Sequence alignment for CL0300

PF10399

UCRI_RHOCB/1-41MSHAEDNAGTRRDFLYHATAATGVVVTGAAVWPLINQMNAS
UCRI_ALLVD/10-50PMSAQGVNKMRRRVLVAATSVVGAVGAGYALVPFVASMNPS
Q5NNY0_ZYMMO/20-60GQPETSDSLDRRDFLNVAAAGLAGIGVCGAAIPFIAQMNPS
Q0G7X4_9RHIZ/9-49VSVNESADPNRRDFLYIATGAFGAVGAAAVAWPFIDQMNPD
UCRI_BRAJA/2-42TTASSADHPTRRDFLFVATGAAAAVGGAAALWPFISQMNPD
Q9AAX0_CAUCR/5-45TEPEHGGDPSRRDFIHIAAIAAAAGGAATLAWPFIDQMNPS
Q1GCS0_SILST/1-41MSHAEDHEGTRRDFLYYATAGAGAVTAGAAVWPLVNQMNPS
Q07SC5_RHOP5/1-41MDTTLPAEPTRRDFLFVATGAVAAVGAVAATWPLIAQLNPD
Q2RXH6_RHORT/7-47TASTPGGESSRRDFLIYGTTAVGAVGVALAVWPFIDFMNPA
Q2J0V0_RHOP2/1-41MTTETSAEPTRRDFLYIATGAVAAVGAAAAVWPFIAQMNPD
A0NYN9_9RHOB/1-41MAHTDQAEPTRRDFLYIATGAMGVVGAGALAWPFIDQMNPD
A8LTC3_DINSH/1-40MMEA.SENTARRDFLYYATVGAGVVATGAALWPLVNQMNPS
Q7CXJ6_AGRT5/6-46TNHDASGEPTRRDFLYLVTGMAGAVGAAAVAWPFIDQMRPD
UCRI_RICBR/13-53VEFEDRSKTSRRDFMVLTASSVAAVGAACTLWPLINSLNPS
A0L4J1_MAGSM/1-41MSTVNEHDENRRDFLIMATGAVGAVGVAGAAWPFIDSWSPS
Q15PI5_PSEA6/13-53VTENQPQDNNRRRFLTVATSVVGGVGVAGAAIPFIGSWNPS
Q6NB14_RHOPA/1-41MTAITSEQPSRRDVLYLATGALAAVGTAAMVWPFVSQLNPD
Q1GTG3_SPHAL/7-47LNAGIEDGVRRRDFINIAAVSFAGVGAVAAVLPLVNQMNPS
A5V644_SPHWW/10-50PGEGAGDGVRRRDFINLAAVSFAGVGAATVLLPLINQMNPS
UCRI_RICTY/4-44TEDNRNKQTTRRDFIVLTASSVAAVGAACAFWPIIDSLNPS
B4SQL1_STRM5/4-44DGVHDPVNTGRRRFLSATTAVVGAVGVGFTAVPFIKSWNPS
Q07JI1_RHOP5/2-42TTATLPEAPTRRDVLFLATGAVAAIGTAAVIWPMVSQMNPN
Q2VZT3_MAGSA/8-48AQPSSVDGQTRRDFLLYATAGVGAIGTGLALWPFVHSMNPA
Q5GSN0_WOLTR/23-63VKGFTKKNKSRRDFITLTTCAMASIGTVSGLWPLIKSMNPS
Q0ARQ8_MARMM/7-47APGADGQEPSRRDFIYIAAGGVAAVGGGLVAWPFIDQMNPA
A5WDK7_PSYWF/10-50MSHAEGVNIKRRRVLIASTAAIGAVGVASVATPFVRSWYPS
Q9KIW4_THIFE/6-46DSEHGHKNITRRRFLAAATSAVGAVVAGMVAVPLVDSLEPT
Q3SPC1_NITWN/1-41MTTSSSAGQSRRDFLFVATGAVAAVGAAAAAWPLVAQLNPD
Q217F6_RHOPB/2-42TSATIPDQPTRRDVLFVATGAVAALGAAAVAWPLVAQLNPN
Q4FPG5_PELUB/1-38MSE...KKPERREFLFTASYAVGAVGVGAVVWPLVDQMNPD
Q8FZE2_BRUSU/1-41MSAHDTAEPTRRDFLYIATGMAGVVGVGGLAWPFIDQMRPD
Q212B8_RHOPB/3-43TATLLPEQPTRRDVLYIATGAVAAVGAVAAVWPLVVQLNPD
Q1QLI7_NITHX/10-50IKKPSGRSPTRRDFLYIATAAVGTVGVAAAIVPMISQLEPD
A4SV32_POLSQ/1-40MSDKPCMDKDRRNWL.IATSAVGGVGAAAALYPFVDSFEPS
Q0FDH6_9RHOB/1-38MSE...DKGNRRDFLYVATAGTGAVIGGAAVWPMINQMNPS
A7HVC3_PARL1/1-41MADIHAVEPTRRDFLYVATGSLAAVGAAFTVWPLIDQMNPD
Q0C5B3_HYPNA/4-44ETHAEAVDEDRRNFIHIATGSVALGGAAMFAWTLVDQWNPA
Q28VM0_JANSC/1-41MSDTHDPSGDRRDFLYYATAGTGVVVAGAAAWPLVNSMNPS
Q92PE6_RHIME/6-46TSSETMGEPTRRDFLYLATGMAGVVGAGAAAWPFIDQMRPD
UCRI_RHOVI/1-41MASSDTAEATRRDFLYVATAAVGAAGVAAVAWPFITQMNPD
A7IJK0_XANP2/2-42AHTETSDTTTRRDFLYIATGAVGAVGAAAMVWPFISQLQPD
Q6SEW0_9BACT/18-58SSNIENRDESRRDFLYYATGGVGSVTVGAALWPLINQMNPS
Q2RV52_RHORT/12-52PSLDDDGFKTRRDFLIYGTLAVSAAGAALAAWPFIDFLNPA
Q98HU4_RHILO/1-41MSATDIHDPNRRDFLYVATGMAAVVGAGAVAWPFIDQMRPD
Q73FX2_WOLPM/22-62PVKDLTKNKSRRDFITLTTCAMAGIGAASGLWPLVKSMNPS
Q11GB7_MESSB/4-44TDSTHIPEHSRRDFLYVATGMAGAVGAAAVAWPFIDQMRPD
UCRI_PARDE/5-45DEHAGDHGATRRDFLYYATAGAGTVAAGAAAWTLVNQMNPS
Q3L5D2_RHIML/1-41MAKDETVEPSKRDFLYLVTAMAGVVGVGAASWPFIDQMRPD
A8H8G2_SHEPA/17-57WMSNAPVDTGRRRFLTAATAVVGGAGAAAVAVPFIKSWNPS

PF10518

Q2J7I3_FRASC/3-28-------ELTRRNLFRHGTAAGAVVVLSAEAFN--------
Q9F2J1_STRCO/52-77-------ALSRRSMMRAAAVVTVAAAGAGAVGV--------
Q7ND06_GLOVI/3-28-------EYSRRELLKFLGVTGGAALLGSMIPG--------
Q82BU3_STRAW/10-35-------ALHRRSFLKYSGALGAAAALSSSLAA--------
A7N0D1_VIBHB/8-33-------NITRRDALKGGSALGALALAGNALSL--------
A0LCA2_MAGSM/17-42-------RLSRRQAMQGLMAGGAMVALHRLPGV--------
Q939S4_DESHA/11-36-------GMNRRSFLKVGAAATTMGVIGAIKAP--------
A6VXP0_MARMS/6-31-------DSNRRRMLGFMAGAPLLPLAGGVFSS--------
A6CDE2_9PLAN/4-29-------SSSRRLFLKSAIAAPAAGTVFSRFLS--------
Q2KX41_BORA1/26-51-------NLSRRAVMRGSLVALAGMSTLGLAAC--------
Q2IPE7_ANADE/2-27-------PLTRRDFLKASAAASALAGLGLPVDA--------
A3JVA6_9RHOB/4-29-------KTSRRAFLRGAAAVGAGAATVGAAAA--------
A6V4F1_PSEA7/33-58-------GLGRRQVLAGGAALGALAFLGVSLPA--------
A8L8A7_FRASN/2-27-------AVNRRQVVVGTGAAGLGFTLSGAVSS--------
A9VX30_METEP/17-42-------RFSRRDLMRGSLATALAAGLAPQTVA--------
Q82BD9_STRAW/2-27-------ELNRRTLIAGTAAAGIAATTLGGTAQ--------
Q82CS1_STRAW/11-36-------RFSRRNMIRGGAVTLGAVAGGAFVPG--------
Q4ZMA5_PSEU2/23-48-------GLTRRGFISAGALCGAAMFLGGNLLS--------
A1THZ7_MYCVP/50-75-------AVSRRSLLHAGGVAVLAVGAGSALAA--------
Q2RLA8_MOOTA/5-30-------KITRRTFLKGSLAAGALATFGGKLIP--------
A3TJD4_9MICO/52-77-------GVSRRAALRVGGAGAAVVGLTAWSMP--------
A5UXR1_ROSS1/28-53-------TLSRRRFLTLSAMTAASAAIAACGGG--------
A4FR09_SACEN/52-77-------VVDRRGLFRAGAVVAVSTAAASSALA--------
Q6LKR0_PHOPR/2-27-------DKKRRQFIKSGLAVGGVSAFAAGYSS--------
Q1R007_CHRSD/26-51-------HVSRRDIMRGGLSLAALGMLGGIGGL--------
A1WXL7_HALHL/20-45-------ACSRRDFLKLSGMSTGAIAAGALGAG--------
Q7NN53_GLOVI/4-29-------VMQRRDFLEFLAAAGAATLLPAPAEA--------
Q2J0K9_RHOP2/7-32-------TSNRRSILKGALAVAAAPAVIGQALA--------
Q0HV33_SHESR/26-51-------HLSRRNFVKSGLGLGAMTAFAGVGLV--------
Q0KEQ1_CUPNH/33-58-------NPARRRVLRGGLGLSLASAFGSGLLA--------
A9AD00_BURM1/6-31-------NASRRHALKILAGAPMLPLSGLALPA--------
A5V967_SPHWW/31-56-------RYSRRQTLFGGISAIAAASFGGLLLT--------
Q5V5G3_HALMA/11-36-------QASRRTFLKATGVATAAAATGAGVGT--------
Q162F5_ROSDO/5-30-------QPTRRSFLQGGAAVFGATSLMGTTAL--------
Q08NU5_STIAD/4-29-------KNSKRWGALAALGLWACTGDTGPTGP--------
A4FR05_SACEN/31-56-------VLSRRGALKAGGVLALSVGAASALGS--------
A1K7B1_AZOSB/7-32-------KASRRNMLKGSASLAAVPFVSTFALV--------
Q16C45_ROSDO/42-67-------RYGRRDVLRGALGVTATTALFGTSAL--------
Q161Y3_ROSDO/14-39-------KLNRRQMLKGTAAVGAMAMMPKGAAM--------
Q3MD12_ANAVT/2-27-------AFSRRKFFTIAGATAAGTLAASPLEG--------
Q4JY48_CORJK/16-41-------QFTRRQVLQTSAAGAAAVGIGAVAAN--------
Q4JY10_CORJK/51-76-------TFSRRTALRAGGAAMVTVGGASFLAA--------
A4Z0J9_BRASO/3-28-------AITRRNMLAGTAAAGALALTGQPARS--------
B8E430_SHEB2/7-32-------DMGRRQLLKALALGSAAGAVVTVSSQ--------
A6GL01_9BURK/13-38-------SVRRRNLLKTFLYGASASALPWMAGC--------
A3INH2_9CHRO/2-27-------VIKRRDLLKFLGVTTGTALLSQATKG--------
A4XC22_SALTO/52-77-------EVSRRGVVRAGTVGALVLGFGGAGAL--------
B8FSM6_DESHD/7-32-------NVSRRNFLRGAAASAVGIAAMGVLGG--------
A6F2I0_9ALTE/34-59-------RMQRRTVMKGSVGAALASVMGLGLAG--------
A4B9W1_9GAMM/18-43-------AMSRRQIIKTGGTVSAAGFLAGTSAL--------
Q098B3_STIAD/2-27-------SFNRRHFLRFSVVTGTALTLGPGFWR--------
A4XEM0_NOVAD/2-27-------TVDRRSFIAASLVSAAAAKTALAQTP--------
Q87JR9_VIBPA/26-51-------SLSRRSILKGGLGISAMTAFGAFGLA--------
Q7WJI1_BORBR/6-31-------MSKRRLVLKMLGGAPMLPLGAVGAAT--------
E6XRD2_SHEP2/3-28-------NIHRRHFLKAAGAVTAGLITANITAS--------
Q8RPG4_DESHA/35-60-------RISRRGFLKTGAVAAAMGVMGAIVGP--------
A5WH70_PSYWF/43-68-------SATRRSVIAFLAGVPMLPLAGCNTSA--------
Q3J992_NITOC/50-75-------RLKRRTLLKGAGLVAASPVLAWASSL--------
B9LMJ2_HALLT/4-29-------NYTRRTVVSSLAALAAASQTAGSVAG--------
Q1Z9K7_PHOPR/31-56-------SMSRRRFMGAASVMTAGAFMAGMPVS--------
Q2S867_HAHCH/33-58-------RIARRTVIKGGVSAALAGMLGMSLVG--------
A3Q2R2_MYCSJ/2-27-------SISRRQVLKAAAPAVLGMSAGLQAVA--------
Q6FER2_ACIAD/9-34-------HPTRRDLLKWFTGIPFLPLGAMATAA--------
Q18K43_HALWD/6-31-------EVNRRRFLRATGAVAATVGVAGCSQG--------

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window