Sequence alignment for CL0350

PF08683

CAMP1_HUMAN/1462-1591TGPKL.FKEPSSKSNKPIIHNAISHCCLAGKVNEPHK-NSILE..ELEKCD...ANHYIILFR..DAGCQFRALYCY.YP
Q7YYZ7_CRYPV/210-337EDMEV.VIK...RNNRNVISLALNWISLSGEHNKKIR-KFVMD..SMNSIELKDLNHFIILFQ.YDDHKGIRGLYSFFQK
Q4RGQ5_TETNG/1262-1393NGPKL.FKEPSSKSNKPIIINAIAHCCLAGKVNESQK-NAVLEASELERCE...SNHLIILFR..DGGCQYRAIYSY.SP
A7RQ86_NEMVE/2757-2885SGPQC.YVKPSGKSNRKLIVNAISYVCLSGTVNKDAK-ERCLQ..AISESN...GYHFMVLFK..D.GLKFRGLYSF.NP
Q966J8_CAEEL/987-1116PTHKL.YAKTVTKSNRGLINNALQFSVFPGAVNNATR-QATIT..QMASSS...SKHFLILFR..DQKCQYRGLYTW.DE
Q4RHF5_TETNG/1329-1444AGPKL.YKEPSFKSNKFIIHNAITRCCLAGKVNEPQK-NKIVE..EMEKSA...ANHFLILFR..DASCQFRAVYTM.NP
Q8T0T0_DROME/1254-1383CGPKL.YKQPAAKSNRGIILNAVEYCVFPGVVNREAK-QKVLE..KIARSE...AKHFLVLFR..DAGCQFRALYSY.QP
Q22NV2_TETTS/1646-1770TKPRI.PF..SKPSNKQLISQAITKVCLAGPTNSKER-EIALK..KIKDSQ...QEHFIVLFKGINGRQDFKALYSM.DS
Q5BSP1_SCHJA/148-278NQPRL.FVKPKAKSNRTVVVNAISHCCLAGTVNEPTK-QLALK..ELAATE...GTHFMILFR..DSRCQYRAVYSF.DL
CAMP3_HUMAN/1108-1237TGPRL.YKEPSAKSNKFIIHNALSHCCLAGKVNEPQK-NRILE..EIEKSK...ANHFLILFR..DSSCQFRALYTL.SG
A2F4R0_TRIVA/686-800KQRAA......NIKNYTIFERALEDLFLPGDNHLGHR-KFILN..EASTIP...SDRVIILIS..SDKKRYKGAYFRGLD
A0DFP2_PARTE/643-768IDRSI.SVEKNKKNNKTILKNAITYVCLAGEPNKRER-EAILQ..KLDGVE...AEHFIILFK.TYGRSDFRALYGY..A
A8BRM3_GIAIC/714-841ESHFIEYLPPAKFDNSSFVQKLILHNLLPGTANYERR-MLAMD..NVSR.E...RGHLLLVFR.DTERKSYHSCVKV.DE
A2FZI3_TRIVA/667-788SKKEI.TEHTSTVPNISTIANALKYHALPGPAHVDEY-NNLMK.ILQDRFS...NERILILMA..SRTMKYKGIYIL...

PF09939

Q89BX0_BRAJA/6-72-------------------------KIKEHMDVISSD-R---K--MVGKV-----DHL-------DGTDKIKLTKQSSP.
Q9RUN6_DEIRA/5-67-------------------------QIKEHMPIICAD-G---K--NHGEV-----DHL-------DG.EYIKIAKDA...
Q09E21_STIAD/120-184-------------------------QVQPKMPVICSN-N---V--PFARV-----DHM-------DGSDTIKLARDE...
Q1MFC3_RHIL3/6-71-------------------------QIREHMEVRAAD-G---T--HVGTV-----DHL-------DGTTRIKLTKMDSE.
B7KQF0_METC4/6-72-------------------------QIREHATVVGSD-G---G--HVGTV-----DHV-------.GKGEIKLTKSDAG.
Q1QG65_NITHX/6-71-------------------------QVREHMVVVASD-G---E--TIGKV-----DHI-------EGANKIKLTKGDSP.
Q6N686_RHOPA/6-75-------------------------GIKEHMEVIGAD-G---T--HVGTV-----DRV-------DG.DRIKLTKKDSG.
Q98NL9_RHILO/6-75-------------------------KIREHMEVVGAD-G---V--HLGTV-----DKV-------DG.QRIKLTKADSG.
Q1NBM9_9SPHN/203-269-------------------------QVKEHMEVVGSD-G---E--HVGTV-----DKC-------RG.DRIILTKNDED.
Q1NFL4_9SPHN/7-83-------------------------QIKEHAEVIGAD-G---V--HVGTV-----DHV-------EG.DRIKLTKKDSGA
B0T0F4_CAUSK/6-72-------------------------QIREHLEVVGSD-G---G--HVGRV-----DHV-------VG.GDIELSKLDLG.
Q9A832_CAUCR/52-118-------------------------QIKERHEVVGSD-G---G--HVGRV-----DHI-------AG.GEIQLAQFDLG.
A5VBW0_SPHWW/201-266-------------------------HVQEHQEVVGAD-G---A--HIGTV-----DHV-------RG.DRILLTKGDRD.
Q6FG17_ACIAD/8-75-------------------------DIQHHAEVIGSD-R---Q--HVGTV-----DHL-------DGQDKIKLAKNDQA.
A3M6W3_ACIBT/8-72-------------------------DIKKHADVIASC-G---T--KVGTV-----DHL-------EGENQLKLTKDE...
Q2GBQ3_NOVAD/12-85-------------------------RIREHMEVIGAD-G---V--HVGTV-----DAV-------EG.HRIKLTKRDSDA
Q1GXW5_METFK/6-70-------------------------GILPGMPVICSQ-G---G--QFATV-----DHM-------EGSNQIKLQKDE...

PF05239

Q8U5M3_AGRT5/23-102-------------------PSLIASDKVEGTRVYGAD.G...K--HIGSI.---.QRIILEKR-.GGRVAYAVLSFGGFL
Q930B5_RHIME/36-117-------------------PTDVLSYNLINLNVTNTA.N...E--SIGEI.---.KDLVLS..-.EGQLAGYILSVGGVL
RIMM_CLOPE/90-162-------------------EDEYFIVDLVGCTVVDTE.G...F--EYGKI.---.KDV.IQTP-.SNDVYWVQGK.....
RIMM_STRP1/96-169-------------------EGEFYYHQIIGMAVYEKD.....V--LIGHV.---.KEI.LQPG-.ANDVWIVKRQGK...
Q98MZ5_RHILO/112-191-------------------TEAIAASRVIGTSVYNTE.G...R--SIGSI.---.EDIMLDKT-.SNGIMFAVIGFGGFL
Q92W42_RHIME/10-89-------------------HDLIASDRVVGTAVYDMN.G...E--NVGSI.---.ERIILEKR-.GGRVAYAVMSFGGIL
O28740_ARCFU/3-81-------------------M.IGEITTFFGMRVFTDE.G...R--YVGRV.---.EDVILDQN-.TKSIRGLAISDYNK.
Q8U4G3_PYRFU/1-71-------------------M.VMRLSKIYGKQIYTTK.G...K--YVGYV.---.DEVIIDID-.EGRGEVVLLALPG..
P73463_SYNY3/4-81-------------------DNIRLRNEFINTEVITRSSG...K--KLGVV.---.KEVLVDVD-.QREIVALGLRDN...
Q9AK83_STRCO/6-79-------------------RTDIDPRNLIGRKAFDRD.G...S--RIGTV.---.DEVYLDDA-.TGVPEWAAIRTGLFS
RIMM_AGRT5/96-170-------------------DDEFYYADLEGLEAVDAE.G...K--SYGAV.---.SAV.YDFG-.AGDLLELKGAGR...
RIMM_CORGL/96-169-------------------EDGFYDHELEGLRVIHEG.....E--DIGEV.---.TGV.MHGP-.AGEILEVRLTSG...
O27055_METTH/11-97-------------------GKMVELSSLYGLEIYTSR.G...K--YVGRV.---.QDVVLNIK-.KGRVSTLKVRPMRHD
RIMM_BORBU/94-166-------------------EGEYYLGKLIGYAIVNNN.....K--KLGEV.---.VAF.FEYL-.NSVFLEVRVGI....
Q9JPA8_RUBGE/139-212-------------------DVAKQDSDPRGKPVYGAD.G...A--QAGTV.---.TDLWVDTP-.ENLFRYFEVELAEGG
RIMM_BACHD/97-172-------------------EGEFFYHEIIGCSVVTIA.G...E--ELGKV.---.KEI.LSPG-.ANDVWVVQCRRGG..
RIMM_LACLA/97-170-------------------DGEFYYHEIIGSDVYEND.....I--LIGQI.---.SEI.LQPG-.ANDVWVVKRKGK...
O26906_METTH/8-84-------------------GVQMKVTEFLGLKVLDKN.A...M--EIGKV.---.SDLEVDPE-.EGLIKSLIISKGELS
RIMM_RHILO/95-169-------------------EDEFYHADLVGLEVRDDT.G...T--ALGKV.---.VAV.HNFG-.GGDILDVTLAGR...
RIMM_MYCLE/104-177-------------------PDTYYDHQLEGLQVRTMM.G...R--DVGVV.---.AEV.LHTA-.AGELLAVRCDS....
Q8TT13_METAC/152-231-------------------PEFLSASTIKGDKIISST.G...E--DIGKI.---.DELMIDLE-.NGRVAYAAVSHGGYL
Q9RCZ1_STRCO/2-76-------------------ITREEIANVLDQPVYDGD.G...N--KIGDA.---.KHVFFDDM-.TGRPEWVSVKTGMFG
RIMM_STAAW/94-166-------------------ENEFYYSDIIGCTVFDDQ.E...T--PIGRV.---.INI.FETG-.ANDVWVIKGS.....
Q8U0T3_PYRFU/1-87-------------------MVKIRASKLRDVELITDT.G...V--RLGWV.---.YDLLFEEE-.GEEKGKILAILAEPD
Q9V279_PYRAB/1-70-------------------M.VMELSKLYGKLIYNTK.G...K--YVGKV.---.DEVVIDIK-.EREGRVLILALPG..
Q97L79_CLOAB/5-84-------------------LNNFFLSEVLYRKVYDEY.G...E--YVGKL.---.WDIYVTAD-.ESYPRAIGYKIKKGG
RIMM_FUSNN/93-167-------------------EDEYLVSDMIGFKVYDVKGD...E--YLGEI.---.TEI.MDTA-.AHDIYVIESEE....
Q8XJS5_CLOPE/3-86-------------------NNVRYLSEIERYEIININDG...E--KYSGLI---NNDVIIDE.-.EGKLKYLIVNLGGG.
Q8YXT2_NOSS1/83-164-------------------IEVEALSNLINWEVITET.G...E--VLGRV.---.RGFRFEAE-.TGKLNTIVIASLGVP
RIMM_STRLI/93-167-------------------EDEYYDHQLIDLDVVTED.G...T--EVGRI.---.TEI.SHLP-.TQDLFVVERPDG...
Q98FN8_RHILO/179-262-------------------ADGNLATNIIGKTVYNGT.GDDAQ--NIGSV.---.NDIVLSK.-.EGKAESLVIGVGGFL
Q98FN8_RHILO/47-130-------------------AEGNIVTNIIGESVYNGT.GDDAE--NIGKV.---.SDVVFDK.-.DGMAKSVVIGVGGFL
Q9HJW3_THEAC/44-126-------------------LVMEFYSRVNQKPVMSSS.G...E--IIGYV.---.KSFMADEK-.WNLTTMVAKPSGGRG
Q9X7S4_STRCO/2-79-------------------DELMAARSLTTRPVVTLG.G...D--AVAHV.---.KDTVCDAA-.AERITGFTLTGRGLL
Q8KZ61_9PROT/139-211-------------------KVHKNDPDPRGQAVFGCD.G...A--QGATV.---.VDLWVDRA-.EPHFRYAELEVGD..
Q8XKS1_CLOPE/4-80-------------------LTMFLYSNIINKKIYDEF.N...E--VLGVL.---.KDVYVTTE-.DGYPRIIGYKVKR..
Q8TT13_METAC/9-88-------------------PDFLSANTLKGDKVVNRA.G...E--DIGKI.---.EELMIDLQ-.DGRVGYAVLSFGGFL
Q984C7_RHILO/152-230-------------------GPGLRVDEIVGSEVRSSD.D...K--IVGEV.---.RNVVIGTK-.DRWDYAVVASGGFFI
Q8YLI3_NOSS1/15-92-------------------DTEFDNYNIKDFDVYSDIDN...D--KVGTV.---.KHILVD.D-.SGRFRYLVVDTGFWF
Q8RA47_THETN/1-81-------------------M.SVRLSEFGSKEIVNIVDG...K--RWGLVE---DSDLIIDED-.TGKIHSIVLYEPGG.
YRRD_BACSU/19-95-------------------HTLRTCHEVEGFPVYSERTS...S--YLGTI.---.SDICFSLK-.GDCLGFILAQK....
Q9FHG3_ARATH/177-263-------------------EGEFYSRDLVGMRVLLKETG...Q--LVGTV.---.ANI.FDNG-.GNDLLHVLLDSSMEV
O29888_ARCFU/1-79-------------------M.YVPARSLARKSVVLTD.G...T--VVGTL.---.YNITVDFK-.TGTIVNLLVKPENE.
Q8YPZ0_NOSS1/27-104-------------------QDSFQGNDIKGLGVYTERSD...E--KIGTV.---.NDVLVD.D-.EGHFRYLIVDLGFWI
YMXH_BACSU/1-81-------------------M...RLSELSGKEIVDIKRA...E--RLGVLG---QTDLEINEQ-.DGQITALLIPTVKW.
Q8PVJ8_METMA/1-79-------------------M.RAELTSLFGLNIYTNN.G...V--YVGKL.---.QDLVIDVE-.EQKVTGLAVSDINR.
Q9RVX7_DEIRA/85-163-------------------EALAGKTNLIGMTLLTTD.G...Q--TLGKI.---.TDVYFDER-.SGQVEGYEASGGLFA
RIMM_DEIRA/98-175-------------------EGTFYYHDLRGLEVYGAG.G...E--RLGTV.---.SDV.MDAG-.HQDLLVVDYGGGTSF
Q8XJH4_CLOPE/1-72-------------------M..YRIRDLIGLKVFDSN.G...K--KVGVV.---.CDLAIDYF-.NGKVMGFIITKKLFS
Q8YXT2_NOSS1/4-80-------------------EQIIRRSDILNTQVITRDNG...K--RLGIV.---.SQVWVDID-.QREVVALGLRDS...
RIMM_TREPA/101-174-------------------AGEFYLADLCRCELVFE..G...S--AVGVV.---.LSV.VEGG-.GSSLLEVQRTHG...
Q979P9_THEVO/4-82-------------------FEAYTIENLRGKYVYTNK.G...I--FVGQV.---.SDVILDFD-.NNVVHGLFIAKTNE.
Q98FN8_RHILO/332-413-------------------VGEIKASDLKGTTVYGAN.D...A--KVGEI.---.GDVVLTP.-.DKKTDAVIVNVGGFL
Q8YPY9_NOSS1/14-91-------------------RETFGGDDVKALELYTQS.G...V--RVGAI.---.ADVLVD.N-.EGRFRYLVIDTHIDD
RIMM_NOSS1/159-240-------------------EDEYHVVDLIGMEVFLQASG...D--LVGAV.---.VDV.I.PA-.GNDLLEVSLHEPVTS
RIMM_CAMJE/95-175-------------------KDEFFYFDILECEVFEED.....K--RLGKV.---.VDI.LETG-.ASYLFEIQSDEKWVE
Q9HQW1_HALSA/3-85-------------------ADADEITSLVGREVYSNN.G...V--FVGEV.---.EDIQLNLN-.AEAVTGLALTELNA.
Q9KDE9_BACHD/84-153-------------------PLMHGQHKLQGKPLITEE.G...E--RLGLV.---.QDVYFLEK-.AGKIVAYEVTEGLLA
Q93RD8_THETI/139-214-------------------SIAEGDPDPRGMTVVGLD.G...E--VAGTV.---.SDVWVDRS-.EPQIRYLEVEVAANK
Q9KDE9_BACHD/1-73-------------------MRTF..ASLEGLPVIDRQTG...N--ELGSV.---.MDGIIA..-.PDRMMGFLVNKNGWF
Q8KYZ8_9PROT/141-216-------------------FHVSAGRDPRGKPVVAGD.G...E--VIGRI.---.NDMWIDVP-.EQMVRYLTVDLNPEG
Q9X7S4_STRCO/87-169-------------------HQQNLRARLRGARVLTEA.G...T--EIGTV.---.LDVVVEGG-TGGRVVGFRVAASRRF
Q8PZP4_METMA/2-84-------------------SKVFARNLLFNKQVMATD.G...T--EIGTL.---.SNIVIEIK-.GGRIIDLMVSPNPTF
Q8PW10_METMA/7-86-------------------PEFLSASTIKGDKVVNTA.G...E--DLGKI.---.EELMIDVD-.DGRIAYAALSFGGFL
RIMM_LISMO/97-171-------------------ENEFYFHEIIGCTVVTTD.G...E--ELGEI.---.TEI.LTPG-.ANDVWVVKGADK...
Y1118_METJA/1-81-------------------MEKMPAKLLFERSIIGNK.G...S--VIGKV.---.KDIVFDEK-.VGRLVSLEVEPAEH.
Y916_METJA/1-83-------------------M.AIRVSDILDKPIYTTT.A...I--YVGKV.---.YDVMLDLN-.KGVISGLIVSDIQN.
Q98P08_RHILO/254-335-------------------IDKIRAEDLVGTTVYGAN.D...A--KVGKI.---.GDVVLTG.-.DKKVDAVLIDVGGFL
Y1314_DEIRA/22-95-------------------DTSM..YNPVGAAAYGVN.G...D--KIGTV.---.RDALVEPE-.TGRIRYFLVDVGGWF
Q98P08_RHILO/125-208-------------------PNGSLVSKIIGATVYNGT.DANAQ--TIGKV.---.NDVLLAK.-.DGKAQSLIIGVGGFL
Q8PW10_METMA/146-225-------------------PIFLSADSIKGNKVVNRD.G...N--DIGKI.---.DEIMIDLQ-.DGNVAYAAVSHGGIL
RIMM_SYNY3/108-184-------------------PGEFHVTDLLGLIVYDHDNG...D--RLGIV.---.TD..FYSA-.GNDLLGITLDKNPD.
Q8TV79_METKA/1-85-------------------MRIL..RDLIGKPVIDSS.A...K--HIGEV.---.LDVEFDEE-.SGEVTTLIVGHSKRP
RIMM_CHLTE/94-167-------------------DDRAYIHELIGLDVFDET.E...G--RVGKI.---.SDV.LQMP-.AHDVYEVDTGD....
Q8YIS7_BRUME/47-131-------------------PGQLLTSDFIGQPVYNGP.SDDAD--NIGTV.---.NDIILGA.-.DGTPQAIVIGVGGFL
RIMM_CLOAB/90-164-------------------EGQYFIKDIIGCNVFDEN.D...K--DLGEV.---.YDV.ISTK-.NNDVYCIRKEGQ...
RIMM_RHIME/96-170-------------------EDEFFYADLEGLEAVDRT.G...K--SYGSV.---.TGV.FDFG-.AGDLLELKGPGL...
Q8TTG0_METAC/16-93-------------------RTFVAATEIKGSKILTVK.D...E--ELGTI.---.KEVMIDSE-.WGRIAYVVFACDCFL
RIMM_BRUSU/96-170-------------------EDEFFQTDLIGLEAVDGD.G...K--SYGVV.---.SAI.FDFG-.GGDLIELSEKGK...
Q97I44_CLOAB/3-86-------------------DNVKYYSEVEKYEIININDG...E--KYATVS---NNDIIIDD.-.SGKMISLIIGNNNT.
Q97IG5_CLOAB/1-72-------------------M..IRSREFIGADVYSTK.G...E--KIGAV.---.DDVILNFS-.SGFVLGFKINKGKVF
Y1697_CLOAB/3-84-------------------LPSHSINAMKSMEVIDINTG...T--KLGLI.---.KDLKIDTE-.EYKVISIILPGSKV.
YLMC_BACSU/1-81-------------------M..ISISEFQVKDVVNVSNG...K--KLGSI.---.GDIDINVT-.TGKIQAIILGGNGK.
RCEH_RHOVI/144-217-------------------SIAEGDVDPRGLPVVAAD.G...V--EAGTV.---.TDLWVDRS-.EHYFRYLELSVAGSA
RIMM_BACSU/98-172-------------------EGEFYFHEIIGCEVFTEE.G...E--LIGKV.---.KEI.LTPG-.ANDVWVIGRKGK...
Q8TT13_METAC/470-549-------------------PDFLSANTIKTDRVVNTA.G...E--DLGRI.---.DELMIDLD-.NGRVAYAVLSFGGFL
P73463_SYNY3/83-164-------------------VEVDLYSPLVNSEVVTET.G...E--PLGRV.---.RDFQFDLA-.TGKVSSIIIASLGLP
Q9RJP4_STRCO/15-90-------------------FEAENIRDWRGLDVVDYD.G...R--KIGTL.---.ESIYFDTL-.TDRPAFATVTIGLPT
Q9K9U3_BACHD/1-82-------------------M..LKISDLQAKDIVNMENG...R--RLGTI.---.TDLDINLT-.TGQISSLVIGGGGK.
A9CG63_AGRT5/75-157-------------------ENQVSANDYIGKSVYTGA.D...E--SIGNV.---.TNLIMEQ.-.DGGLVAAVIGVGGFL
RIMM_AQUAE/95-164-------------------EEEYYAYELVGMEVETDK.G...K--KLGKV.---.ERV.QDMG-.PYDALVLDK......
Q8TT14_METAC/106-185-------------------PDFLSSGTIKGDKVINKA.E...E--HLGKI.---.EELMIDLE-.NGRVAYAVLSFGGFL
Q8YLG6_NOSS1/15-91-------------------NEIFGGNDIKDFDVYADN.....D--KIGNV.---.DNILVDED-.DGHFRYFIIDTGFWV
Q9HJM4_THEAC/8-86-------------------EKEFDVASLIGKDVYTIK.G...I--KVGRV.---.NDIVLDFD-.KNQIHGIFIMNTND.
Q8XJJ6_CLOPE/3-83-------------------ENLFSLNNLRAMEVIDVSEG...K--KLGLI.---.ADVKIDCD-.DNRILSIIIPGEKT.
RIMM_HELPY/101-181-------------------EGEFFYCDLVGLSVVEEN.....E--ILGKV.---.IEI.QRIS-.QTDYFLVETTLNLVE
Q7CY35_AGRT5/58-138-------------------KTDLTASQLDGMDIYNAQ.N...E--NIGEI.---.EDVVIGD.-.GKSVIGLVASVGGFL
Q8R9H5_THETN/1-81-------------------M..IKASDLRDKEVIDINTG...E--KLGNI.---.IDIDVNLE-.EGKIEGIILPKETG.
Q97IG5_CLOAB/73-150-------------------GSFIRFNSIKNMDVINYD.G...T--ILGMV.---.EEIMFDEK-.TFKIKGIIVSRGF..
O27219_METTH/9-79-------------------GEEKYWSEIKGYQVATNN.A...R--ILGEL.---.EELIINDK-.TGKITDVVIKVD...
Q97A34_THEVO/1-81-------------------M.MDFYSRLIEKPVMSSS.G...E--IIGHV.---.KNFSIDEK-.WNIVTMIASPASKKY
RIMM_MYCTU/100-173-------------------PDTYYDHQLVGLMVQTAT.G...E--GVGVV.---.TEV.VHTA-.AGELLAVKRDS....
Q9KA86_BACHD/1-79-------------------M...RLSEISGKEIIDFQRG...E--RLGVLG---QTDLVIDEE-.NGQIEAFIIPTMRW.
Q9RVX7_DEIRA/1-75-------------------M..IKGKELLGRPVVAVSNG...A--QVDNV.---.HDVVFDHQ-.GNRVLALLVEEGGWL
RIMM_CAUCR/97-173-------------------DDEFYLTDLVGLTVRHIQTD...Q--LLGRV.---.KSV.QNFG-.AGDILEITPDLGG..
RCEH_RHOCA/142-214-------------------MKVSAGRDPRGMPVQAGD.T...E--VVGKI.---.VDMWVDIP-.EQLVRYLEVELNSG.
Q92KL1_RHIME/85-167-------------------ENQVSANTYIGQSVYNAS.D...E--SIGEI.---.NDLIIEK.-.EGGIAAAVVGVGGFL
Q9LCY6_9RHOB/140-215-------------------FIVSAGRDPRGLPVMSGD.K...E--IVGKI.---.TDMWIDEP-.EQLVRFLEFELEGKW
Q8RTW1_9PROT/141-213-------------------KVNSRDPDPRGCAVIACD.G...K--QGGTV.---.TDLWVDRA-.EPLFRYAEVDVGD..
RCEH_RHOSH/140-212-------------------FHVSAGKNPIGLPVRGCD.L...E--IAGKV.---.VDIWVDIP-.EQMARFLEVELKDG.
RIMM_RICPR/94-165-------------------EDEFYIADLNHLQILDQS.N...K--EIGKI.---.KNI.LNFG-.AGDIIEIEFLDK...
Q8TZ43_METKA/14-101-------------------KRYVRFQRLLGMEVFTED.G...R--RVGTV.---.EDVTFDPR-.TGDLVRFLVIVTEQP
Q8PW10_METMA/656-735-------------------PEFLSAGTIKGDKVINTE.G...E--DLGKI.---.EELMIDLD-.DGRVGYAVLSFGGFL
Q8YIS6_BRUME/6-88-------------------NEGLSAEKLIGAMVYDAD.E...T--KIGTI.---.GDVLMSA.-.DGQTEAFVADVGGFL

PF08683

CAMP1_HUMAN/1462-1591DTEEIYKLTGTG..PKNITKKMIDKLYKYSSDRKQFNLI.PAKTMSVSVDALTIHNHLWQPKR
Q7YYZ7_CRYPV/210-337ENNWQCVVEIVPNCPKVIRKEMVHTLYKFDTSQKLFKPINRSKKITDIVDGLSI.......KN
Q4RGQ5_TETNG/1262-1393DTEEMVKFTGTG..PRAIGHKMVDKLYKYSSDRKQFTVI.PAKTVSVSIDALTIHNHLWQVKR
A7RQ86_NEMVE/2757-2885ENEQLYKVFGIG..PRVITAKMIDNLYKYSSGGKEFVKI.HSKTLSISVDGLSIMKQYWQSSK
Q966J8_CAEEL/987-1116ISDTAVKISGQG..PPKCTEAMMNSMFKYDSGAKNFTNI.ATKHLSATIDGFAILDQYWQKAR
Q4RHF5_TETNG/1329-1444ETEEMHYSSCQD..AAVL..LTTDCLQQTSSSDETFGDV.KKDEQQET............EKK
Q8T0T0_DROME/1254-1383ETDQVTKLYGTG..PSQVEEVMFDKFFKYNSGGKCFSQV.HTKHLTVTIDAFTIHNSLWQGKR
Q22NV2_TETTS/1646-1770NTNEVKKIFGLNTAPTQIDLASVQAFYRYDSGSKEFKEI.LVKAFSNQVDAVLL.......KK
Q5BSP1_SCHJA/148-278ELEELKIICGNG..PRRITHDMVNRFFKYNSGTKQFTQITSTKHLSPVVDAVTIHDALWTNKS
CAMP3_HUMAN/1108-1237ETEELSRLAGYG..PRTVTPAMVEGIYKYNSDRKRFTQI.PAKTMSMSVDAFTIQGHLWQGKK
A2F4R0_TRIVA/686-800NENCVVKHCGKG..PQMINTADIGRSLNYDVGSMNF.....SKSNIDDADAFYL.......KK
A0DFP2_PARTE/643-768VDSQPYLIFGQGKCPQVLTSEMVKTFFKYDSGAKQFKAIDGNKQFTIMVDAVQL.......RK
A8BRM3_GIAIC/714-841LSGSLIKVDGPDNMPNELAQSIIESMLKYDSSSRSFLVV.DQRQLSTLVVAITL.....KVRR
A2FZI3_TRIVA/667-788NNDVAKKIYGIG..QDSIYQSDVSAFYKFVNGTKQYERI.LSKSFTQTTDGFSM.......KR

PF09939

Q89BX0_BRAJA/6-72........DGQHHHFIPLSWV-----DHVDQ..HVHLNKTGADITS-----------------
Q9RUN6_DEIRA/5-67.........QGQHHWLPLSAV-----DHVDE..HVHLKLSHEQVHQ-----------------
Q09E21_STIAD/120-184.........NGEHHYIPLSWV-----QSVDDA.GIHLDRPGKEAMK-----------------
Q1MFC3_RHIL3/6-71.........DGKHHLIPIDWV-----DHVDA..HVHLSKNARDVRM-----------------
B7KQF0_METC4/6-72........AGGLHHYIPLDFV-----IAVEGD.QVRLNRSADEVKK-----------------
Q1QG65_NITHX/6-71.........DGKHHFIPLDWV-----ENVDD..RIHLGKAAKDVRA-----------------
Q6N686_RHOPA/6-75.....EGHHKGHHHFIDGGLV-----AEVEGD.KVRLSANADVAVT-----------------
Q98NL9_RHILO/6-75.....EGAHKGHHHYIPLALV-----AEVDGK.KVWLSANSDVAVT-----------------
Q1NBM9_9SPHN/203-269........AGGVHHSIPSNWI-----KSVDAT.RVTLEKTAEQAQD-----------------
Q1NFL4_9SPHN/7-83QVEGATGSHEGHHHYISKGLI-----AEVESDGRVRLSANADVAVT-----------------
B0T0F4_CAUSK/6-72........GGFKHHLIPVTWV-----DHVDDD.GVHLTLTKDDAKA-----------------
Q9A832_CAUCR/52-118........GGLKHHLIPLSWV-----EYIDDA.KVHLSVTKDDAKS-----------------
A5VBW0_SPHWW/201-266........AGGHHHSVPCAWI-----AEVSD..KVTLNRTAAQAQA-----------------
Q6FG17_ACIAD/8-75........AQGQHHYIPTQWV-----QQIQGN.QVVLNKTAEQVFQ-----------------
A3M6W3_ACIBT/8-72.........NDQHHLIPTSWI-----GEVKED.QVILNKNSEEVKE-----------------
Q2GBQ3_NOVAD/12-85GYE..GGTHSGHHHYLSCGLV-----AEIEGD.KVRLSANGDVAYG-----------------
Q1GXW5_METFK/6-70.........NGQHHYIPVSWV-----TATDNA.EVTVDRPGEQAMQ-----------------

PF05239

Q8U5M3_AGRT5/23-102GI.........GDDYYPLPWE....KLHYDEE-LDGYRIDLTKEQI-----------------
Q930B5_RHIME/36-117GM.........GERYVVVSPKALKITYVENDK-KWTAVMDATKDQL-----------------
RIMM_CLOPE/90-162.............KEVLVPVLK.DIVLDINMD-EKLITIRPSGEWQ-----------------
RIMM_STRP1/96-169.............RDLLLPYIP.PVVLNVDVP-NKRVDVELMEGLD-----------------
Q98MZ5_RHILO/112-191GI.........GEKYHAIPWA....SLDYDEN-RGGYVVPFSKEQL-----------------
Q92W42_RHIME/10-89GI.........GHEHYPLPWE....MLDYNTD-LGGFQVNITKEQV-----------------
O28740_ARCFU/3-81ALI......DSHAKGVIIPYR......VVKAV-GDIIIIKDLFKRK-----------------
Q8U4G3_PYRFU/1-71.............ERVGVPYE......RVTAV-GDIILVEATTEKK-----------------
P73463_SYNY3/4-81.............FLSLTGMPQYLYLNSIVQT-GDVVLVENDDVFE-----------------
Q9AK83_STRCO/6-79.............RDAFVPLE......PSELV-DGALRVPFDRALI-----------------
RIMM_AGRT5/96-170.............RPALIPFSE.AAVLEIDLE-AGRILIDPMAAGL-----------------
RIMM_CORGL/96-169.............KETLIPFVH.AIVPEVDLE-EGTATITPPEGLL-----------------
O27055_METTH/11-97KKNVGIKDVLKTSIRIVPESD......EIRPI-QEEGIIDINYDRV-----------------
RIMM_BORBU/94-166.............KFFFIPFLS.IYIGDINTQ-EKTIELKVLDLLK-----------------
Q9JPA8_RUBGE/139-212.............RKVLLPVN......FAILK-RDAVKVTALLGHQ-----------------
RIMM_BACHD/97-172.............KDLLIPYIE.QVVKQVDLE-KQQITIEPMEGLL-----------------
RIMM_LACLA/97-170.............RDLLLPYIP.PVILNVDVN-QHRVDVSIMEGLD-----------------
O26906_METTH/8-84L..........KQRTFIVDME......SVSRV-GDYVVLAIAADEA-----------------
RIMM_RHILO/95-169.............KGVLIPFTQ.AAVPDVSVA-EGFVRVDPVAAGL-----------------
RIMM_MYCLE/104-177.............GEVLVPFVG.AIVKLVSLD-DGIVEIDPPKGLL-----------------
Q8TT13_METAC/152-231GV.........GSKFFAIPWQ....ALQLKVH-EHAFVLDISKETL-----------------
Q9RCZ1_STRCO/2-76............STESFVPIR......DAALV-QDHLEVPYGKDQV-----------------
RIMM_STAAW/94-166.............KEYLIPYIA.DVVKEVDVE-NKKIIITPMEGLL-----------------
Q8U0T3_PYRFU/1-87EDIDISKFRITEDELLIIPIT......AVKSI-GEVIIIDSSKLAQ-----------------
Q9V279_PYRAB/1-70.............ERVGVPYE......KVVAV-GDIILVQA.SEKK-----------------
Q97L79_CLOAB/5-84.............EYINYEFKSIHFYREDESR-KIYMQVKAVKDTI-----------------
RIMM_FUSNN/93-167.............FETMIPDVD.VFIKNIDFE-NRKMLVDTIEGMK-----------------
Q8XJS5_CLOPE/3-86KFNL.....FNSDEYLEIEWE.....NVKRIG-AKTIILDVDSDMI-----------------
Q8YXT2_NOSS1/83-164Q...........IPDQFLSTYEISIEEVVSTG-PNRLIVFEGAEER-----------------
RIMM_STRLI/93-167.............SEVYVPFVS.EIVTGIDLD-AQRAVIDPPPGLI-----------------
Q98FN8_RHILO/179-262GL.........GAKNVTYDFNKAQW..AEKNG-DRWLVAQTTKEAL-----------------
Q98FN8_RHILO/47-130GV.........GTKNVAFDYDKLQW..AEKNG-DRWLVAQTTKDEL-----------------
Q9HJW3_THEAC/44-126RLNI....PTDDDGNYLIPMS......NVNVG-NDAIVVMNIESIR-----------------
Q9X7S4_STRCO/2-79S..........GPLKEGLPWS.....AVYALG-HDAVMIRDRRGLV-----------------
Q8KZ61_9PROT/139-211.............RRVLLPMT.....MARVKR-DGSVHVKSIRSDQ-----------------
Q8XKS1_CLOPE/4-80.............DGVIFDYEF.KNIDFYQKD-NGKFKIQIRGSRE-----------------
Q8TT13_METAC/9-88GM.........SDKFFAIPWQ....ALQLRVH-EHAFLLDIPKETL-----------------
Q984C7_RHILO/152-230A..........GKDSIVVPLR....YLQVNEE-RTSFYLRISSADV-----------------
Q8YLI3_NOSS1/15-92F...........GRQVLLPIG....RSRFNYT-NRRVYANGLTKEQ-----------------
Q8RA47_THETN/1-81FFR.......GRGNYIEIPWD......AIKRI-GDDMIIVEFEGKP-----------------
YRRD_BACSU/19-95.............RFLHHHHALLRACDISSIF-DDRILASVSSEQL-----------------
Q9FHG3_ARATH/177-263CNGN.....AKTNQLVWIPFVD.AIVPDVDLE-RKEMYITPPKGLL-----------------
O29888_ARCFU/1-79IPDF.....KKEEGLYIIPFE......CVRSL-KDFIVVDR.RRVR-----------------
Q8YPZ0_NOSS1/27-104F...........GKKVLLPVG....RSRIDYG-AGRVYAIGMTRDQ-----------------
YMXH_BACSU/1-81FGL......RKQGHDIRVPWH.....HIQKIG-SDMIILDVPEEMP-----------------
Q8PVJ8_METMA/1-79ELF......DISSRGIIIPYR......WVITA-ADIIIVRDVIQRY-----------------
Q9RVX7_DEIRA/85-163DM.........TNGRTFIPAP.....QSIQIG-KDSAIVPAGVAAA-----------------
RIMM_DEIRA/98-175.............VPLQAPYVE.VPLAGGKPG-AVHLTADAPAGLI-----------------
Q8XJH4_CLOPE/1-72.............KRDYVDLT......NVISL-SDTIMTEGVHVHR-----------------
Q8YXT2_NOSS1/4-80.............LISISGLPRYMYLSSIHQY-GDVILVDN.EDVI-----------------
RIMM_TREPA/101-174.............GVCYVPFHR.TFIGDVDVG-RKKIELLQRWILE-----------------
Q979P9_THEVO/4-82KLV.......KDGDPISIPYN......YVRSI-GDIIILKSFPDLM-----------------
Q98FN8_RHILO/332-413GI.........GTKEVAVGLDNLKFM.TDKNG-KKYLYTTFTKEQL-----------------
Q8YPY9_NOSS1/14-91S..........ISKKILLPIG....LSQINYP-ERRVYVDGLSKEQ-----------------
RIMM_NOSS1/159-240DK.........KPKTVLIPFVK.AIAPVVDLQ-TRRIEITPPPGLL-----------------
RIMM_CAMJE/95-175KK.........YPKIFFIPYLD.KFVKNIDIE-KRQIFCTQDAFLI-----------------
Q9HQW1_HALSA/3-85DLFAA...QMTGQKGVIVPYR......WVRAV-GDIILINDVVERY-----------------
Q9KDE9_BACHD/84-153DI.........TE..............GRKVV-RSNGPVTVGKDVL-----------------
Q93RD8_THETI/139-214.............KKVLLPIG....FSRFDKK-ARKVKVDAIKAAH-----------------
Q9KDE9_BACHD/1-73............HRHQWLPLD.....HIISLG-TDGVMIEAKGLSK-----------------
Q8KYZ8_9PROT/141-216T...........GQTRLIPIN......FCKIN-DDRVTVRSIYGAN-----------------
Q9X7S4_STRCO/87-169VPGP.....TRHRRRVYVPRG......RTLTV-SGRALVLPDGAVR-----------------
Q8PZP4_METMA/2-84DASR....YKKEDNYLLIPFD......SVSAI-KDYIIIDKMKARA-----------------
Q8PW10_METMA/7-86GM.........GNKLFAIPWQ....ALKLRLH-EHTFLLDIPKETL-----------------
RIMM_LISMO/97-171.............KEKLIPYIA.DVVKEINID-DQKITIEVMEGLL-----------------
Y1118_METJA/1-81SPIM.....REEGRNVLIPYK......LVVAI-KDVVVIDETNLNR-----------------
Y916_METJA/1-83GCLKD..YVTDPSKKVVLPFN......LITAI-GNIILVKPPADSG-----------------
Q98P08_RHILO/254-335GI.........GAKEVAVGMDNLKFM.TDKSG-NKYLYTNFTKEQF-----------------
Y1314_DEIRA/22-95S...........SKEVLVPVG......YGRVD-DSGVYFDSLTKDQ-----------------
Q98P08_RHILO/125-208GI.........GEKNVAFDFNKAQW..AEKDG-KRWLVIKTTKEDL-----------------
Q8PW10_METMA/146-225GI.........GSKLFAIPWK....AFSLRIR-DNAFILDIPEETF-----------------
RIMM_SYNY3/108-184.............KEVLVPFVE.AIVPTVELA-EQRLEIKTIPGLL-----------------
Q8TV79_METKA/1-85GVLRKIKWLGGEEKAVRIPYS......NVVAI-EDMVLVEGRWVSR-----------------
RIMM_CHLTE/94-167.............RKVLIPAVE.DFITETDLE-KGMVRLKRFKEFL-----------------
Q8YIS7_BRUME/47-131GV.........GEKDVAIGCNHFSWV.DKSGG-TRWLMVDADKEQL-----------------
RIMM_CLOAB/90-164.............QDILVPALK.DIVLKIEIE-NKKIVIKAVEEWL-----------------
RIMM_RHIME/96-170.............RPVLIPFTE.WSVLEIDLE-AGKLVIDPTAAGL-----------------
Q8TTG0_METAC/16-93GM.........KCKFFAIPWG......ALHTS-RGDYILKVDKDAF-----------------
RIMM_BRUSU/96-170.............RPMLIPFTE.AAVPEIDFD-KGIIKVEPHAAGL-----------------
Q97I44_CLOAB/3-86GFSL.....FSKNEFFEVEWQ.....YIKKIG-ARTIIMDVDNSVM-----------------
Q97IG5_CLOAB/1-72............NKHCCISVK......NMVSF-TSKMIVNYVP.YK-----------------
Y1697_CLOAB/3-84GGW......FSKGNDIEIDWT.....DIQKIG-VDVILVNGDNLFV-----------------
YLMC_BACSU/1-81VLGF.....FGKEEELVIPWR.....NIVKIG-EDVILVRLSEPHA-----------------
RCEH_RHOVI/144-217.............RTALIPLG......FCDVK-KDKIVVTSILSEQ-----------------
RIMM_BACSU/98-172.............KDALIPYIE.SVVKHIDVR-EKKIEIELMEGLI-----------------
Q8TT13_METAC/470-549GM.........SDKLFAIPWN....FLTYRAH-EHAFTLDIPRDVL-----------------
P73463_SYNY3/83-164Q...........IPDQLISTYELSIDEVVSSG-PNRLIVFEGAEER-----------------
Q9RJP4_STRCO/15-90R...........RRLVFVPVD......KATVG-PSYLKVTYDKSLV-----------------
Q9K9U3_BACHD/1-82VMGL....FGRGEDEVVIPWK.....NIIKIG-SDVILVEVPQFND-----------------
A9CG63_AGRT5/75-157GI.........GAKDVAVPMDKVTMTRNTQDG-TIRLTTTETAETL-----------------
RIMM_AQUAE/95-164.............ENLLVPFVS.DIVLKVDKE-NKKIIVK..EELL-----------------
Q8TT14_METAC/106-185GM.........GDKFFAIPWQ....ALQLKVH-KHAFVLDVPKETL-----------------
Q8YLG6_NOSS1/15-91F...........GKKVLLPIG....LARLNYE-NKRLLVPGLTKEQ-----------------
Q9HJM4_THEAC/8-86RLV.......KNGDPISIPFN......YVKAI-GDIIILKSFPDLM-----------------
Q8XJJ6_CLOPE/3-83SFF.......SKSEDIEIEWS.....DVYKVG-VDVILIDSKGKNI-----------------
RIMM_HELPY/101-181KG.........LAKIFLIPYRD.FYIQEILLQ-DKKITTHNAKTLL-----------------
Q7CY35_AGRT5/58-138G...........IDKSYVVLDPASVAVHNDNG-TWKAYVDTTKDAL-----------------
Q8R9H5_THETN/1-81FFRF.....FSKEAEIYLPWA.....AIKKIG-SDVILVDFRSANG-----------------
Q97IG5_CLOAB/73-150.............FANLVSGKKIILEGNYMLG-KKNLFCFSNDKNL-----------------
O27219_METTH/9-79.............SGRNVTVK......GAKKK-GDYLLVPFGKVEK-----------------
Q97A34_THEVO/1-81ENLP.....TDDDGNFLIPMA......NVNVG-KDAIVVMNIESIK-----------------
RIMM_MYCTU/100-173.............DEVLVPFVR.AIVTSVSLD-DGIVEIDPPHGLL-----------------
Q9KA86_BACHD/1-79FGF......GKKEKEVTVYWD.....QIKKIG-QDMIIIDL..EHM-----------------
Q9RVX7_DEIRA/1-75............RAAKAVPFG.....RVQSIG-EKAVMIATPEDVV-----------------
RIMM_CAUCR/97-173.............PTWYLPFTR.AAVPEVRVS-EGLILADPPALVG-----------------
RCEH_RHOCA/142-214.............KKKLLPMT......MLKIW-SDRVRVNAITSDL-----------------
Q92KL1_RHIME/85-167GI.........GEKNVAVPFDKIAVADQPDSD-DIKLTTTETADSL-----------------
Q9LCY6_9RHOB/140-215G...........SGTRLVPMT......FANIK-SNRVNIAALYGEH-----------------
Q8RTW1_9PROT/141-213.............GTRLLPMT.....MARVSK-DGTVQVKSIRSDQ-----------------
RCEH_RHOSH/140-212.............STRLLPMQ......MVKVQ-SNRVHVNALSSDL-----------------
RIMM_RICPR/94-165.............TTELLPFN....KEFFPII-TKDYVILNYQTKV-----------------
Q8TZ43_METKA/14-101SGGGLLPLPGGGGRRTETVDA.....ELVKAV-GDIIIIESPEKAS-----------------
Q8PW10_METMA/656-735GM.........GDKLFAIPWK....ALSLKVH-EHAFVLNIPKDVL-----------------
Q8YIS6_BRUME/6-88GI.........NSKPVAISIANLDVATGKDGK-LSVFTQFTKKDLQ-----------------

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window