Sequence alignment for CL0354

PF09022

Q8CTZ2_STAES/3-107MHNYNNINIVSD--DSKYQEICWFHTLEGIWHPVE--------------VETSPLNITFNKDITPNYVCTLINEDSRKII
Q99SX7_STAAM/1-105MEQIELFSIDKF--KCNSEAKYYLNIIEGEWHPQD--------------LNDSPLKFILSTSDDSDYICKYINTEHKQLT
Q106U4_STAAU/1-105MSKYQLINIKDN--NLEFSEKYWLHILQGVWRPEK--------------ISTKPLKITFNKNIFPIYICKEINEDSRRII

PF09023

A7X0T0_STAA1/1-107MYQLQFINLVYDTTKLTHLEQTNINLFIGNWSNHQ--------------LQKSICIRHGDDTSHNQYHILFIDTAHQRIK
Q8KLJ0_STAWA/1-107MYQLHFIHINDDALTLTKSKQDTIHLFIGNWINPS--------------AQKSISIRTGVDTNHNQYQILQIDTEHQRIK

PF02974

OMP19_AGRT5/84-180PATALDVTKES---------------MVGNWRVS...............NGGANCDMFLTLTNLGSG...SRGGTRGCSG
Q2K3E7_RHIEC/78-171AANALDVTKES---------------MVGSWRVN..................GSCDMFLTLTNLGSG...SRGGTRGCVG
Q11CW1_MESSB/82-178AASAAPIEKNS---------------LLGSWTVN...............SGGSSCQMFLTLTKYGNS...SRGGTRGCSN
A0NUQ0_9RHOB/76-173PADAKEIGRTD---------------LLGGWKIS...............SAGENCMAFMTLTTWSGG...YRANTRGCSS
Q1YE17_MOBAS/121-217STSSEPLSRTS---------------MTGFYQVS...............ASGGNCRVGLTLTQYDEN...YNAASMGCPG
A6WXE5_OCHA4/83-179PASAPDLTPGS---------------VAGVWNAS...............LGGQSCKIATPQTKYGQG...YRAGPLRCPG
OMP19_RHILO/83-179PAGASDLSAAA---------------VAGVWNAS...............VSGQSCKIATPQTKFGAG...FRAGPLHCPA
A1UQV6_BARBK/81-177PSYAINLSPAS---------------IAGVWNLS...............VDNTVCRVATPQTKFGQG...YSARPLSCSK
Q6G1L8_BARHE/82-178PGNAIDLFPAS---------------IAGVWNLS...............MGGKVCRIATPQTKFGQG...YRAGPLHCPG
Q6FYC8_BARQU/83-179PGGVLDLVPAS---------------ITGVWNLF...............VDGKFCRIATPQTKFGQG...YRAGPLNCSG
Q48H85_PSE14/26-124AMSLKLPDPAE---------------LSGKWRLSLQG............KTNEVCELHLNIDVP......KRTGDLACAV
INH_PSESM/26-124AMSLKLPNPAE---------------LSGQWRLSLQG............KADDACELQLNTEAP......QLTGDVACAA
INH_PSETO/25-120ASSFVVPSTAQ---------------MAGQLGIEA..............TGSGVCAGPAEQAN.......ALAGDVACAE
Q9ZNJ0_PSEFL/27-122ASSLVLPTSAQ---------------LAGHWALH...............QQEQVCALDLIEQAN......ALGGDVACAG
Q9ZG95_PSEFL/25-120ASSLVLPSSAQ---------------LAGHWQLH...............QADQVCALDLLEQAN......ALGGDVACVA
Q1ID46_PSEE4/24-122ASSLLLPNAAQ---------------LAGRWQLYPEQ............QKAQACDLRLGASEG......KLDGDLECAE
INH_YERRU/17-121ASSLVLPKVGD---------------LSGQWQLQLNV............SGAKICDIELKNTPITPDLIWHASGDTDCLS
Q3KCT5_PSEPF/2-111ASSLRLEDPSV---------------FAGQWQATLSARSDSPEAQALQDKPSNTCQIDLEANQ.......TLGKGADCLS
Q840P3_PSEFL/28-137ASSLRLEEPSV---------------FAGQWQATLSERSDDAKAQKHQDKPSNTCIVELQANK.......TLSKGADCLG
Q6DUB9_PSEFL/28-125ASSLRLADPSE---------------LVGQWQLQQAA............APAEGCTLDLLHNA.......ALGDGADCLS
INH_ERWCH/19-118ASSLRLPSAAE---------------LSGQWVLS...............GAEQHCDIRLNTDVL.DGTTWKLAGDTACLQ
Q9RB19_PECCC/2-101ASSLKLPSASE---------------LSGVWQLR...............GGEQQCEVVLHNTPLVDS.TWRLDGDAQCLK
INH_PHOLL/26-126ASSLVLPHASE---------------LKGVWQLS...............DKHQQCDVLLTDHPLPEGSIWSLNGDNDCLA
Q5D1B6_XENNE/39-140ASSLRLPAADE---------------LKGLWQLS...............DGNKLCSIELTDSRLPEGSIWAVKGD.SCVT
A8GE90_SERP5/30-136ASSLPLLAPSA---------------LKGHWQLNDAE............GKAAACEVELSDELIEGTNAYRFTASAQCLQ
Q2VU39_9ENTR/23-123ASSLVLPSAQS---------------LAGQWLVA...............NAEQQCQIEFLAGEQSEINGYSLVDRQHCLE
Q02J91_PSEAB/25-128ASSLILLSASD---------------LAGQWTLQQD.............EAPAICHLELRDSEVAEASGYDLGGDTACLT

PF09022

Q8CTZ2_STAES/3-107---LSNVDN-----PNIIIEMILINSKKLVFNAISKEGLGTS-----PKITFTK
Q99SX7_STAAM/1-105---LYNKNN-----SSIVIEIFIPNDNKILLTIMNTEALGTS-----PRMTFIK
Q106U4_STAAU/1-105---LNNTDN-----TNIIIEIIIINHRKIIFNVLNKLSLGVT-----PKITFIK

PF09023

A7X0T0_STAA1/1-107---FSSIDN-----EEITYILDYDDTQHILMQTSSKQGIGTS-----RPIVYER
Q8KLJ0_STAWA/1-107---LTSEED-----PQLMYILDYEDTNHIFIQTSVKNSYGTS-----RPIRYEK

PF02974

OMP19_AGRT5/84-180E..LTAMGS.WEVSGKMVLFKNRSGDTIGRVYKSADARFDGTTNSG.QPLSLSR
Q2K3E7_RHIEC/78-171E..LTAMGS.WEVAGKQVLLKDRSGNAIGSVYKTADNRFQGQTNTG.QPISLSR
Q11CW1_MESSB/82-178E..LANMRA.WDLSGNQVVMYDESGNTVARLYSSGGGRLDGTTTGG.TPVSVSR
A0NUQ0_9RHOB/76-173PV.LSGISA.WDLSGNQVVLKDGAGLIVAQLYSSASGQFNGQTSTG.SPISLYR
Q1YE17_MOBAS/121-217R..LADVRR.WSTTGNQLQLKDTSANVIATLTSSGKNRFTGQTTTG.VPVELYR
A6WXE5_OCHA4/83-179E..LGNLAS.WAVNGKQLVLYDANGGTVASLYSSGQSRFDGQTSGG.QAVSLSR
OMP19_RHILO/83-179P..IDGIKS.WNVAGKQLTLYDENGGSLARLYSSGGSKFDGQTSNG.QPISLTR
A1UQV6_BARBK/81-177I..FSEVRS.WAVKGKKLYFYDGSGRVVAVFYSFNGGRFEGYMFNN.QPAILTR
Q6G1L8_BARHE/82-178I..FSQVNS.WTVKGKRLYFYNNSGRIVVTLYSSNVDRFEGYTLDG.YPVVLSR
Q6FYC8_BARQU/83-179I..VSRVNS.WAVQGKKLYFYDNTGRIVVALYAFNVDRFEGRTLDN.RPVVLSR
Q48H85_PSE14/26-124KW.LHEAPTGWFPTPDGLAFTDKEGNRLIHLNNMGEQIYQASLPDG.EVLVLGR
INH_PSESM/26-124KW.LHEPPAGWFPTPDGLALTDNQGNRLIHLNRMDEQTYEARLPGG.ELLILGR
INH_PSETO/25-120QW.LGDKPVSWSPTPDGIWLMNAEGTGITHLNRQKEGEYTGRTPSG.ADVTLQR
Q9ZNJ0_PSEFL/27-122QW.LGEAPVSWTPTPDGIWLMNAEGTGITHLNRQKEGEYEGRSKSG.AVLLLQR
Q9ZG95_PSEFL/25-120QW.LGDTPRTWSPTPDGIWLMNAEGSGITHLNRQKEGEYQGRTASG.AMVVLHR
Q1ID46_PSEE4/24-122RL.LGLRPGSWLVTPDTLALVGGDGSTVVHFSREGAQRYGWTTPSG.TQLVLER
INH_YERRU/17-121QL.LGSAPQGWRPTPDGIMLTDETGSAVAFFERAQNG.YENTLPDDAGVIVLRR
Q3KCT5_PSEPF/2-111AW.LQDAAIGWFPDPDGLSITGKEGSRIQFFSRQRDGLYLSTLKSG.LVITLKR
Q840P3_PSEFL/28-137SW.LEATPIGWFPDPDGLSITGKEGSRIQFFSRQRDGFYQTTLKSG.LMITLER
Q6DUB9_PSEFL/28-125KW.LGEAAVGWFPEPDGIAITGREGSKIIFFSRQKEGLYEARLKAD.GLIVLQR
INH_ERWCH/19-118KL.LPEAPVGWRPTPDGLTLTQADGSAVAFFSRNRD.RYEHKLVDG.SVRTLKK
Q9RB19_PECCC/2-101VL.LSEVPAGWRPTPDGITLTKAQGQTVAFFSKEKEG.YTLILPDG.GTRTMHK
INH_PHOLL/26-126YM.FGEVPAGWRPTPDGLTITDEQGSGLAFFAHEPDGWF.ARFADG.RELMIKP
Q5D1B6_XENNE/39-140EL.IGQPVEGWYPSPDGIALTDDDGNSLAFFAHESERWVAYVVDGQELVMTFSR
A8GE90_SERP5/30-136PLALAELPVAWRPTPDGMTLTNADGSMVAFLALTAPKRYEVINHHGKPRFTLTP
Q2VU39_9ENTR/23-123KV.LTAEVVGWRPAPDGIALLRADGSTLAFFSRDGD.IYRNQLGAD.DGLTLKA
Q02J91_PSEAB/25-128RW.LPSEPRAWRPTPAGIALLERGGLTLMLLGRQGEGDYRVQKGDG.GQLVLRR

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window