLKLLK

PF02403

SYSM_SCHPO/49-157ERGKLVNEAKGLKKKTEEYNK.IISKVTNDLYQYCLAVPNTT
SYS_SYNE7/1-112EIAALREEGNQLKQQIADLEQ.QERQVRSELDTYLLTLPNLP
SYSC_MOUSE/2-113EAVGDDESVPENVLNFDDLTADALAALKVSQIKKVRLLIDEA
SYSC_SCHPO/1-112DASELLEEKNSLTERKKNLIE.QETAKNKEMLNVVSSIGNIV
SYS_CORGL/1-106.RPALLEGSNELKAKVKDAEA.AQEAAEAKVNELQMKLSNVV
SYS_STAAW/1-108NADDVIAEMRTLGDDIKEKDS.QLNEIDNKMTGILCRIPNLI
SYS_BORBU/1-106LKISLIETGKILKKQLIDLEE.ELERVSVDFDLENKKVPNIL
SYS_STRP8/1-108DATQQIADMQKVSADIKTIDN.QLVAIDQQVADIITVLPNTP
SYS_PYRHO/1-110PVDELLAKSREIVKRIGELEN.EVEELKKKIDYYLWRLPNIT
SYS_XANCP/1-108DVAALMAEVAGFGDELKASED.ALDVIRAQLEGIALGIPNLP
O65395_ARATH/76-181ERERLVEEGKNLKESLVTLEE.DLVKLKDELQHVAQSIPNMT
SYS_AQUAE/1-109DTTEIQNRVKELKEEIDRLEE.ELRKVEEELKNTLLWIPNLP
SYS_METMA/1-108DAASRINEMQGINSRIKELDD.KIRDYKSKINEIMLSIPNIP
SYS_HELAN/1-112DASSLIKNTEENKDSTAKKQA.EVQEARTALYSKLETVGNLV
SYS_THETN/1-107DASELIAKMKELSDKIKDMEQ.ELREIEEEMEKILWTIPNIP
O82108_MAIZE/1-113EAKKLMESTDEIKKRLAAKEV.EVQEAKSTLDAKVTTIGNIV
SYS_FUSNN/1-107NADHIIEKMGEVSTKIKDLDA.ELVEIDEKIKDIQLNIPNVY
O82110_MAIZE/51-156VRQALVEEGKNLKEGLIALEE.DLVQLTDKLQLEAQSIPNTT
SYS_TREPA/1-106ARSACVETGRALKDRIAHSER.LLVQISDQLLSATQALPNMT
SYS_CHLTR/1-107NADALIQEVNTIADQLVAFET.TLQEQEALLEDLMARLPNYP
SYS_ENCCU/1-115DLSEKVAEIKGLSDEAKGLRD.DVKAVEDELNKVMKGIGNII
SYSC_YEAST/1-112DASGLLAEKEKLTQQKKELTE.KEQQEDKDLKKKVFQVGNIV
SYS_SHIFL/1-107DIEPLRLEVNKLGEELDAAKA.ELDALQAEIRDIALTIPNLP
SYS_AGRT5/1-109LAEKLKAEVADIKENMPRAEE.EDRQVSAELNDALSRLPNMP
SYS_THET2/1-105EKEALIARGKALGEEAKRLEE.ALREKEARLEALLLQVPLPP
SYS_CLOPE/1-110DVTEVMAEMREIGDKIKADDA.KVAELNDKINYIMLRIPNIP
SYS_BACSU/1-108DADHIIKEMREVGEEIKKLDE.ELRTVEAELDTILLSIPNIP
SYS_RALSO/1-107DASAVMAEVAGIGDELKASAA.QLDVVQGRLQDLLLSIPNVP
SYS_COXBU/1-107NPELLMAEVSQLNDELKQEEA.NFETIQKAFSDFQLAIPNLP
SYS_LISMO/1-108DADAKIEEMRVVGDRIKTLDI.ELREIDEKLDMILMSIPNIP
SYS_HAEIN/1-108DIAPLLAEMDDMGNQLTEAKA.QLDAVLAEINQIALSIPNLP
SYS_BRUME/1-109TAEKLKAEVGELKDFLAHAEE.DERRLSKELSDALSTIPNIP
SYS_MYCGE/1-104K...LLAESKELKQKIENLNN.AYKDSQNISQDLLLNFPNIA
SYS_NOSS1/1-112EIQALRDEGNAIKAQLSELEP.REKELKAEIEQLILALPNLP
SYS_HALMA/1-110EAQEAIDRSQELKDELQDIEE.RADELESQLEEALLELPNIP
SYS_HELPY/1-109DTSDLKKELENNKIKLNELSK.SVGELEQQIDLKLSIIPNLV
SYS_BUCAI/1-107KNELLRHQVIQSSKDLNASKI.ELNSLKEKIHHFSMCIPNIP
SYS_RICCN/1-107EFEGLQRDVKHINEKLEALEQ.DLNN.NNELNELLNMFPNIP
SYS_PASMU/1-108DISALLNEVEHMGIELSTTKA.HLDEVLAEINQIVLAIPNLP
SYS_RHIME/1-109LADRLKAEVADLKNALPAAEE.ESRRIEAELSDALSRIPNTP
SYS_BUCBP/1-107NIQCMKERIITLKKKIDVMKK.ELKILLEQIHIFLMNIPNLP
SYS_SYNY3/1-114EIQTLREEGNSLKIQLADLEP.QEKDLKEQLQKLLLELPNLP
SYS_MYCPN/1-104K...LLKESKELKQKLEQLNI.AFKEAETLSQELLLNLPNIA
SYS_THEVO/1-108VSNEKD.RVELINEKIVSLEK.KIREIEEERDRVLWTIPNLI
SYS_BUCAP/1-107LDENLKRTLTKSSKNLSELKI.ELNLLQEKIHNFSLSIPNIP
SYS1_CLOAB/1-110NADELLAEMKKISDDIKGIDA.KVSEIDEKMQYIMLRIPNIP
SYS2_CLOAB/1-108VDESFFKDIKEISNKISELET.SLEPIKGKMDTFLEALPNIP
SYS_MYCTU/1-106.RPPLLRRAKELAEQVKAAEA.DEVEAEAAFTAAHLAISNVI
SYS_STRPN/1-108NTDDKIAAMQNLSAEVKALDA.ELAEIDAKLTEFTTTLPNIP
SYSC_CAEEL/2-114GTD.DSVADDIVARLAELKID.ELSQLTVVQLKKLRVLVDEK
SYS_RHILO/1-114LAEKLKAEVGDIKTFIQNGEA.RERELDKALTDALAVLPNVP
SYS_ARATH/1-112DASEIIQQTEKNKQDSTAKEA.EVREAYAALKAKLEQVGNLV
SYS_MYCPU/1-107EKNELKAKISKIKKEQEQKEK.KSELIDDRVFFLLANLPNII
SYS_XYLFT/1-108DVSALMAEVAAFSDDLKASEI.ALEEIRTELEKVALDIPNLP
SYS_VIBPA/1-109GAEEIKKQIGTLGSDLDAKKV.ELEQVMAQLDEFTLSVPNIP
SYS_PSESM/1-107DIAPLMADVERMGNELSEGKV.ELDAIQAELDALVLNIPNLP
SYS_CAUCR/1-109EAARLMAEVESLKGVMATAAE.AENLADGQLKDLLASLPNIP
SYS_BURCE/1-107DTSAVMAEVGGIGDEMKASAA.KLDEIQARLSELLLGMPNLA
SYS2_LACPL/1-108DASAEIAEMQKVSADVKTLDE.ERRTVDAQVQDMAAHLPNMP
SYS_MYCLE/1-106.RPALLERAKDLAEQVKAAET.TQAETAAAFAAAYMAISNVV
SYS1_LACPL/1-108AGQALIQQVKQLNGDIKSTEA.AQTEVNDRLHYLAIRFPNLP
SYS_LACLA/1-108DASAQIAAMQKVSAEIKAIDA.ELAEIEENLNEIIIMLPNLP
SYS_CLOTE/1-110NVDDIMAEMKELAGKIKKLDE.RLSEIDGSIEYIMLRIPNIP
SYS_BRAJA/1-109RAATLMAEVAELKTTMPQLEA.AAKAADEELTKELSAIPNIP
SYSC_CANAL/1-112DAKDLIAEKEKLSNEKKEIIE.KEAEADKNLRSKINQVGNIV
Q89ZR4_BACTN/1-112EAEAARARVAELKESNKALDA.TMTQAATDMQNVLYTIPNIP
SYS_THEAC/1-108ASAEKK.AVEDINARISDLEN.KLKKIEEERDRILWTIPNLV
SYS_HALSA/1-109AAQEAIERSQALKDELADVEA.RADDLEAELERLLLTLPMVP
SYS_NEIMA/1-109EAQVAMDQVAQIKTDLEQAAA.DLDAVQKELDAWLLSIPNLP
SYS_WIGBR/1-107NIDIYKNKSNKINILLNEKKQ.KLKKIKKEIDNYLSTIPNIL
SYS_BACHD/1-108DADHLIKEMRDVSDEIKGLDE.TLRQLDEELDQLLLAIPNVP
SYS_THEEB/1-112EIQALKAEANALKQKLSDLEP.QERQLKEELESLLLTIPNPP
SYS_STRMU/1-108DASEQIADMQKLSAEIKALDA.QLVEIDGQLKTFTTTLPNIP
SYS_CAMJE/1-104DKESLKAKLSENKSKINEQSA.KVNALENELEEIAHAIPNIP
SYS_STRA5/1-108NADEQIAAMQTLSADIKAIDA.ELADVDANLQSMVTVLPNTP
SYS_SHEON/1-107DVDAIMAQVGDLGAQLDAKKV.ELAAVLEEVNAIAMSMPNLP
SYS_UREPA/1-109KLQQTLDLVNNIKNELQDISL.TLSNKQDELNKLLLVIPNMP
SYS_OCEIH/1-108DAEPAIKEMREVGQEIATLDK.QLKDIEEKLEQIMLSIPNLP
SYS_DEIRA/1-105DRPGLIQKGKDLSEDLKALEP.QLREQEDALKQLLLRVPNIP
SYS_MYCPE/1-109KVDELKKEMESIKNTLETTNE.ELKTISAKVDDILLSIPNIP
SYS_LEPIN/1-109DITKISASVKLVGEKIKEIES.KLEQEENALLNINLGLPNIL
Q9VQL1_DROME/2-115GAMSEDLPADVTKDLTEIVAE.TLQPLTVNQIKQLRVLIDDA
SYS_BIFLO/1-106EKAKLIAETKELSQKVSEYKS.KADSAAEEYTTAMWKLSNIV
SYS_THEMA/1-110EAEALIEEGKRLGEEIKALEE.KEKELQKKLNDLLLMIPNIP
Q8GE42_HELMO/1-107DAEAMILEMRQVGDQIKDLDD.QLAQIEEDMEKLLYYIPNIP
SYS_CHLPN/1-107DATNLIQEVETLAADLEKIEQ.HLDQKNAQLHELLSHLPNYP
SYS_STRCO/1-106.KAELLKRAEQLKTDVKAADA.ERDAADAETQELLQRLGNLV
Q8IBS3_PLAF7/2-115DVEDLKKKSLNIKEEIPKYQL.KEKELLKERNKYISKIGNLL
SYS_CHLTE/1-111SADELIGQMKQVSDEIADLDL.ALSALEAEIEELLLTLPNKL

PF02912

SYFA_STRPQ/21-93LRPVVGKQVNEVRDLLTKAFEEQAKIVEAAKIQAQLD-----
SYFA_LACLA/19-91ERPVIGALANAFRDEFGAKFEAKKVEIEQAVMNAALE-----
SYFA_BUCAI/16-88DKKKHSIIINKKKQEIISKINIKKQKLSVYILEQRIK-----
SYFA_PSESM/16-88ERPHVGALINVAKERVTEVLNARKASFEQAELTAKLA-----
SYFA_BACHD/17-89ERPVIGQLANDVREAIGKAIESKMEALEQAEIHRKLQ-----
SYFA_BACSU/17-89ERPKMGALANEVRERIANAIADKNEKLEEEEMKQKLA-----
SYFA_NEIMA/16-88ERKTIGAHINECKNRFQTAFNAKRDALNEAKLQARLA-----
SYFA_MYCTU/19-90QRAEAGKRVNAARNAAQRSYDERLATLR.AERDAAVL-----
SYFA_THETH/10-82ERRKRGQELNAIKAALEAALEAREKALEEAALKEALE-----
SYFA_THETN/17-89ERPVIGQLANDVREKIENMILERREKIAKEEKERKIK-----
SYFA_BIFLO/24-96QKKEAGKLMGKLRADFGRAYGPKEVELKEAAEKAALA-----
SYFA_HELPY/9-81EKNAFAKEIHHYKQAFEKAFEWKKKAIIELELEERLK-----
SYFA_CHLTR/19-91QKATVGASINACKQYVEEVLLERGKAVLAKEEAEEFL-----
SYFA_VIBPA/16-88ERREAGQEINKAKGVVQQAIAARKDALQSAELEAKLA-----
SYFA_NOSS1/21-93ERPKIGAIANTVKEALQASLDKQRESLESAQIQAQLD-----
SYFA_RHIME/16-88ERQTRGARINALKNTVTEAISARKTALKDAAIAERLA-----
SYFA_CLOPE/19-91ERPIVGKLANEVREVLEAELEAITKAVKEAEKQEKLK-----
SYFA_STRPN/22-94MRPIIGKHVNEARDVLTAAFEETAKLLEEKKVAAQLA-----
SYFA_AGRT5/16-88ERQTRGAAINQLKTEITDLIGERKNALKDAAIAARLK-----
SYFA_AQUAE/16-88ERKEYGKRVNLLKEEAEKLIKEKEEELKERELEEKLK-----
SYFA_LACPL/19-91ERPKVGAYANEVRDRIQAAIDERREELEQAAVNEQLA-----
SYFA_FUSNN/17-89ERPKIGQIINEVKEKINSLLDERNKALKEKELNERLE-----
SYFA_RICCN/16-88ERKEFGLKINKLKDKIQNIIKAKAEILEEQELNFKLA-----
SYFA_RALSO/17-89TRKSEGARINLAKSRVEAALNDRRQALADALMNARLA-----
SYFA_RICPR/16-89KRKEFGLKINTLKDKIHDIIKAKAQNLEAEELHLKLA-----
SYFA_DEIRA/10-82ERKACGAEINVVRAAIQAALDEKESALKRAALDAKLA-----
SYFA_MYCLE/19-90DRAAVGKQVNTARSEVQRDYDERLATLQ.AERDAAVL-----
SYFA_LISMO/17-89ERPKMGSLANEVRTALTEAISSKQQILETEAINEKLK-----
SYFA_BUCAP/16-88ERKKYFIIFNEIKKKTINQINKKKIELNKIILDKQIE-----
SYFA_STAAW/19-91EKPAFGQKVNELRQTIQNELDERQQMLVKEKLNKQLA-----
SYFA_CLOAB/17-89ERPIIGKLANEVRSKLESLIVEASEKIKDAEKKTRLE-----
SYFA_COREF/18-89QRKDAGRFVNMALGRVEKHFAQVKAQLE.EKRNREVL-----
SYFA_SYNY3/21-93ERPKFGAIANEVKEALQHDLESRKANLQNAAIEAQLA-----
Q8RPZ8_AZOVI/16-88ERPKAGALINTAKNSVQEALNTRKADLESAALTAKLA-----
SYFA_THEMA/15-87ERPAYGKRVNELREKIEKLFEEKRQQIQRILEQEKME-----
SYFA_HAEIN/18-90ERPAMGAKINEAKQAALEFLNAKKTEWEQAELNSKLE-----
SYFA_CHLPN/19-89DKAKLGSLINDFKTYVEDLLQEKSLVLLASEQAEAFS-----
SYFA_XYLFT/18-90QRKAIGEKLNRVRDLISDALMDRKAALESAALSKRLI-----
SYFA_CLOTE/17-89ERPIVGKLANEIRKNIEEIIETTLKEIKEKEKNIKLS-----
SYFA_CAUCR/16-88ERKTQGAAINALRDKVQDAITQKKAALEAAELDARLA-----
SYFA_XANAC/16-88QRKAAGEAINLSRDALTAALSERKHTLETAALDARLA-----
SYFA_LEPIN/19-91EKKTVGQKANELSKKLETFISETKTSLKKKLFEKQAA-----
SYFA_OCEIH/17-89ERPVIGEIANQVREQITAALDQKTEKMEEEALNEKLE-----
SYFA_RHILO/20-92ERQLKGPVINGLKNRVTEALTARKAELKDVAIAARLA-----
SYFA_PASMU/16-88ARPAVGQKINDAKQLAQNALNEKKVQLETAELNAQLA-----
SYFA_BRAJA/16-88DRKTQGAAINQAKDKVTEALAARRDVLKSAALDARLA-----
SYFA_THEEB/27-99DRPTIGTLANTLKEKLLQELEARRATLQAEKIAAQLA-----
SYFA_ECOLI/16-88ERPAAGAVINEAKEQVQQALNARKAELESAALNARLA-----
SYFA_STRCO/18-89AKAEAGKRVGMARGAVNKALAARQEELE.AERDARVL-----
SYFA_BRUME/16-88ERQMQGPAINGLKNRVTEALSERRTELRKAAVAARLE-----
SYFA_SHEON/16-88EKPAFGQAVNDAKQAIQQKLTERIDGLKSAELEAKLI-----
SYFA_CAMJE/9-81AKKEFAAKLNAQKEIFNEAYLAKFKDLENLALEERMK-----
SYFA_PSEAE/16-88ERPKVGALINVAKEKVQDVLNARKTELEGAALAARLA-----

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window