Sequence alignment for CL0359

PF01348

YMF11_MARPO/546-691SGGLS--------LLVDMQKVINRLAEKGFCDKS........GHPKPNFAYFQYPQ---SYSVARIASILR--GLANYYH
O03089_9ROSI/66-204PKKLD--------TIVPIIPLIGSLTKAKFCNAL........GHPISKLIRADLSD---FDILNRFLRICI--NLSHYYS
Q35057_MARPO/978-1138AFRIQ--------IYAPLSRILDKLRARGIINAE........GRPTSVPLLATQDD---VTITQWYGSVAH--GFLSYYR
Q35058_MARPO/1090-1229SVNLY--------IRCPISHILECLRSQNIVAKN.......TRRPIAVTTISNLDD---LTIIDWFKSKAH--GILSYYK
MATK_HORVD/363-502MKKFD--------TIVPATLLIGYLSKAQFCTGS........GHPISKPIWTDLSD---WDILDRFGRICR--NLFHYHS
O03133_TROAR/92-230SKKFD--------TIVPISPLIGSLAKAKFWNVS........GHPISKPVRADSSD---SDIIDRFGRICR--NLSHYHS
MATK_SINAL/356-494RRKLD--------SNIQISSIIGSLAKDKFCNVL........GHPISKATWMDSSD---SDILNRFVRICR--NISHYYS
YMF40_MARPO/355-492LGRIR--------LCIPIDILIGKLSQMGACDEK........GTPKAVTKWIFLNV---GEIINKYMAVFR--GYYNYYS
Q03979_WHEAT/535-676EFPIQ--------IEAPIKKILRRLRDRGLISRR.......RPRPIHVASLTNVSD---RDIVNWSAGIAI--SPLSYYR
MATK_MARPO/220-354KKEFC--------SIIPVIPLIRLLAKEKFCDVL........GRPLCKLSWTTLSD---NEIFERFDQIIK--HIFSYYS
Q35062_MARPO/661-802TERLR--------VCAPITKLFYKLKEKGFVKRNEMG....KYVPTARRNLTPLDH---ADILELYNQKVR--GTLNYYS
O03101_9ROSI/151-289MKKLD--------TIVPIIPLIGSLAKSKFCNAL........GHPISKPAWANSSD---SDIIDRFVRIRS--NLSHYYS
MATK_EPIVI/295-434IKKVN--------ILVPIILSIS..DKEKFFNVL........GHPTSNLFRVDLSD---YNIIGRLECIYR--NLYHYLS
Q33759_ALLMA/562-727HTRVF--------FYIPVDKILAKLAAQGFLKDYVPG...GKIVTNAITKWIFLDH---RSIISKYNSIIN--GFLSYYS
MATK_SAXIN/362-497IKKFD--------IIVPIIPLIRSLAKAKFCNLV........GDPISKPAWADSSD---SYIIDRFVRICR--NIYHYHS
Q02718_PODAN/556-726NNRLY--------FYVPVRDIINKLEKAGFIKTYTSANGREKLAPNAITKWIFLDH---RSILLRYNAVIR--GLLNYYS
Q35059_MARPO/1119-1291RSTVY--------LEMPYSKIREKLRSVGFIRDEQ......GAFPKSLPQITELED---IQIIDFFKQKAY--GLLNFYQ
AI1M_YEAST/602-777TTRPI--------INAPIRDIINKLATNGYCKHNKNG...RMGVPTRVGRWTYEEP---RTIINNYKALGR--GILNYYK
AI2M_YEAST/638-799HTSLV--------VNAPIRSIVMKLNKHGYCSH...G...ILGKPRGVGRLIHEEM---KTILMHYLAVGR--GIMNYYR
LTRA_LACLM/381-549NGSVE--------LLIPLQDKIRQFIFDKKIAIQKKD...SSWFPVHRKYLIRSTD---LEIITIYNSELR--GICNYYG
Q35056_MARPO/669-811KVILT--------MDADMNQLKLRLQQQAYLAGN........GDPLPNFGLMSLPQ---SEANRRMNSILR--GYANWYQ
Q35063_MARPO/700-861ALPLQ--------ILAPLKEIRKRLKLWGLITEN........NKPCCVVRLIQLND---EDIVLWFNSVAR--DLLNYYR
YMC6_SCHPO/585-729SGFIL--------LSAPMDRIAKKLRETGLMLN.........HKGRSVIRWLPLDV---RQIIGLANSIIR--GYDNYYS
Q02717_PODAN/553-721TTSTV--------MNAPISKLVTKLADKGIVIWKSKALNEDNLIPQPILKWVNLPI---RDIILRYKMIWN--GYINYYS
MATK_PINCO/357-493TDEID--------PIVPIVPIIGLLATEKFCDIS........GRPISKLSWTSLTD---DDILDRFDQIWR--NLFHYYS

PF08388

A6DJK4_9BACT/340-418-----------------LKKCKDAI.RK.KTRRS---------NK........DSI---EDIIAYLRPNLV--GWYQYFK
Q8DMT0_THEEB/344-422-----------------VKAFLKKI.RD.TL.RE---------LRT.......ATQ---EIVIDTLNPIIR--GWANYHK
Q84EW7_LACFE/24-103-----------------KKRFKQSL.RE.ATKRN---------.RG.......ISL---EQLFKEIRQKVV--GWLNYYG
A3IQ70_9CHRO/380-459-----------------LKKHHEKL.RK.VV.RS---------EKA.......SKQ---EVLIRKLNSVIK--GWTNFYS
Q0HZ96_SHESR/345-423-----------------LRNVLQKV.RD.IV.KS---------HKT.......AKV---VTLISLLNPVLR--GWANYHS
Q4BXG1_CROWT/91-169-----------------QKRHYKKV.AE.TI.EK---------YKG.......QSQ---TILISKLNPIIK--GWCNYFS
Q118Z9_TRIEI/28-106-----------------IKTHYRKL.AD.IC.DK---------YKN.......AST---KALITKLNPVIK--GWANYFS
A7BUU9_9GAMM/362-442-----------------VKAHMESI.RQ.VT.KT---------MRA.......VST---QTLIDKLNPIII--GWSNYYS
Q8TH39_METAC/313-391-----------------KKSMQQEI.HN.WRMHL---------KPD.......LTL---EDLSHMYNPIVR--GWVNYYG
A6N5T0_PSEAI/316-394-----------------LKRMRQAV.RR.WRLNR---------QTH.......VTL---VDVARLYNPVIQ--GWWQYYG
A1ZX32_9BACT/379-457-----------------IDRHYQTL.KA.TC.IK---------HRA.......LSA---GALISNLNPIIR--GWCNYQS
Q92V78_RHIME/332-411-----------------LNAFKRRV.RQ.LTRRS---------.GG.......RSM---AEVAERLRVYVL--GWKAYFR
Q1NMW5_9DELT/335-413-----------------IAGIKEKI.RG.II.TA---------NKT.......AKT---DNLIGKLNPVIR--GWANYYR
A1T776_MYCVP/353-435-----------------MVRLREKV.RE.RTGRN---------RVG.......FDI---RDVIAVLNPILR--GWGNYFR
Q1XA93_PARBD/411-489-----------------VLAFLDNI.RN.IF.IK---------SQN.......LNA---YTLMKKLNPFLI--KWCNYYN
Q08724_9CYAN/368-446-----------------VKKHYDDI.AR.II.DN---------HKN.......AAQ---ETLISKLNPVIR--GWVNYYS
A6TN43_ALKMQ/221-299-----------------INKVTQTI.SE.LI.HN---------SRT.......VQQ---EQLIYRINEVTR--GWANYHH
Q9F5E4_AGRRH/348-426-----------------VKALLDKV.RR.II.KG---------NAA.......IAQ---EGLIQMLNPIIR--GWAMYHR
A6WZI3_OCHA4/335-414-----------------VKRLRGKL.KA.QFRAG---------.RG.......RAI---DATIKDLAPILR--GWTAYFK
Q94Z25_PYLLI/363-440-----------------IKRLKSRI.KL.EF.RS---------NKP.........I---GALIKDLNPVLR--GWANYYR
Q5IX97_9RHIZ/317-395-----------------LKSMRATI.KS.LNIPR---------QTP.......GTL---AEIAKQLNPLLR--GWIAYYG
A7KG74_KLEPN/317-395-----------------LKNVLRKI.KE.IV.KD---------NLA.......ATA---EMLIIKLNPVIK--GWANYHQ
Q75TN2_BACCS/287-366-----------------VKRLKQRI.RE.LTSRR---------.HS.......MKM---SDRLRRLNRYLT--GWLGYYQ
Q71EW7_9DELT/175-251-----------------LKRMNQAV.RD.LKIHR---------RTS.......LTL---QELAALLNPMVR--GWVGYYG
Q5L096_GEOKA/288-367-----------------IRRMKQRI.RT.MTSRS---------.KP.......IPM---PERIEQLNQYIL--GWCGYFS
A6L278_BACV8/349-427-----------------QKRFCEKI.RK.TI.EA---------NKC.......VKQ---KSLIMMLNPIIK--GWGNYYK
Q121L7_POLSJ/346-425-----------------VKAFYAKVKKE.IV.ES---------LSK.......VPV---ETLIKRLNPILK--GWAQYHK
Q6LJ59_PHOPR/129-208-----------------LQRFKQKL.KS.LTKRN---------.SG.......KPL---LEIIKGLNPVLR--GFSNYFR
Q8RSV8_9BACT/289-365-----------------EKRILGEL.RK.LKIHR---------WIY.......MNI---HQVSQRLRAKVR--GWLNYYG
A8MI91_ALKOO/292-371-----------------IERFKDKV.RS.KTKRN---------.AG.......RKL---EDIIKDLNPVIR--GWINYYR
Q67R28_SYMTH/286-365-----------------LKRVKDKL.RT.LTDRN---------.RS.......QSM---EDRIRCLNAYLR--GWVGYYA
Q4V1Q3_BACCZ/358-436-----------------RQKAKKKI.GD.TL.RV---------MRG.......QPI---GEIIRVLNPIIR--GYGQYWK
Q2BCB5_9BACI/292-371-----------------KQRLETKL.LK.LTNRN---------.WG.......VSM---TYRILKINQLIQ--GWGNYFK
A6L5N4_BACV8/347-425-----------------LKKFMQKI.RG.II.DS---------NKG.......SKQ---ESLIRLLNPVIT--GWVNYYK
Q1VWX8_9FLAO/148-228-----------------RSKLFSKL.RE.LFANR---------KH........WTI---EWIVWKVNQLLR--GWLNYFS
Q64BS2_9ARCH/304-382-----------------MGNLIRKI.GD.VI.KR---------AKA.......WKQ---EDLINVLNPLIT--GWSNYHR
A4XCB1_SALTO/367-443-----------------IRSLKAKV.RA.LTRRT---------SQ........QDL---GTVLTRLNLVAH--GWANYFR
B0KBD2_THEP3/339-418-----------------IKRFKEKV.RE.ITNRN---------.KG.......ISM---ENRIKRLNQITT--GWVNYFG
Q8RSV7_9BACT/97-174-----------------IKRVGERL.KK.LKIHR---------MVH.......LHV---REIAEILAPIVR--GWINYYR
Q7GEU5_CANPA/684-762-----------------VLSFIEKL.KL.IF.KK---------SMN.......LDA---YNLITKLNPILR--GWSNYYN
Q4C1M3_CROWT/353-431-----------------YRTFRQKV.KD.IVNCS---------N.........YGA---KVKAKKLAPLVR--GWRNYHR
A5VHP4_LACRD/329-408-----------------QQRVKKAL.RL.LTKRN---------.RG.......ISL---TRMFEEIQRKMR--GWLQYYS
Q3F0V4_BACTI/313-390-----------------KKAIRKEV.RS.WRLQL---------KAD.......KTL---QDISNMFNKKIQ--GWINYYG
O99969_PORPU/347-422-----------------IDRHLKDI.KS.ILKKS---------SG........ISQ---KVLISKLAPVIN--GWTRYFA
Q2THC8_SHIFL/276-360-----------------MRKITETI.KK.WRIHR---------STA.......ESL---LDFARRYNAIVR--GWIEYYG
Q119D3_TRIEI/365-444-----------------IKAHYQRL.AS.EI.DK---------FKS......CKSQ---IDLIKGLNPIIT--GWSNYYS
A7N7X0_VIBHB/337-415-----------------TLLFLSNL.RE.LI.KK---------HAT.......IPV---NDLIKLINPKLR--GWSNYYR
Q8TM71_METAC/31-109-----------------QREVIKKI.SD.AI.HK---------AKA.......WDQ---DRLIRDLNPIIR--GWTQYHN
A4BN29_9GAMM/57-135-----------------VKKITVQL.TE.LTKRE---------LTC.......IPL---GDVVANVNRSLR--GWANYFH
Q7NP80_GLOVI/345-423-----------------IKTHTEKL.RR.II.HK---------HKA.......QPQ---SFLIEHLNPIIR--GWTHFFS
A4Y225_SHEPC/252-330-----------------QKGMIKKI.RM.LAIRK---------RTD.......LSL---EQIARRINPIIN--GWINYYG
Q10VN2_TRIEI/308-393-----------------VKEFLTLI.RG.WL.KA---------HPT.......STQ---EAVIANLNSIIR--GWGNYYR
A0L945_MAGSM/330-405-----------------RTSLLGRL.KE.VFKHL---------RS........QPT---EWVVNTINPILR--GWVSYFR
Q94Z24_PYLLI/352-428-----------------KRRLRSKI.RN.AV.KT---------NKS.........S---GEIIVELNPILR--GWANYYK
Q1XGB6_PHYPA/398-476-----------------RWRFLEDI.RR.AI.QF---------SKG.......KAA---YQLIITLVPKIV--GWGHYFK
Q82RB7_STRAW/349-427-----------------LQRARKRI.ST.TA.RE---------NSG.......SPT---ESLVRALSPFVR--GWSTYYR
A4VKJ2_PSEU5/358-436-----------------VSAFYRKV.RE.II.KG---------SGA.......LTQ---DALIGQLNPVLK--GWAQYHS
Q4E6A8_9RICK/143-220-----------------IKKLLNKA.RT.LI.KA---------NIA.......NTQ---AVLIKLLNSLLR--GWGNYYS
A1BAQ8_PARDP/313-391-----------------LKSFRRRV.RN.WGLQR---------RSD.......KGL---IDLARMFNRQIE--GWIGYFR
A4BSH6_9GAMM/128-208-----------------QGRFKARV.RE.MTRRN---------NP........LPM---YQVIHELNKYLR--GWVGYFG
Q1KVR4_SCEOB/824-902-----------------IQNHLNEC.KQ.IL.KK---------SIG.......QKQ---LNFMKKLHKKIQ--SWSKNYN
A7Y2S3_VIBCL/293-372-----------------LHIFKQKI.RR.LTNRN---------.WG.......VSM---SYQLFKVRQYMQ--GWINYFG
Q1VQF9_9FLAO/318-397-----------------RKRIADKL.EE.LKVNK---------LTF.......KSI---VGVAQYLNPMIR--GWVRYYG
A7V2J4_BACUN/347-425-----------------QKRFRAKI.GD.IV.KG---------HKM.......CKQ---ESLIRMLNPVIT--GWGNYYR
B4SCG3_PELPB/311-390-----------------LRHMRQTI.RR.WKLQL---------KNS.......LEL---ADLSAQFNPILR--GWKNYYT
Q10VN3_TRIEI/334-413-----------------IRSHYCHI.AE.VI.DK---------YKS.......ASQ---AVLIRKLNPIVK--SWVNYYS
A1BGI0_CHLPD/311-387-----------------LKTMRRTI.RS.WHLQL---------KSD.......KQI---EELSKAIDPVLR--GWKNYFC
Q6EI10_9CHLO/387-465-----------------RKKHQDKL.HE.LIIAT---------GKG.......LGQ---LALIKVLNPVIR--GWSNYFG
A3IK29_9CHRO/370-448-----------------ASEHYQKI.AE.II.RK---------HKS.......KRQ---AALIDNLNPIIR--GWCNYFA
A4FC41_SACEN/223-301-----------------LNKISREV.RS.WRLHL---------RTG.......HTF---AALARRINPVVR--GWMQYYG
A4BSI5_9GAMM/26-104-----------------IAAVKGKI.RA.II.KA---------GGS.......LPQ---DALIRRLNPIIR--GWGSYYR
Q9S109_ECOLX/353-430-----------------ARNFAASL.TA.LLSGN---------YS........ESK---VDMAEQLNRKLK--GWAMFYQ
A0YXC5_LYNSP/95-173-----------------LTRHYRKL.AD.WC.RK---------MMA.......VSQ---KELIGRLNPIIR--GWCNYHS
Q92Y56_RHIME/377-468-----------------AANLRHKV.KQ.LTQRD---------SIS.......VSL---GEKLRGVNAITS--GWANYYR
Q5P179_AROAE/107-185-----------------VTAMRQKT.RK.LNYRN---------RTD.......LSL---ADIARLHNPLLR--GWLEYYG
Q3B1V7_PELLD/340-418-----------------IKAHLTKV.RG.II.KA---------KKT.......IKQ---VDLIGLLNPVLR--GWANYHR
Q89TI6_BRAJA/98-173-----------------VLRIKRKV.SE.LLTPG---------NK........GAW---PEVQARLNRLLR--GWSAYFS
A5CZB8_PELTS/292-371-----------------IKKFKDRI.RE.LTPRN---------.HG.......MSL---KEMIKRLNPVLR--GWANYFR
Q2LRA6_SYNAS/211-289-----------------RKEINREI.CR.RHIQL---------KND.......KTL---DDLSNMFKAKIR--GWIAYYG
Q01P79_SOLUE/337-416-----------------LDRFKRRI.RE.ITGRA---------.KG.......VSM---KTTMEELAPYMR--GWRSYFG
A5LLN9_STRPN/155-234-----------------VRRFKFKL.KK.LTQRK---------.WS.......IEL---TRRIEQLNLSIR--GWINYFS
Q8YJX0_NOSS1/384-462-----------------LKIHAQKI.GK.LI.DE---------HKA.......VPQ---SDLIAHLNPVIR--GWTNYYS
Q81ZI4_NITEU/301-380-----------------LANFKHRV.RQ.LTGRS---------.WG.......VSM---EYRLEKLGQYLR--GWFGYYG
A3ITJ4_9CHRO/375-453-----------------IKAHHEKI.KK.VI.KN---------HKK.......TSQ---EALILRLSPVIK--EWSNYYQ
Q024N3_SOLUE/339-417-----------------VRKERRKL.HE.MTDSH---------QCF.......KPI---PVLIGELNRHRK--GWANYFS
Q4BZL5_CROWT/73-152-----------------ILAHHEAI.KE.VV.KA---------NKK.......APQ---EVLIARLNPIIR--GWCNYYR
Q2SF99_HAHCH/347-425-----------------TKAFLTKC.RD.VI.NA---------NKS.......AKQ---ENLIHRLNPIIR--GWVNYHK
Q0VRW5_ALCBS/345-423-----------------VKRFLAEV.KS.VL.DT---------HKT.......MPA---WWIVKTLNPKIR--GWANYHR
Q64A80_9ARCH/299-377-----------------AKVMRQKA.RR.WKIHL---------RSD.......MSL---DELSRMLGPIIR--GWISYYG
Q0RWF2_RHOSR/343-419-----------------LRSLKDKI.RA.VTSRL---------SQ........QPP---RDVLIRLNRIMR--GWSNYFR
Q9AMP0_PSEAC/333-396-----------------LQRLRERV.KS.LLRAR---------.RG.......SQL---TWLIERLNPVLR--GWSSYFK
Q4MP10_BACCE/356-434-----------------VKKAKEKI.SE.IF.KS---------HRG.......RSI---GQLIRKLNPVIT--GIANYWS
Q2JAX6_FRASC/343-420-----------------MQHARDRI.RE.ITGRS---------RLL.......LNP---EAVVRELNLFLR--GWAGYFR
A0YYL7_LYNSP/367-444-----------------IELHTDKV.KE.VI.KT---------HKT.......APQ---YALIKHLNPVIR--GWCNYHS
Q7UY81_RHOBA/354-431-----------------HQKMVDTI.RR.LTPRK---------SG........QSL---EATIVQINRVTV--GWFSYFR
A6TTG9_ALKMQ/237-315-----------------NKLFRAKI.KA.LKIHK---------KTG.......CKI---DMIAQWINPIVR--GWINYFG
Q11ZP2_POLSJ/335-414-----------------LDTFKQRI.RL.ITKRV---------.GG.......KGM---VQIAEQMKEYLP--GWKSYFR
A5ZS99_9FIRM/8-87-----------------LDKVKKKV.RK.LTSRK---------.WS.......VSN---SYKAKKIAEVVR--GWINYFK
A3IVC5_9CHRO/352-437-----------------IKPQKEKL.RE.KL.RE---------IKSWLYEHPNLKP---GAVIKVLNPILR--GWANYYK
A4YPB0_BRASO/18-96-----------------TSCFTHHI.GS.CGRRS---------GRG.......LA.---.QIIEKLSLYLK--GWRGYFG
A4G3U3_HERAR/349-427-----------------VKTFYEKL.RN.VV.SD---------NLG.......AKQ---VNLIGLLNPMLR--GWSQYHS
Q1D1V6_MYXXD/324-399-----------------VTEVLRRV.RH.VLRDS---------RA........LAV---QSAVVEVNAIVR--GWVNYFR
Q1NNY7_9DELT/350-429-----------------LDRARERL.RT.LTRRQ---------N.T.......APL---ATVIKAVNRFLV--GWGGYFR
A6TKY0_ALKMQ/313-390-----------------IKSFMDKI.KK.L..RK---------NSY.......LSL---TELAEKMNPIIR--GWANYFD
A6X7I7_OCHA4/354-431-----------------AKGFVRKL.TE.TLSGN---------HS........VST---VDMIAGLNRQLV--GWAAFYK
Q3M1M1_ANAVT/413-491-----------------LKQHLLHI.AR.II.DT---------HAL.......SPQ---ETLISKLNPVIK--GWANFYS
A6TVZ8_ALKMQ/227-305-----------------LKKITRKI.KE.TI.RI---------NIM.......QKQ---EILIYRLNQIIR--GWCNYHN
B4S5R5_PROA2/311-390-----------------LKAMRQTI.RG.WHIQL---------RCD.......RNL---QELAARFNAVLR--GWHCYYG
Q89BF9_BRAJA/341-418-----------------VRRLLRQV.HD.RTTRQ---------WYP.......DSP---ENTVAVINRFLR--GWCGYFD
A9BGC0_PETMO/340-419-----------------IKEFKKKL.KG.ETKRS---------.SG.......RSM---AYRLSRIKQIIT--GWTNYYG
Q5ZWK4_LEGPH/357-435-----------------VKALKLKV.KT.MI.TK---------LCT.......AKQ---EEVIGVLNPIIR--GWANYHH
A5G3H6_GEOUR/335-414-----------------AARLKANL.KT.IFRRG---------.RG.......QNI---QTTVEETTPKLR--GWLNYFR
A6TNL0_ALKMQ/222-301-----------------IKSLIRKC.SI.IILKE---------GKA.......STQ---SELIRRLNLVLK--GWTNYHK
Q6WFV8_EUGMY/378-464-----------------RNSHQEKL.HN.IVLKE---------GKG.......IAQ---EILIKKLNPIIR--GWSNYFG
A9B272_HERA2/344-422-----------------QRTFLATI.RA.TI.KA---------NMA.......LDA---EKLIRLLNPIIS--GWTAYHH
Q9AMW9_BRAJP/312-391-----------------LKEMRARI.RG.WRLPQ---------HSP.......LPL---EDIARSLSPVLR--GWDQYYG
A7BYN3_9GAMM/297-375-----------------LKKHKIAL.IE.VF.RQ---------MKT.......SSQ---EDLIRRLNPIIR--GWTNYFR
Q7YAJ7_CHAVU/296-374-----------------QETLLSQT.RF.VI.QS---------HKG.......SAV---HRLISALVPLIS--GWGNYFK
A6FZM7_9DELT/259-338-----------------MERMKERV.RE.LTNKR---------.RG.......RRV---EQVVWQLQRYLQ--GWWRYYG
A5IEI2_LEGPC/352-430-----------------VKAMTLKL.RR.GNWRN---------NTS.......LSL---QELADFINPMLR--GWLAYYG
A6EY09_9ALTE/319-396-----------------IDKLKTHV.RR.LSRRT---------.RG.......HSL---FQVIAELKETLL--GWKAYFD
Q0S063_RHOSR/344-424-----------------VRHARERI.RE.LTDRS---------RLL.......LPT---EVVVQDLNLFLN--GWAAYFK
B4S633_PROA2/313-392-----------------GKRIRQEV.RS.WKLHL---------RSD.......KAL---EDLARMFNAHIR--GWVNYYS
A4JUE6_BURVG/312-391-----------------LARFKERI.RE.LTQRT---------.RG.......ISV---DQMIGTLKRYLT--GWRGYFG
A3IWI4_9CHRO/365-443-----------------VKEHYNKI.AR.TV.DK---------HKA.......SPQ---RVLITELAPIIR--GWSNYYR
A0YT41_LYNSP/64-142-----------------IKIHLRKL.GE.TV.ES---------HNS.......APQ---VALIKRLNPIIR--GWSNYYS
Q93PB4_9BACT/329-408-----------------EQRFKEKV.KK.VTRRN---------.RG.......ISL---EQMVKELNRVLR--GWLNYFR
A5FDH6_FLAJ1/334-413-----------------YGKLKDRL.KE.ITNRS---------.NG.......MGY---EKIKELLRYYLQ--GWISYFK
A3WXE2_9BRAD/317-397-----------------VKDFHHRI.KQ.LTTRG---------RSR.......LSF---QEVIDALNPVLL--GWGRFYQ
Q877J2_PSESM/334-413-----------------LQVFKHRI.RG.LTPRS---------.GG.......RSL---PQVVENLRPYLL--GWKAYFG
Q1LRT7_RALME/348-426-----------------AQAFYRKV.KE.VI.SA---------NKT.......VKQ---EVIIRLLNPMLR--GWAQYHS
Q8A4I2_BACTN/337-416-----------------KNKMKSKL.KE.LTSRS---------.NG.......WGY---EKRKQKLKDYIR--GWIAYFC
Q24WW9_DESHY/303-382-----------------IRKLKDKI.RE.VTGRS---------.NG.......MGI---EERKTKLNQVVR--GWTNYFK
Q5ZTU1_LEGPH/340-418-----------------IKSVQMKI.KE.TV.KK---------GYG.......WKG---SELISALNPIIK--GWANYHR
Q4C1I8_CROWT/375-452-----------------IQAHYQEI.VK.VV.NN---------YKH.......APQ---RELIRQLNPIIQ--QWSDYYS
A7LY43_BACOV/347-425-----------------EKRFMENI.RK.VT.KG---------HKG.......CKQ---ESLIRMLNAKIR--GWGAYYQ
A0YTU1_LYNSP/380-458-----------------IKVHYDQI.AK.VI.DT---------HKS.......ASQ---EALIKHLNPIIR--GWSNYYA
A8KXN1_FRASN/320-396-----------------VASFSREM.RD.LRLHR---------RTN.......LTL---DQLAADINPKVA--GWLEYFT
A0YZ77_LYNSP/366-429-----------------IKTHLVKI.AE.II.DS---------HKT.......APQ---AALISKLNPLIR--GWSNYYS
A5ZWA2_9FIRM/335-416-----------------MKKMKRTV.KESINQRY---------LLV.......KTE---EELIKVLNPKIT--GWRNYYK
Q4C6J4_CROWT/338-415-----------------IKNHYKKL.RD.TV.DK---------YKK.......APQ---SRLIMELNPIIR--GWCNYNR
Q8YLU0_NOSS1/360-436-----------------TSSIKAKV.KE.VMKDS---------C.........FTL---EERIDKCGAIVR--GWRNYHR
Q8TMH8_METAC/132-210-----------------IESITQKI.KN.IV.SK---------AKA.......WTQ---EELIKTLNPIIR--GWANYHR
Q73IV1_WOLPM/33-111-----------------IKQHTFAI.KH.KL.RE---------MRG.......APQ---EVIIRNLNPINR--GWSQYYS
A3ESY4_9BACT/349-427-----------------VRSFLDKA.RN.IL.KL---------AKA.......KTQ---TWLIETLNPVIR--GWANYHR
A0LB55_MAGSM/355-433-----------------ISNLLEKV.RE.II.KS---------HKS.......STA---GGLILLLNPIIR--GWANYHR
A6DUJ5_9BACT/111-190-----------------IKAFKGKV.KL.ITKRN---------.SP.......VNL---QRVIDELRPKMR--GFANYFR
A0YQ93_LYNSP/350-428-----------------VKLFLREI.RE.WL.KT---------NKH.......ASP---ETVIQYLNPRIR--GWGNYYK
Q6ED59_CANZE/334-409-----------------VKLFTKNI.RT....KM---------KKC.......NSR---EDMMAT.NSVIR--GWANYYK
A0YP84_LYNSP/369-447-----------------QKVHHQQV.AK.II.EA---------HKS.......APQ---AALINRLNPVIR--GWANYYS
A7BMD0_9GAMM/46-124-----------------IKRVKEKI.RV.IC.KT---------GRG.......LSQ---EVIIRELNSVIR--GWGMYYR
Q1XGD2_PHYPA/395-473-----------------IMSLKWKI.KN.VF.SE---------NIG.......LSP---YQMIKLVNPILH--GWGNYFG
B7WSG4_COMTE/349-427-----------------VQAFYRKV.SE.IV.KT---------HLS.......TKQ---EDLIAKLNPILR--GWARYHQ
A0LN71_SYNFM/335-414-----------------VDRMKAKL.RE.QFRMG---------.RG.......RNI---RRVIEELTPVLR--GWVNYFR
Q8A4Z2_BACTN/144-223-----------------KEKFKRKV.KS.LTRRS---------.NS.......MGY---AQRKEILWQTFR--GWIGYFK
A0L6Q1_MAGSM/246-325-----------------SKSLRQTI.RREWKLQA---------RSQ.......HSI---EELARRLNPVIT--GWINYYG
Q2FSK1_METHJ/343-421-----------------IAAIIDKV.RV.II.KS---------AKA.......WKQ---EDLIKALNPVIK--GWAMYHR
Q8A4I4_BACTN/315-393-----------------MKRINETM.RS.WHLNR---------HSN.......LTL---EHLASDINPIVR--GWMTYYG
A4BP43_9GAMM/119-196-----------------RLAIKAKI.RD.IIRRG---------GA........IPA---TTLVARINAALA--GWVNYFR
Q12UG1_METBU/382-460-----------------IKKVTEKI.SN.TI.KD---------GKT.......WTQ---EDLISKLNPIIT--GWSNYHQ
A0YP86_LYNSP/368-446-----------------VKLHLKEL.AK.VI.DT---------HRA.......ASQ---SKLIESLNPVIK--GWANYYR
Q1VZ87_9FLAO/317-395-----------------KVRITGEL.RK.LAFHN---------KTQ.......RGI---QDLANLLNPKLR--GWIQYYG
Q97DG3_CLOAB/341-420-----------------VKKFKAKI.KA.ITARS---------.NA.......LNI---ENRIIKLRQCII--GWLNYFG
Q6DKY2_GEOSE/289-368-----------------IQRLKQRI.RQ.LTNPN---------.WS.......ISM---PERIHRVNQYVM--GWIGYFR

PF04494

Q0TXM2_PHANO/12-154GQTLAAQSTES..GGPKATKAFELL-RK-YTEDNLDIYKPELRK.LLWPVFVYSFL...DLVRDFYTKDAE..TFFVLFQ
Q6BLE6_DEBHA/159-301RDYEEKQRREN..DPEIYYRVYSML-RS-WVETSLDLYKPELSR.LLYPIFIHCFL...ELIAKNFSSQAK..RFLDKFK
Q28YL4_DROPS/95-236AEALAKFIGDDSFDAQQHEQAYEDL-RS-FVEDSLDIYKHELSM.VLYPILVQIYF...KMLAIGQKEKAR..AFIEKYK
A5DCG3_PICGU/117-259GAANAAGVTGL..DPEVYSRAYNML-SR-WVDTSLDLYKPELAR.FLYPLFVHCFL...ELVARGHPAHAK..AFLDKFG
Q6PGV3_DANRE/54-195ANVVSAAPCQA..DPQQYENQFSRL-RS-FLQEAEGPLVKEASS.VLFPLFLYLHL...HMARCGLKGALD..SFYSRFH
A4S3V7_OSTLU/9-148DHLLYHAETET..DPRGAASGYATL-RE-WAQNSLDMYKSELCR.VLFPMFAHVLL...DLVKKGYAEDAR..EFYATHH
TAF5_SCHPO/42-184SVEEKLKSIEE..TPDAYTHTYTIL-RD-WVDSSLELYKAELHR.ILFPIFVHSYL...NLLSQDHYEAAK..QFYELFK
Q0CWI4_ASPTN/88-229GRPLPPLGEDA..RP.KYRMGFDLL-KV-WVEDNLDLYKPELRR.VLWPLFVYSFL...NMVTSFYPQEAK..QFFDINK
A7TGM1_VANPO/215-355EHEQKRSIVEI..NERTLTRSYALL-KS-WIDRNLSIYQEHLKNIILFPIFIHTYIKMKKLVKTNTISSSRCEAFYSKYN
A2Q8R6_ASPNC/90-230RPPMPPLGEDA..RP.KYRMGFDLL-KV-WVEDNLDLYKPELRR.VLWPLFVYTFI...NMVSSFKPQDAK..QFFDLNK
Q67UR9_ORYSJ/38-177VSDVALARSEN..DPARYYDGYSKL-RT-WAYSSLDQYKHELLR.VLYPVFIHSFM...DLVAEGHTQEAR..SFFHTFH
Q6CEN7_YARLI/135-279PIPKPPVAKSIHDDTTAIRKGYVML-RN-WTEASLDFYQPELRR.ALYPIFVHCYL...DIIAKGQASEAR..DFFATYS
A6ZLD9_YEAS7/137-278IVSSGRLEGLN..APENYIRAYSML-KN-WVDSSLEIYKPELSY.IMYPIFIYLFL...NLVAKN.PVYAR..RFFDRFS
Q7PZ11_ANOGA/47-186NSVLAAYKSEG..DPDIYENSYMEL-RR-FVEESLDIYKHELAL.ILYPVLVHMYI...ELVYNSHEVQAK..KLITKFG
Q54KH7_DICDI/265-404MYNSSNKGDTS..NPQNYLEQYKKL-GN-WIHSSLDIYKNELLS.ILYPVFVHSYI...DLITKGYPQQAR..ELMEKIG
A7EPZ0_SCLS1/162-304GKPIQERAEDL..GTAKYAKGFRLL-SN-WIESNLDIYKFELRR.ILWPVYVYSFI...ELITSNYASDGK..AFLNEFK
Q9VT91_DROME/308-446NVSLLVIKEDS..VFADYEFAVKKL-IK-LIQSTPSHYKYEIYI.LLYPLLVLTYL...QMMASDKIQKAR..MLLVRFQ
A6R542_AJECN/53-194GRPLPPASEES..RP.KFKLAFDMT-RK-WIEDNLDIYKPELRR.VLWPLFVYSYL...NLITSLVPLEGR..QFFETNK
TAF5L_HUMAN/55-196ANIVSAAPCQA..EPQQYEVQFGRL-RN-FLTDSDSQHSHEVMP.LLYPLFVYLHL...NLVQNSPKSTVE..SFYSRFH
Q6FJL6_CANGA/118-259VVLKDKVRQDM..SPEHYIRAYTML-KN-WVDSSLDIYRSELSY.IMYPVFIYLFL...YLVSKD.PIYAR..RFFDKFS
Q5A6L8_CANAL/179-321KELEKKTKRES..DPEIYFTAYSML-RR-WVGSSLDLYKPELSR.VLYPLYIHCFL...ELISKGFSSEAK..LFFDKFR
Q6S7B0_ARATH/52-191KLIRSFSQQED..DPTRYREGYSKL-RS-WAYNSLDLYKHELLR.VMYPVFIHCYM...DLVGKGHTQEAR..AFFNSFR
Q4SVI5_TETNG/54-195ANIVTAAPCQA..DPQQYETQYARL-RT-FLSETEISWAKEVSC.ILYPLFVYLHL...DMVLCGLKGAVD..GFYSRFH
Q00ZU2_OSTTA/340-479DHLLWRSEQES..DPRFAIAAYAKL-RD-WAHGSLEKYKGELCR.ILFPAFAHVLI...DLVKRGFGEEAR..EFYVEHH
Q9C2E3_NEUCS/92-233GRPAQ.RNEEN..GPRKYLKAFILL-RD-WIENNLDIYKFELRK.LLWPVFVYSYI...ELVSTGYVEEAK..HYLATLR
Q7XB58_ORYSJ/50-168LSDAALSRSEN..DPARYYDGYSKL-RT-WAYSYLDHYKHELLR.ILYPLFFHCFM...DLVAEGHTQEAC..SFFHTFR
A7RZJ8_NEMVE/60-199PNILSLSVNHL..DSSTFDEQFGNL-KS-FILDVNPAYRSELAK.LLFPMFAVCYL...ELIAKGHLISAQ..NFFSKYS
A3M063_PICST/168-310KDLEEKKKREN..DPDVYFTVYSML-KK-WVDTSLDLYKPELSR.VLYPLFIHCFF...ELISKNFVDSGK..RFFDKFK
Q758K7_ASHGO/135-272LVQQAQV......TPQHYFRAYAML-KN-WVDSSLDMYKPELSR.IIYPIFIYVFL...TLVSKA.PVQAR..RFFDKYS
A0JPI3_XENLA/182-321SAVLSAYTQQG..DPTLYEDYYSSL-KR-FIESVLDCHRAELSQ.LFYPLFVHMYL...ELVYNQHEHKAK..SFFDKFH
Q6DE31_XENLA/55-196TNAVSSVPCSA..DAHQYEVQFARL-RN-FLSDADSPQSQEVTK.LLYPLFVYLHL...DMIQNSLKSAVD..SFYSRFH
TAF5_ENCCU/4-142NIRESISAKTL..SKDQMETSYVSL-KT-WIEDSLDLFKNDLLP.LLYPLFIHIYF...DLIQQNKTDEAK..EFFEKYR
TAF73_SCHPO/45-187IPEEQQDWHIG..ASETYVQVYILL-RD-WIDGTLDLYKPKLQK.VLYPIFVHSYL...DLLQKNDPEMAI..YFFESFR
Q2GXG5_CHAGB/85-226GRPAQ.RNDDP..GPKKYLKSFALL-RN-WIENNLDIYKFELRK.LLWPVFVYSYL...ELVGQGYADDAK..HLLDTLR
A7TLK2_VANPO/155-296IIAYEQTIMKT..SPESYLRAYKLL-KE-WVDSSLEMYKTELNF.VLYPIFIYIFL...KLVSTS.PIHAR..AFFDKYS

PF01348

YMF11_MARPO/546-691LANSKRQC--VT-------------------------------RLSYILRTSLAKTYAAKFKLGT---------------
O03089_9ROSI/66-204GSSKKKSM--S.-------------------------------RIKYILRLSCVKTLARKHKS.T---------------
Q35057_MARPO/978-1138CCDNFYKV--KK-------------------------------VVDYQLRWSCLHTLSHKIKAKG---------------
Q35058_MARPO/1090-1229CAHNIWEV--RD-------------------------------LVNYHLRYSLLSTLALKHKS.S---------------
MATK_HORVD/363-502GSSKKRTL--Y.-------------------------------RLKYILRLSCARTLARKHKS.T---------------
O03133_TROAR/92-230GSSKKKSL--Y.-------------------------------RIKYILRLSCARTLASKHKS.T---------------
MATK_SINAL/356-494GSAKKKNL--Y.-------------------------------RIKYILRLCCVKTLARKHKS.T---------------
YMF40_MARPO/355-492FADDIHHL--L.-------------------------------QIIYILRYSAINTVARKLGL.N---------------
Q03979_WHEAT/535-676CCDNLYQV--RT-------------------------------IVNYQIRWSAIFTLAHKHKS.S---------------
MATK_MARPO/220-354GCINKKGL--Y.-------------------------------QLQYIFRFSCAKTLACKHKS.T---------------
Q35062_MARPO/661-802FASNRSSL--N.-------------------------------QIVHVLHMSCALTLALKYKLKT---------------
O03101_9ROSI/151-289GSSKKKSL--Y.-------------------------------RIKYILRLSCVKTLARKHKS.T---------------
MATK_EPIVI/295-434GSSKKNSL--Y.-------------------------------LIKYILLLSCVRTLARKHKS.T---------------
Q33759_ALLMA/562-727FVDNLNAF--HL-------------------------------IINYILVHSCAKTLARKFRLGS---------------
MATK_SAXIN/362-497GSSKKNCL--Y.-------------------------------RVKYILRLSCARTLARKHKS.T---------------
Q02718_PODAN/556-726FVDNKIAF--HS-------------------------------IVNFLIHHSCAKTIARKLNLPN---------------
Q35059_MARPO/1119-1291CADNRWEL--IK-------------------------------IVNWMLRYSLLHTLAHKYNT.T---------------
AI1M_YEAST/602-777LATNYKRL--RE-------------------------------RIYYVLYYSCVLTLASKYRLKT---------------
AI2M_YEAST/638-799LATNFTTL--RG-------------------------------RITYILFYSCCLTLARKFKLNT---------------
LTRA_LACLM/381-549LASNFNQL--N.-------------------------------YFAYLMEYSCLKTIASKHKG.T---------------
Q35056_MARPO/669-811FAGNKRGA--IA-------------------------------YLAYVLRSSLAKMFAAKFKLHS---------------
Q35063_MARPO/700-861CCANFYKV--RD-------------------------------YVDYFLRWSLIHTMAGKHKT.S---------------
YMC6_SCHPO/585-729FVHNRGRF--AT-------------------------------YVYFIIKDCVLRTLAHKLSLGT---------------
Q02717_PODAN/553-721FADNKPRL--V.-------------------------------LIYWILRKSLAKTLATKLKLGT---------------
MATK_PINCO/357-493GSFDRDGL--Y.-------------------------------RIKYILSLSCAKTLACKHKS.T---------------

PF08388

A6DJK4_9BACT/340-418HS..TVYA..MR-------------------------------GIDEFTRRRLRSIIAKYNR..K.......KGS.....
Q8DMT0_THEEB/344-422GQ.VSKET..FN-------------------------------RVDFATWHKLWRWARRRHP..N.......KP......
Q84EW7_LACFE/24-103IA.KIKTF..IS-------------------------------DLDGWLRTRIRQYIWKSWK..S.......VKT.....
A3IQ70_9CHRO/380-459TV.CSKDS..FE-------------------------------TQDHLLFSCLVKWAKRRHP..R......IKS......
Q0HZ96_SHESR/345-423HI.VAKET..FN-------------------------------YVDYRVWKLLWQWCRRRHQ..N.......RQ......
Q4BXG1_CROWT/91-169TV.ISRKA..FG-------------------------------RLYHLIVWKLIKWGIKRHR..N.......KG......
Q118Z9_TRIEI/28-106AI.VSKST..FS-------------------------------KLDMLLWKRIGQWAMRRHP..N.......KL......
A7BUU9_9GAMM/362-442SA.ASKKT..LN-------------------------------WCDNQMFLKLWKWATRRHN..D.....DHKS......
Q8TH39_METAC/313-391LF.YKSEL..YC-------------------------------VL.KHMNRALTRWALRKYK..K...............
A6N5T0_PSEAI/316-394SF.YRTAM..LG-------------------------------IF.QHIDRALERWARRKYK..A...............
A1ZX32_9BACT/379-457PW.HASKS..FS-------------------------------KVKDLLWKRLWRWAKRRHP..K.......KK......
Q92V78_RHIME/332-411LA.QTPRL..FK-------------------------------ELEEWMRHRVRAIQLKHWK..R.......GKT.....
Q1NMW5_9DELT/335-413HV.VSQQA..FD-------------------------------KIDSAIWEMAWKWAVRRHP..N.......KP......
A1T776_MYCVP/353-435TG.NAADK..FR-------------------------------QIDHYVTRRLKELLIKKRG..R...............
Q1XA93_PARBD/411-489LG.NSFHS..RN-------------------------------TVKNAIYHLIWKWAHNKHK..K.......WG......
Q08724_9CYAN/368-446TS.VSKEI..FS-------------------------------KLSHLIYQKLKRWGKRRHP..D.......KS......
A6TN43_ALKMQ/221-299SV.CSKKA..FA-------------------------------LMDHRIWEMLWKWAKRRHP..N.......KN......
Q9F5E4_AGRRH/348-426HV.VAKAT..FS-------------------------------SIDFYIWRMLWRWACRRHP..N.......KG......
A6WZI3_OCHA4/335-414LA.DVKGT..FE-------------------------------EMDGWVHRKLRATLWRQWT..K.......PAA.....
Q94Z25_PYLLI/363-440GSYHSQQS..FQ-------------------------------SIGHYVYQLFWKWAQKKHS..S.......RN......
Q5IX97_9RHIZ/317-395RY.SRSAL..ST-------------------------------LA.DYVNQKLRAWIRRKFK..R...............
A7KG74_KLEPN/317-395HI.IAKVA..YG-------------------------------YVDYRIWQLLWYWCKRRHP..K.......RS......
Q75TN2_BACCS/287-366LV.DTPSI..LA-------------------------------QIDAWIRRRLRMIRWKEWK..T.......TSA.....
Q71EW7_9DELT/175-251TF.YPEPL..RR-------------------------------FL.VRLDLRLGRWARKKYK..T...............
Q5L096_GEOKA/288-367LA.ETPSV..FK-------------------------------ELDGWIRRRLRMCQWKEWK..L.......PRT.....
A6L278_BACV8/349-427YG.TSANV..FH-------------------------------RMDWEIFKKIWQWARRRHP..Q.......KC......
Q121L7_POLSJ/346-425GT.VAKQI..FS-------------------------------KVDSLIYWRLMRWGMRTHP..R.......KT......
Q6LJ59_PHOPR/129-208IA.NCKRE..LK-------------------------------VIACWLRRRLRSIQLKLWK..K.......PQR.....
Q8RSV8_9BACT/289-365RF.RKSEL..SW-------------------------------IF.RHLNIRISKWARNKYK..................
A8MI91_ALKOO/292-371IA.NIKKL..VE-------------------------------KLMGWIRRRLRMIKLKQWK..T.......YKA.....
Q67R28_SYMTH/286-365LS.DARSA..FE-------------------------------RLEGWLKRRLRACVWRQWK..R.......VRT.....
Q4V1Q3_BACCZ/358-436HV.VSKKI..FG-------------------------------TMDSYIYWRIGKHLRQLHP..K.......KS......
Q2BCB5_9BACI/292-371VG.DIKSY..AE-------------------------------DIDKHIRRRLRACLWKQWK..K.......IKT.....
A6L5N4_BACV8/347-425NC.VASDT..FR-------------------------------KADYLIFEKLWQWATRRHP..K.......KG......
Q1VWX8_9FLAO/148-228ISKVTHIWETIK-------------------------------IIKKHLDYKLFKWMKCKGR..........KA......
Q64BS2_9ARCH/304-382SA.VAKEI..FS-------------------------------KLDHIVWDMLWRWAKRRHP..D.......KR......
A4XCB1_SALTO/367-443HA.VAKNV..FS-------------------------------MLDNFIWKRVIRMLIARHR..W...............
B0KBD2_THEP3/339-418LA.DAKSI..MK-------------------------------TLDEWIRRRLRACIWKQWK..K.......IKT.....
Q8RSV7_9BACT/97-174GF.NVTGL..KR-------------------------------AM.RRVNLKLITWVINKYR..R...............
Q7GEU5_CANPA/684-762MG.NSSHY..RD-------------------------------TVRNSLYHLIWRWAHRKHR..R.......WN......
Q4C1M3_CROWT/353-431YCKMDGSRFSLW-------------------------------RTAHRAFKVFNKEKKLNRY..K...............
A5VHP4_LACRD/329-408IG.KLTDF..IQ-------------------------------RLDKWLRARIRQYIWKQWK..K.......LKT.....
Q3F0V4_BACTI/313-390HF.YKSEM..YS-------------------------------VL.RYINSSLIKWVRRKYK..K...............
O99969_PORPU/347-422VC.NATKT..FS-------------------------------FCSMRTFYLLKTWSQKKSR..................
Q2THC8_SHIFL/276-360KF.WSRNF..NY-------------------------------RLWSAMQSRLLKWMQSKYRLSN...............
Q119D3_TRIEI/365-444KV.NSAKT..FK-------------------------------ELDHLLTLKLIAWGKSRHH..H.......KS......
A7N7X0_VIBHB/337-415HC.VAKQV..FG-------------------------------YVGHKLFHTLWHWAKRRHP..T.......KS......
Q8TM71_METAC/31-109HT.VSSEI..FS-------------------------------KLDDTVYNMLISWAKRRHS..N.......KG......
A4BN29_9GAMM/57-135YR.NSSDR..MS-------------------------------KVRYHAEERLRTHLRKRYK..V.......RNR.....
Q7NP80_GLOVI/345-423KV.VSGAT..FK-------------------------------KLDRTLYMQLKAWATSHHR..N.......QS......
A4Y225_SHEPC/252-330SF.CRSEL..YR-------------------------------VF.RQINKALIWWARHKYK..K...............
Q10VN2_TRIEI/308-393HG.VSQRI..FS-------------------------------YVDHEIWKSLWQWSLRRHS..KRVGKQKGKG......
A0L945_MAGSM/330-405IG.NSSRS..FN-------------------------------FVRNWVERKMRRHLMRARV..................
Q94Z24_PYLLI/352-428AT.SAKKV..FT-------------------------------SIGKYVWDKTWTWAKRKHR..Q.......LN......
Q1XGB6_PHYPA/398-476YS.ECNNI..FR-------------------------------RLDHDIFQKIRAWVYRRHP..T.......WG......
Q82RB7_STRAW/349-427TV.CSKET..FN-------------------------------LLDAHTFEVLKRWAMRRHR..R.......KP......
A4VKJ2_PSEU5/358-436TV.VAKQT..FS-------------------------------KLDSLIFWRLWRWAKRRHP..R.......KS......
Q4E6A8_9RICK/143-220HV.CAKRA..FN-------------------------------KIDHEIMCALWKWAKKRY...........RLV.....
A1BAQ8_PARDP/313-391CF.YKSAL..YS-------------------------------TL.RLIDAHLVRWVMRKYK..R...............
A4BSH6_9GAMM/128-208IQ.EFKYL..FR-------------------------------NLDAWIRSRLRSTQLKKWK..................
Q1KVR4_SCEOB/824-902TS.SNQKI..FE-------------------------------YCDSILLKFLWNWARKTHP..N.......KS......
A7Y2S3_VIBCL/293-372IA.NAYQE..CV-------------------------------DLDHWIRRRVRMCYWRQWR..K.......PRT.....
Q1VQF9_9FLAO/318-397KF.KMYEL..TK-------------------------------VF.RLLSKRLVWWARKRYE..R...............
A7V2J4_BACUN/347-425YG.ASTDA..FH-------------------------------GCDNHIYNLTKKWALRRHP..K.......KR......
B4SCG3_PELPB/311-390RF.YGSAM..AP-------------------------------VW.QHMNYYLAHWMMRKYK..Q...............
Q10VN3_TRIEI/334-413KLFVSKKI..FQ-------------------------------DLDNLIFQKLWGWAKRRHP..N.......QN......
A1BGI0_CHLPD/311-387RF.NASAM..KP-------------------------------VW.HHVNLYLTRWLMRKYQ..K...............
Q6EI10_9CHLO/387-465AF.ESNTTGVLT-------------------------------KMDYLMYLKLRKWASRKTG..................
A3IK29_9CHRO/370-448IA.SSSKV..FR-------------------------------RLKNITFWKLWKWGKKRHQ..N.......KG......
A4FC41_SACEN/223-301AF.YRSAL..HP-------------------------------FL.QRINAYLMRWIRKKYK..R...............
A4BSI5_9GAMM/26-104HV.VSKQV..FS-------------------------------DIDHAIWRMTWNWAKRRHP..Q.......KG......
Q9S109_ECOLX/353-430FVDFKAKV..FS-------------------------------YIDRVVFWKLAHWLARKYR..T...............
A0YXC5_LYNSP/95-173PW.NSKEV..FS-------------------------------KLDYLIWNRLWRWAKRRHP..N.......KG......
Q92Y56_RHIME/377-468YCVGAGRV..FV-------------------------------ALDWYIGLRLYCWLHKKRP..K.......ATPSELWG
Q5P179_AROAE/107-185KF.CRSAM..YP-------------------------------VL.RHFNKTLVAWAMKKYR..R...............
Q3B1V7_PELLD/340-418HS.VAKDV..FA-------------------------------RNDHEVWSMLWKWAKRRHP..N.......KG......
Q89TI6_BRAJA/98-173YG.SLATA..HQ-------------------------------AVDRHVFDRVLAFLRRRHK..................
A5CZB8_PELTS/292-371VA.NCKKL..FA-------------------------------QLMEWIRRRLRMKQMKEWK..S.......WRP.....
Q2LRA6_SYNAS/211-289RF.YPSEI..GW-------------------------------IW.KNINGYLIRCVRRKYK..R...............
Q01P79_SOLUE/337-416FC.ETPEV..LI-------------------------------GLTRWVRLRLRAAMWRQWK..T.......PRR.....
A5LLN9_STRPN/155-234LG.NMKSI..VA-------------------------------SIDERLRTRLRVIIWKQWK..K.......KSR.....
Q8YJX0_NOSS1/384-462CV.VSKRI..FN-------------------------------QADTTLFSQLKAWAEHRHP..N.......KS......
Q81ZI4_NITEU/301-380IS.QYYRP..IP-------------------------------ELDEWIRRRVRMCYWKQWR..W.......ART.....
A3ITJ4_9CHRO/375-453TV.ASKET..FS-------------------------------SEDHILWNMLRAWAISRVK..K.......GS......
Q024N3_SOLUE/339-417FG.YPISV..YY-------------------------------ELDRYVQGRLIQHLQRRSQ..R.......PYR.....
Q4BZL5_CROWT/73-152TV.TSRET..FS-------------------------------SEDSILWNTLRAWTVNRKK..K.......ETP.....
Q2SF99_HAHCH/347-425HQ.VASDA..FA-------------------------------RVDAQLWHALWRWARRRHS..K.......KG......
Q0VRW5_ALCBS/345-423HV.VSKAT..FN-------------------------------YVDYRIWKMLWQWCRRRHL..N.......RR......
Q64A80_9ARCH/299-377SF.YKSAL..YP-------------------------------IL.RHLNRILVRWAMRKFK..R...............
Q0RWF2_RHOSR/343-419YA.VAKSV..LQ-------------------------------SLAIFVWHRIARWWIRLHR..W...............
Q9AMP0_PSEAC/333-396LS.QSKRP..VE-------------------------------ELDGWVRRLLRNVL.......................
Q4MP10_BACCE/356-434PV.VAKVI..YG-------------------------------DIDSYVHKKVMHHLKYKHH..R.......KG......
Q2JAX6_FRASC/343-420YG.YSARR..LA-------------------------------MIRRFAQVRLARFVRARHR..R...............
A0YYL7_LYNSP/367-444KV.VSKKT..FS-------------------------------SLDNIRWQRLRAWTVSRCG..........KA......
Q7UY81_RHOBA/354-431HC..TWNI..FD-------------------------------KYDGMVRKRLRRQLLKRHR..R.......N.P.....
A6TTG9_ALKMQ/237-315KY.NASAI..KY-------------------------------TL.DCVERRIVKWAMCKFK..N...............
Q11ZP2_POLSJ/335-414LA.QTPQT..FK-------------------------------DLDSWTRHRLRAIQLKHWR..V.......GTT.....
A5ZS99_9FIRM/8-87IG.SILTV..SR-------------------------------KLDTVIRYRFRMCIWKHWK..N.......PKT.....
A3IVC5_9CHRO/352-437HG.VSSRS..FN-------------------------------YFDHRMVKMLIKWAKKRHP..N.......KG......
A4YPB0_BRASO/18-96FC.ETPSV..LR-------------------------------KLDEWIRRRLRAVVWTQWK..H.......GRT.....
A4G3U3_HERAR/349-427PV.VAKET..FS-------------------------------RIDHLLFWRLMRWAKRRHP..K.......KN......
Q1D1V6_MYXXD/324-399WG.NSYQA..LD-------------------------------RVKHHVELKVRRFAAKRAK..................
Q1NNY7_9DELT/350-429YG.YPRMA..FK-------------------------------KIDWFVQNRFRRFIRTRSQ..R.......RCQ.....
A6TKY0_ALKMQ/313-390KF.TASKV...H-------------------------------AILSCVNLSLARWMMKKSK..R......YKN......
A6X7I7_OCHA4/354-431FTDFTAYV..FR-------------------------------RIDHVVFWKMAHWLGHKYR..S...............
Q3M1M1_ANAVT/413-491IG.VSSRA..FS-------------------------------KADFLTYQKLRAWATNRCT..H.......SS......
A6TVZ8_ALKMQ/227-305HV.CAKKT..FQ-------------------------------TLDKNIFRYLWLWAKRRHP..M.......KP......
B4S5R5_PROA2/311-390KF.HGSAM..SV-------------------------------IW.RHMNMYLARWLMRKYK..H...............
Q89BF9_BRAJA/341-418QG.PVVET..YN-------------------------------LIRQYVDRRLRHWLVQRTG..A...............
A9BGC0_PETMO/340-419IA.NMKSV..AG-------------------------------SLDGWLRRRIRMCIWKEWK..K.......IKT.....
Q5ZWK4_LEGPH/357-435HI.VAKET..FT-------------------------------KVDHFIWRSLRCWACRRHP..N.......KN......
A5G3H6_GEOUR/335-414YA.EVKGI..FE-------------------------------ELDGWLRRKLRRILWKQWK..R.......PKT.....
A6TNL0_ALKMQ/222-301HA.VASHA..FS-------------------------------YINNILYLLLQRWVKHRHP..N.......KN......
Q6WFV8_EUGMY/378-464KS.DANTMGLLG-------------------------------QMDYLLYLKIRKWAKRIYK..T.......TG......
A9B272_HERA2/344-422HV.VSKAV..FQ-------------------------------SMGHAIYQALWRWAKRRHA..N.......KP......
Q9AMW9_BRAJP/312-391RF.YPTEL..RR-------------------------------LY.EYFDERLGAWLRCKYK..Q...............
A7BYN3_9GAMM/297-375YV.QSWET..MS-------------------------------HLENWLWGKLKRWTMRRHP..L.......KG......
Q7YAJ7_CHAVU/296-374FS.ECSAI..FH-------------------------------RMDFRIFQQLRAWVFRRHP..T.......WG......
A6FZM7_9DELT/259-338LT.ESRWG..FR-------------------------------DVEGWIRRRVRCLILYQYR..T.......PRR.....
A5IEI2_LEGPC/352-430KY.SRSSM..YR-------------------------------VW.RCVNNMLLAWAKKKYK..T...............
A6EY09_9ALTE/319-396AA.EVLSP..LR-------------------------------DLDKWIRRRMRSYVWKQWG...........RS.....
Q0S063_RHOSR/344-424YG.NSAHR..FG-------------------------------VIREYVRMRMALFIGKRHK..R.......SRS.....
B4S633_PROA2/313-392VF.YKSAL..YP-------------------------------TL.RHIDRKLTLWATRKFK..R...............
A4JUE6_BURVG/312-391FC.ETPSV..LK-------------------------------QLDEWIRRRLRCFFWKQWK..R.......GRT.....
A3IWI4_9CHRO/365-443AV.CSKTT..YS-------------------------------KLDHLLWLKLFRWALRRHP..Q.......KS......
A0YT41_LYNSP/64-142SV.VSAET..FS-------------------------------DCDHCFFEKLKRWAYRRHP..M.......KN......
Q93PB4_9BACT/329-408SA.KMLSK..LQ-------------------------------RLSSWIHRRIRCFRLKQCK..R.......AIG.....
A5FDH6_FLAJ1/334-413LA.DMSNK..IK-------------------------------RIDEWLRFRIRMLIWKSWK..K.......IST.....
A3WXE2_9BRAD/317-397HCYGAKQV..FA-------------------------------RIDHYAWDRLRRWLRKKYP..K........TP.....
Q877J2_PSESM/334-413LS.QAPGL..WK-------------------------------SLDGWIRRRLRAIQLKQWK..T.......GKT.....
Q1LRT7_RALME/348-426PV.VAKEA..FS-------------------------------KMQSRVFRALLWWTKRRHR..G.......KN......
Q8A4I2_BACTN/337-416LA.QMKRL..CI-------------------------------ETDEWLRRRIRMCIWKSWK..N.......AKT.....
Q24WW9_DESHY/303-382LA.DAKSQ..LK-------------------------------EIDEWMRSRIRMVAWKQWK..R.......IRS.....
Q5ZTU1_LEGPH/340-418KV.VSKAT..FS-------------------------------ELDNYIYQETFRWTMRKFS..G.......HN......
Q4C1I8_CROWT/375-452RV.SSYGV..FS-------------------------------KLDQMIASKLRAWIKTRTG..G.......TG......
A7LY43_BACOV/347-425HG.ATRDS..FH-------------------------------RIDHQIFLALWQWAKRRHS..K.......KG......
A0YTU1_LYNSP/380-458SQ.VSKVA..YK-------------------------------KLDYLLYQKLETWANSRHP..N.......KG......
A8KXN1_FRASN/320-396MF.YPSVV..LP-------------------------------IG.TRIDSHLVRWARKKYK..R...............
A0YZ77_LYNSP/366-429TV.CSKET..FI-------------------------------DTPAA........................KS......
A5ZWA2_9FIRM/335-416TR.NDRKW..MR-------------------------------AIDWYILCTFCRWNNKKRQ..................
Q4C6J4_CROWT/338-415VV.CSGKI..FS-------------------------------KIDHLLWCKLRAWTVNRTG..........KA......
Q8YLU0_NOSS1/360-436FCDMSQHN..LW-------------------------------AIAYWTWKFIRKQGRYNRD..Q...............
Q8TMH8_METAC/132-210HI.VAKNA..FK-------------------------------KLDHYLWRVTWQWGKRRHP..N.......KG......
Q73IV1_WOLPM/33-111SV.VSCKI..FS-------------------------------SLDNTIHRKLWKWAVFRHP..N.......KG......
A3ESY4_9BACT/349-427HI.VAKTT..FG-------------------------------KVDSTLWSLLWSWLKRRHP..G.......KG......
A0LB55_MAGSM/355-433HV.VSGRV..FA-------------------------------RVDHAIWQAIWAWAVRRHP..K.......KS......
A6DUJ5_9BACT/111-190VA.NCKKL..FE-------------------------------ELMAWIRRRLRSKQMKLWK..K.......PAK.....
A0YQ93_LYNSP/350-428HG.VSSEV..FS-------------------------------YVDHQIFQAIWRWSLSRHP..N.......KG......
Q6ED59_CANZE/334-409HV.SSSNV..FR-------------------------------YTRYQMHQCTLSWGMKKLH..T.......HS......
A0YP84_LYNSP/369-447TV.CSKKS..YA-------------------------------EQDHQMYQKLRAWARFRHL..K.......KS......
A7BMD0_9GAMM/46-124SV.VSKET..FS-------------------------------QIDHYTFECIWKWATKRHS..N.......KG......
Q1XGD2_PHYPA/395-473IG.NFLRT..FS-------------------------------LLDHWIWHRSWRYLHRKFS..K.......TP......
B7WSG4_COMTE/349-427PV.VAKET..FS-------------------------------RMDSLIYWRLVRWTRRRHP..N.......KS......
A0LN71_SYNFM/335-414LS.EVKGN..FE-------------------------------ELDEWIRRKFRCIIWRQWK..R.......TYT.....
Q8A4Z2_BACTN/144-223YA.DMRSL..LI-------------------------------PLDQWYRRHLRMCIWKCWK..R.......VKT.....
A0L6Q1_MAGSM/246-325RF.CRSEM..HS-------------------------------VL.DRINTALAFWAMRKFK..K...............
Q2FSK1_METHJ/343-421TV.SASMT..FG-------------------------------KLDWVVRNMLWRWAKRRHN..N.......KG......
Q8A4I4_BACTN/315-393KF.YPTRL..KW-------------------------------FM.QTLNGRLARWVMCKFE..R...............
A4BP43_9GAMM/119-196VG.NASRA..FS-------------------------------EVRDYVEMKVRTLLTRRKR..RQ..............
Q12UG1_METBU/382-460GV.ASKET..FS-------------------------------LIDFKIWNILWKWAKRRHP..M.......KS......
A0YP86_LYNSP/368-446AI.PSSKT..FY-------------------------------RLDFLVYQKLRAWAKHRHP..S.......KS......
Q1VZ87_9FLAO/317-395KV.SRRSL..QP-------------------------------VF.YYLHNRMIRWILNKYK..R...............
Q97DG3_CLOAB/341-420IA.EMTKL..AK-------------------------------KLDEWTRRRLRMCYWKQWK..K.......VKT.....
Q6DKY2_GEOSE/289-368LV.ETPSV..LQ-------------------------------TIEGWIRRRLRLCQWLQWK..R.......VRT.....

PF04494

Q0TXM2_PHANO/12-154NLFERDHE--ED..IKSLRQVRLPVHLTESRVAKLYQDNKYRLTMTKIPFFNLIQFLESKVH--D---------------
Q6BLE6_DEBHA/159-301GDHVMLHG--LE..INKLAGISLPEHLKENELAQAYRNNKYRIIVSKTSINLLLYFLHENEA--V---------------
Q28YL4_DROPS/95-236SDLDGYYI--EG..LFNLLLLTKPEELLDNDLVVAMEMDKFVIRMSRDSHSLFKRHIQDRRQ--E---------------
A5DCG3_PICGU/117-259GDHQLLHG--SE..VSKLAGISLPEHLRENELATAYRTRRYRLVVSKTSKNLVLYFLHENDA--V---------------
Q6PGV3_DANRE/54-195SLFQQDPE--QKAIVDLLRGALTLQDVTTNPKLCALLDHKYVVHLTDQAYSYLLRYLQSEDN--S---------------
A4S3V7_OSTLU/9-148ADHMRLYG--ED..LAALSALSDPEHVLTDPVARKFLDNKVSLKMTQYSFELLVKFLHAQNL--I---------------
TAF5_SCHPO/42-184DDHTDLHD--FD..VKNLKSLSLPSHVAEDRTAQQYRQNKYQLHFSRITFDLLLHFLFENVS--N---------------
Q0CWI4_ASPTN/88-229NLFLPEHT--ED..VRALEPISLPEHVQDNSTAKLYRNNKYRLVLSNPAFSNLMQFLESKPK--E---------------
A7TGM1_VANPO/215-355EFTSNGTN--KD.TIEALHKLVSDIDEE.........DFKYVVIVSGRLFYPLLTHILENEM--I---------------
A2Q8R6_ASPNC/90-230NLFLPEHT--ED..VRALEPISLPEHVQANSTAKLYRTNKYRLVLSNPAFSNLMQFLESKQK--E---------------
Q67UR9_ORYSJ/38-177EDHELMHS--RD..LQKLEGILSPSHLEEMELARSLRKNQFRIKLCEYSYELLLQYLQKTQA--L---------------
Q6CEN7_YARLI/135-279GDHAVLHG--HD..LQKLSGISLPDHIPSNELAQKFRSSKYRLNISRTVFDLLFYFLQEHDS--T---------------
A6ZLD9_YEAS7/137-278PDFKDFHG--SE..INRLFSVNSIDHIKENEVASAFQSHKYRITMSKTTLNLLLYFLNENES--I---------------
Q7PZ11_ANOGA/47-186PEQEYYYQ--DE..LAKLAMVTKRDEMSGNDITDTFKSNAFTIRISRDTLSLLKRHLHEKKA--S---------------
Q54KH7_DICDI/265-404PDHEEYFG--DD..LKLLRGISNTDHLKENELVDLFRNNRWNIKMCAYSFELLMSFLHQSNF--I---------------
A7EPZ0_SCLS1/162-304DQFQQVHA--DE..LTTFETISLPQQINDNTITKLYLSSKYRIPLNTHVYYNLMTHLESNSK--Q---------------
Q9VT91_DROME/308-446DHLDDSYI--SR..IIKLREISKPAEVPNKARKLLAGLEKVKIEMSEGAFRQLLLCTEEWTR--G---------------
A6R542_AJECN/53-194SLFLPEHS--ED..IRALEPISLPEHVQENSVAKLYRNNKYRLTLSNPAFSNLMQFLESKQK--E---------------
TAF5L_HUMAN/55-196GMFLQNAS--QKDVIEQLQTTQTIQDILSNFKLRAFLDNKYVVRLQEDSYNYLIRYLQSDNN--T---------------
Q6FJL6_CANGA/118-259SDFRVKHG--SE..INRLFSVNSVDHIKENEVAKAFNGNRYRVTISRAAFYLMLYFLTDNEG--V---------------
Q5A6L8_CANAL/179-321SDHLVLHG--IE..VEKFAGLSLPEHLEENDLAVAYRKYKYRILVSKTSLNLLIYFLHENEA--V---------------
Q6S7B0_ARATH/52-191KDHEMVHL--RD..LQKLEGVLSPSHLEEMEFARSLRKSKVNIKFCQYSYELLLQYLHSTVS--T---------------
Q4SVI5_TETNG/54-195GAFLQDSE--QRATIEQLRHVLTAQDIAANSKLSALLEHKYVVHMTEPAYSYLLRYLQSEDN--S---------------
Q00ZU2_OSTTA/340-479ADHMRLYG--ED..LAALSALSEPEHIESDPIARKFLENKASVRMTSYSFDLLVKFLHANDL--M---------------
Q9C2E3_NEUCS/92-233PHFDAVHR--EA..LDLFTTVTLPQHIRENQTIKLYRENKYRIPLNQSLSGNLFHFLEREAD--A---------------
Q7XB58_ORYSJ/50-168EDHE..HS--RD..LKKLESILSPLHLE...................YSYELLLQYLHKTQA--L---------------
A7RZJ8_NEMVE/60-199GDLALEHK--ED..IQHLQAITDSERLKSSDIAANFRRSKYVLRLSSKVFTYFMQYLRSSDR--V---------------
A3M063_PICST/168-310SDHIILHG--VE..INQLAGISLPEHLKENELALAYRRNKYKIVVSKTSMNLLLYFLHENEA--V---------------
Q758K7_ASHGO/135-272EDYKALHG--TE..INKLFSVNSVDHIKENELAQGFQSNKYRVTISRTTLNLLLYFLNENES--V---------------
A0JPI3_XENLA/182-321GDQECYYE--DD..LRILASLTKKEHMKGNETILDFRTSKFVLRISRDSYQLLKRHLQERQN--N---------------
Q6DE31_XENLA/55-196GMFVQYPG--QKDIVEQLQTTMTMQDIHSNCKLRAFLDNKYVVCLQEDSYHYLLRFLQSDNN--T---------------
TAF5_ENCCU/4-142GDHYN.KS--EE..IKQFESIYTVQHIHENNFAYTFKNSKYHLSMGRYAFDLLINFLEERNL--T---------------
TAF73_SCHPO/45-187IEHEVLHG--YD..IRALAQLKIASDVEEIEIAQLYRKNKYRINFTRSTFDLLVQFLFENEV--N---------------
Q2GXG5_CHAGB/85-226PQFDAVHQ--DA..LALLATVTLPQHVEENQTTRLYRENKYRIPLNQSLSGNLFHFLERESD--E---------------
A7TLK2_VANPO/155-296TDFRVLHG--TE..INRLFSVNSVDHIKENELANAFQSNKYRVTISKTTLNLLLYFLNEHES--S---------------

PF01348

YMF11_MARPO/546-691-----AAKVFAK-----GG................RDLSKPIKAKKARRPLLN.........RVLGSKTTAHRRRG....
O03089_9ROSI/66-204-----VRAFLKR-----LG................SELF.EEFFTEEEEF............LSLIFPRTSLSLRR....
Q35057_MARPO/978-1138-----VGKVIDK-----YTHELR..........VETAKGPRVYFPTPTELRVMG.....KQFLVKSIKDPERILGLMFLR
Q35058_MARPO/1090-1229-----ISGIIRG-----YG................KAPKIRTINEKSQES..............TEFPTVHRVNSTR...
MATK_HORVD/363-502-----VRTFMQR-----LG................SAFL.EEFFTEEEQV............FSLMFTKTTLFSFSG...
O03133_TROAR/92-230-----VRAFLKR-----FG................SELL.EEFLTEEEQV............LSLIFPKISSTSQR....
MATK_SINAL/356-494-----VRAFLKR-----LG................SGLL.EEFLTGEDQV............LSLIFPRSDYASKR....
YMF40_MARPO/355-492-----TAKVIKR-----FG................VDLIFRDHTNEIKHK..............LNFPRSLPNKRMN...
Q03979_WHEAT/535-676-----ARNIILK-----YP..............KDSNIVNQEGGKTLAEFP.............NSIELGKLGLGQ....
MATK_MARPO/220-354-----IRTVWKK-----YG................SNLLTSSIFFNKTKL............ISLNFSNKNPYKKN....
Q35062_MARPO/661-802-----ASKTFNR-----FG................KCLTCPATGMSLFRP..............SAYKAIHLYNPS....
O03101_9ROSI/151-289-----VRTFLKR-----LD................SELL.EDFFTAEEQI............LSLIFPRASSPSRR....
MATK_EPIVI/295-434-----VRTFAFQ-----KKR.............LCLELL.EGFFISEEDI............LFLKFQKVYSSLGG....
Q33759_ALLMA/562-727-----RAGAFKK-----FGGDL..AAPA..PSPQDKPLGLNLKKSYAKTNKFN.....IKTSYRDPTEVLNWSLRT....
MATK_SAXIN/362-497-----VRAFLKR-----LG................SGLL.EEFLTEDD...............SLIFPRTSSPLWR....
Q02718_PODAN/556-726-----RAQAFNK-----FGRYL..TAPG...EGKLKPMELFTLDSFKKTTSLLK...SYVTNPVDPFTITNWSLRTQ...
Q35059_MARPO/1119-1291-----VSKIMGV-----YSKSPKVFIEA....ENPGEYSMLTGFPTPLEINTRRKEFLVSGDETPESLEKLLDDRRTLLT
AI1M_YEAST/602-777-----MSKTIKK-----FGYNL..NIIE..NDKLIANFPRNTFDNIKKIENHGMFMYMSEAKVTDPFEYIDSIKYMLPTA
AI2M_YEAST/638-799-----VKKVILK-----FG.............KVLVDPHSKVSFSIDD.FKIRHKMNMTDSNYTPD.EILDRYKYMLPRS
LTRA_LACLM/381-549-----LSKTISM-----FKDGSGSWGIPYEIKQGKQRRYFANFSECKSPYQFT........DEISQAPVLYGYARN..TL
Q35056_MARPO/669-811-----LKKVFQI-----AG................NDLGRALEARYPVGVT............DSQVEAWQQSVSG....
Q35063_MARPO/700-861-----ATKLIRA-----LSIDMVIKDNE..GEKIISFLSSNEIRRMGRMFLRG....IPCDSDMRTLDRIYATFRR....
YMC6_SCHPO/585-729-----RMKVIKK-----FG................PDLSIYDYNSRDENN.........KPKLITQLFKPSWKVNV....
Q02717_PODAN/553-721-----VRKVYLK-----FGVNLRFEILG..TDNKSIEFTKGNLLPTPKNFKG.......KTNFVDNLKVVEWSLRT....
MATK_PINCO/357-493-----IRVVRKE-----LG................PELF.KKSFSKEREF............DSLPFSSKAAARSQ....

PF08388

A6DJK4_9BACT/340-418.....HRMIDTR.....KY-------------------------------------------------------------
Q8DMT0_THEEB/344-422.....AQWVKDK.....YF-------------------------------------------------------------
Q84EW7_LACFE/24-103.....RFKNLMK.....FG-------------------------------------------------------------
A3IQ70_9CHRO/380-459.....WKKVKNK.....YW-------------------------------------------------------------
Q0HZ96_SHESR/345-423.....KRWIKAK.....YF-------------------------------------------------------------
Q4BXG1_CROWT/91-169.....KKWVYLK.....YF-------------------------------------------------------------
Q118Z9_TRIEI/28-106.....AKWVKKK.....YF-------------------------------------------------------------
A7BUU9_9GAMM/362-442.....KRWIKNK.....YF-------------------------------------------------------------
Q8TH39_METAC/313-391.....LSGHKRRA..RY.W-------------------------------------------------------------
A6N5T0_PSEAI/316-394.....LHRRKRRI..SQ.W-------------------------------------------------------------
A1ZX32_9BACT/379-457.....LPWIKKK.....YF-------------------------------------------------------------
Q92V78_RHIME/332-411.....TYKALLA.....KG-------------------------------------------------------------
Q1NMW5_9DELT/335-413.....SKWIKTK.....YF-------------------------------------------------------------
A1T776_MYCVP/353-435.....NLRAGQADQWTEEW-------------------------------------------------------------
Q1XA93_PARBD/411-489.....KKLIAKT.....YL-------------------------------------------------------------
Q08724_9CYAN/368-446.....NVWVTKK.....YW-------------------------------------------------------------
A6TN43_ALKMQ/221-299.....KHWIKDK.....YW-------------------------------------------------------------
Q9F5E4_AGRRH/348-426.....ARWIRRR.....YF-------------------------------------------------------------
A6WZI3_OCHA4/335-414.....RARNLMQ.....RG-------------------------------------------------------------
Q94Z25_PYLLI/363-440.....KQWIYDR.....YI-------------------------------------------------------------
Q5IX97_9RHIZ/317-395.....FQSHKTRA..SL.F-------------------------------------------------------------
A7KG74_KLEPN/317-395.....KYWIKEK.....YF-------------------------------------------------------------
Q75TN2_BACCS/287-366.....RQKNLVR.....LG-------------------------------------------------------------
Q71EW7_9DELT/175-251.....LRRRKQRS.....W-------------------------------------------------------------
Q5L096_GEOKA/288-367.....RVRKLQS.....LG-------------------------------------------------------------
A6L278_BACV8/349-427.....KGWVKDK.....YF-------------------------------------------------------------
Q121L7_POLSJ/346-425.....AGWVYGH.....YW-------------------------------------------------------------
Q6LJ59_PHOPR/129-208.....LHRWLKQ.....QG-------------------------------------------------------------
Q8RSV8_9BACT/289-365.....LKTYSKSY....GW-------------------------------------------------------------
A8MI91_ALKOO/292-371.....MHKDMRK.....EG-------------------------------------------------------------
Q67R28_SYMTH/286-365.....RFRELRA.....LG-------------------------------------------------------------
Q4V1Q3_BACCZ/358-436.....WKWIYAR.....YY-------------------------------------------------------------
Q2BCB5_9BACI/292-371.....KYKNLRK.....LG-------------------------------------------------------------
A6L5N4_BACV8/347-425.....KYWIADR.....YF-------------------------------------------------------------
Q1VWX8_9FLAO/148-228.....HRKLRQR.....PY-------------------------------------------------------------
Q64BS2_9ARCH/304-382.....NTWVANR.....YW-------------------------------------------------------------
A4XCB1_SALTO/367-443.....SWTDVRR.....HF-------------------------------------------------------------
B0KBD2_THEP3/339-418.....KHDNLVK.....LG-------------------------------------------------------------
Q8RSV7_9BACT/97-174.....FRRKPRKL....AW-------------------------------------------------------------
Q7GEU5_CANPA/684-762.....RHAIAKT.....YF-------------------------------------------------------------
Q4C1M3_CROWT/353-431.....ASELIKK.....AF-------------------------------------------------------------
A5VHP4_LACRD/329-408.....KVTNLQK.....LG-------------------------------------------------------------
Q3F0V4_BACTI/313-390......RKHRRKA..EY.W-------------------------------------------------------------
O99969_PORPU/347-422.....SGTKVSK.....HW-------------------------------------------------------------
Q2THC8_SHIFL/276-360.....RKAQRKLTLVRKEY-------------------------------------------------------------
Q119D3_TRIEI/365-444.....IKETIKK.....YF-------------------------------------------------------------
A7N7X0_VIBHB/337-415.....RTWIALK.....YF-------------------------------------------------------------
Q8TM71_METAC/31-109.....LTWIMTK.....YW-------------------------------------------------------------
A4BN29_9GAMM/57-135.....MAGLVK.......F-------------------------------------------------------------
Q7NP80_GLOVI/345-423.....QKWLARK.....YW-------------------------------------------------------------
A4Y225_SHEPC/252-330.....LQRRKTRA..GQ.F-------------------------------------------------------------
Q10VN2_TRIEI/308-393.....KEWVRKK.....YF-------------------------------------------------------------
A0L945_MAGSM/330-405.....RRGFGWN.....RW-------------------------------------------------------------
Q94Z24_PYLLI/352-428.....FRDLAKL.....YY-------------------------------------------------------------
Q1XGB6_PHYPA/398-476.....RDKIKQK.....YF-------------------------------------------------------------
Q82RB7_STRAW/349-427.....WGWIKRR.....YW-------------------------------------------------------------
A4VKJ2_PSEU5/358-436.....ADWIRKK.....YF-------------------------------------------------------------
Q4E6A8_9RICK/143-220.....SQQKSHK.....NS-------------------------------------------------------------
A1BAQ8_PARDP/313-391.....FKQRPRQA..RL.W-------------------------------------------------------------
A4BSH6_9GAMM/128-208.....KPGKFQRVMIRAGF-------------------------------------------------------------
Q1KVR4_SCEOB/824-902.....KSWIRKK.....YF-------------------------------------------------------------
A7Y2S3_VIBCL/293-372.....KVQNLLK.....RG-------------------------------------------------------------
Q1VQF9_9FLAO/318-397.....YKTSIRKG..YKWL-------------------------------------------------------------
A7V2J4_BACUN/347-425.....KSWVADK.....YW-------------------------------------------------------------
B4SCG3_PELPB/311-390.....LSGHKTRA..SRKL-------------------------------------------------------------
Q10VN3_TRIEI/334-413.....NHWIYQK.....YW-------------------------------------------------------------
A1BGI0_CHLPD/311-387.....YAGRLKRA.....V-------------------------------------------------------------
Q6EI10_9CHLO/387-465.....SANTSTR.....YW-------------------------------------------------------------
A3IK29_9CHRO/370-448.....RKFVKNK.....YF-------------------------------------------------------------
A4FC41_SACEN/223-301.....LRQSKKAK..AC.W-------------------------------------------------------------
A4BSI5_9GAMM/26-104.....QRWIKDR.....YF-------------------------------------------------------------
Q9S109_ECOLX/353-430.....GIASLMR.....WW-------------------------------------------------------------
A0YXC5_LYNSP/95-173.....KKWIARK.....YW-------------------------------------------------------------
Q92Y56_RHIME/377-468SKQPSRRRATRR.....VW-------------------------------------------------------------
Q5P179_AROAE/107-185.....LKGHKIRA..AR.F-------------------------------------------------------------
Q3B1V7_PELLD/340-418.....LRWIMDK.....YF-------------------------------------------------------------
Q89TI6_BRAJA/98-173.....TPGRGVR.....RF-------------------------------------------------------------
A5CZB8_PELTS/292-371.....LHKALRR.....RG-------------------------------------------------------------
Q2LRA6_SYNAS/211-289.....FASHKKQA..RC.Y-------------------------------------------------------------
Q01P79_SOLUE/337-416.....RRAALLE.....LG-------------------------------------------------------------
A5LLN9_STRPN/155-234.....RLWGLLK.....LG-------------------------------------------------------------
Q8YJX0_NOSS1/384-462.....SRWSCQK.....YW-------------------------------------------------------------
Q81ZI4_NITEU/301-380.....KIRHLLD.....LG-------------------------------------------------------------
A3ITJ4_9CHRO/375-453.....TKKKLRK.....YF-------------------------------------------------------------
Q024N3_SOLUE/339-417.....PPQGES.......W-------------------------------------------------------------
Q4BZL5_CROWT/73-152.....LYDALKK.....YF-------------------------------------------------------------
Q2SF99_HAHCH/347-425.....KRWIASR.....YW-------------------------------------------------------------
Q0VRW5_ALCBS/345-423.....KRWVKNK.....YF-------------------------------------------------------------
Q64A80_9ARCH/299-377.....FRRHRRRA..EY.W-------------------------------------------------------------
Q0RWF2_RHOSR/343-419.....SWTDLRR.....HL-------------------------------------------------------------
Q9AMP0_PSEAC/333-396.................CG-------------------------------------------------------------
Q4MP10_BACCE/356-434.....ARWINKK.....YF-------------------------------------------------------------
Q2JAX6_FRASC/343-420.....SMGFGWR.....VL-------------------------------------------------------------
A0YYL7_LYNSP/367-444.....SYDQLKK.....YF-------------------------------------------------------------
Q7UY81_RHOBA/354-431.....QRLCRTH.....RW-------------------------------------------------------------
A6TTG9_ALKMQ/237-315.....FRGHRRRA...EKW-------------------------------------------------------------
Q11ZP2_POLSJ/335-414.....VYSRLRS.....LG-------------------------------------------------------------
A5ZS99_9FIRM/8-87.....RYKNLVK.....LG-------------------------------------------------------------
A3IVC5_9CHRO/352-437.....SEWVVPR.....YF-------------------------------------------------------------
A4YPB0_BRASO/18-96.....RFDELQR.....RG-------------------------------------------------------------
A4G3U3_HERAR/349-427.....ADWIRQR.....YW-------------------------------------------------------------
Q1D1V6_MYXXD/324-399.....RGGFGWK.....RW-------------------------------------------------------------
Q1NNY7_9DELT/350-429.....HLDGKSQ.....YH-------------------------------------------------------------
A6TKY0_ALKMQ/313-390.....KFMAALR.....RL-------------------------------------------------------------
A6X7I7_OCHA4/354-431.....RIKPLMR.....KW-------------------------------------------------------------
Q3M1M1_ANAVT/413-491.....KHEIANK.....YW-------------------------------------------------------------
A6TVZ8_ALKMQ/227-305.....KKWRKSK.....YF-------------------------------------------------------------
B4S5R5_PROA2/311-390.....LAGHKTRA..TKAL-------------------------------------------------------------
Q89BF9_BRAJA/341-418.....RGRGFNR.....YS-------------------------------------------------------------
A9BGC0_PETMO/340-419.....KHENLVK.....LG-------------------------------------------------------------
Q5ZWK4_LEGPH/357-435.....LRWVKQR.....YY-------------------------------------------------------------
A5G3H6_GEOUR/335-414.....RAKKLMR.....RG-------------------------------------------------------------
A6TNL0_ALKMQ/222-301.....QWWRLHR.....YW-------------------------------------------------------------
Q6WFV8_EUGMY/378-464.....KARAVFRRVGNNKW-------------------------------------------------------------
A9B272_HERA2/344-422.....KRWIKEK.....YF-------------------------------------------------------------
Q9AMW9_BRAJP/312-391.....LKGHRGRS..LRKL-------------------------------------------------------------
A7BYN3_9GAMM/297-375.....TRWIMKK.....YF-------------------------------------------------------------
Q7YAJ7_CHAVU/296-374.....RQRIKHK.....YF-------------------------------------------------------------
A6FZM7_9DELT/259-338.....AYRALRA.....LG-------------------------------------------------------------
A5IEI2_LEGPC/352-430.....LGRSRTKA..GK.L-------------------------------------------------------------
A6EY09_9ALTE/319-396.....GYRELRK.....RG-------------------------------------------------------------
Q0S063_RHOSR/344-424.....FGWHVVA.....YA-------------------------------------------------------------
B4S633_PROA2/313-392.....LKGHRRRA..THVL-------------------------------------------------------------
A4JUE6_BURVG/312-391.....RFRELVA.....RG-------------------------------------------------------------
A3IWI4_9CHRO/365-443.....KHWVVNK.....YW-------------------------------------------------------------
A0YT41_LYNSP/64-142.....RTWIMRK.....YW-------------------------------------------------------------
Q93PB4_9BACT/329-408.....ITRFLVS.....LG-------------------------------------------------------------
A5FDH6_FLAJ1/334-413.....KYNNLKK.....IG-------------------------------------------------------------
A3WXE2_9BRAD/317-397.....RLVIRRR.....YW-------------------------------------------------------------
Q877J2_PSESM/334-413.....TYRELRK.....LG-------------------------------------------------------------
Q1LRT7_RALME/348-426.....AEWVRKK.....YF-------------------------------------------------------------
Q8A4I2_BACTN/337-416.....RVANLKK.....CG-------------------------------------------------------------
Q24WW9_DESHY/303-382.....RYDYLKK.....AG-------------------------------------------------------------
Q5ZTU1_LEGPH/340-418.....RYKAMDR.....YF-------------------------------------------------------------
Q4C1I8_CROWT/375-452......KTEMSL.....YF-------------------------------------------------------------
A7LY43_BACOV/347-425.....KRWIKDR.....YW-------------------------------------------------------------
A0YTU1_LYNSP/380-458.....KRWVANK.....YW-------------------------------------------------------------
A8KXN1_FRASN/320-396.....LTRSERRA.....W-------------------------------------------------------------
A0YZ77_LYNSP/366-429.....KIITGDS.....SF-------------------------------------------------------------
A5ZWA2_9FIRM/335-416.....QTRKLKGLYATK.I-------------------------------------------------------------
Q4C6J4_CROWT/338-415.....NKQKLSK.....YF-------------------------------------------------------------
Q8YLU0_NOSS1/360-436.....TNQVIHR.....AF-------------------------------------------------------------
Q8TMH8_METAC/132-210.....HKWVASK.....YW-------------------------------------------------------------
Q73IV1_WOLPM/33-111.....KCWIKRK.....YF-------------------------------------------------------------
A3ESY4_9BACT/349-427.....RRWIFQQ.....YF-------------------------------------------------------------
A0LB55_MAGSM/355-433.....KKWVRSK.....YF-------------------------------------------------------------
A6DUJ5_9BACT/111-190.....LQRVLRQ.....RG-------------------------------------------------------------
A0YQ93_LYNSP/350-428.....KKWVAGK.....YF-------------------------------------------------------------
Q6ED59_CANZE/334-409.....ISSVYSK.....YF-------------------------------------------------------------
A0YP84_LYNSP/369-447.....RGWIVRK.....YW-------------------------------------------------------------
A7BMD0_9GAMM/46-124.....RKWVKDK.....YF-------------------------------------------------------------
Q1XGD2_PHYPA/395-473.....RPRLVSR.....FY-------------------------------------------------------------
B7WSG4_COMTE/349-427.....HPWCKSR.....YW-------------------------------------------------------------
A0LN71_SYNFM/335-414.....RAKNMMK.....CG-------------------------------------------------------------
Q8A4Z2_BACTN/144-223.....RFSNLQK.....CG-------------------------------------------------------------
A0L6Q1_MAGSM/246-325.....LRGHKTRA..HK.W-------------------------------------------------------------
Q2FSK1_METHJ/343-421.....KRWIARK.....YW-------------------------------------------------------------
Q8A4I4_BACTN/315-393.....YRHRFYPA..QE.W-------------------------------------------------------------
A4BP43_9GAMM/119-196.....KRSVGWR.....RW-------------------------------------------------------------
Q12UG1_METBU/382-460.....RTWIAHK.....YW-------------------------------------------------------------
A0YP86_LYNSP/368-446.....GNWIATK.....YW-------------------------------------------------------------
Q1VZ87_9FLAO/317-395.....FKGSKIKA..VK.W-------------------------------------------------------------
Q97DG3_CLOAB/341-420.....KYDNLRK.....FG-------------------------------------------------------------
Q6DKY2_GEOSE/289-368.....RIRELRA.....LG-------------------------------------------------------------

PF04494

Q0TXM2_PHANO/12-154-----GAQALLDVIREHIN-------------------------------------------------------------
Q6BLE6_DEBHA/159-301-----GGAILIRIINQYLN-------------------------------------------------------------
Q28YL4_DROPS/95-236-----...VVADIVAKYLH-------------------------------------------------------------
A5DCG3_PICGU/117-259-----GGGLLVRIINQYLS-------------------------------------------------------------
Q6PGV3_DANRE/54-195-----...AICWVLTAHLQ-------------------------------------------------------------
A4S3V7_OSTLU/9-148-----...SMLAVLNAHLC-------------------------------------------------------------
TAF5_SCHPO/42-184-----GGSIIIKLINQHID-------------------------------------------------------------
Q0CWI4_ASPTN/88-229-----GGSVMSAILSSYCT-------------------------------------------------------------
A7TGM1_VANPO/215-355-----GGNLLMDIIDKFIA-------------------------------------------------------------
A2Q8R6_ASPNC/90-230-----GGSDMTAILRV.IA-------------------------------------------------------------
Q67UR9_ORYSJ/38-177-----...VVLGIINERTT-------------------------------------------------------------
Q6CEN7_YARLI/135-279-----GGAIILRIVNQYID-------------------------------------------------------------
A6ZLD9_YEAS7/137-278-----GGSLIISVINQHLD-------------------------------------------------------------
Q7PZ11_ANOGA/47-186-----...VILNIVNEHMY-------------------------------------------------------------
Q54KH7_DICDI/265-404-----...LLLGLINQYIH-------------------------------------------------------------
A7EPZ0_SCLS1/162-304-----GGSVIIYLLQTFCE-------------------------------------------------------------
Q9VT91_DROME/308-446-----QQEKLL....SHFQ-------------------------------------------------------------
A6R542_AJECN/53-194-----GGTVMSAILSSYCT-------------------------------------------------------------
TAF5L_HUMAN/55-196-----...ALCKVLTLHIH-------------------------------------------------------------
Q6FJL6_CANGA/118-259-----GGSLIIGIINDHIQ-------------------------------------------------------------
Q5A6L8_CANAL/179-321-----GGGILIRIINQYLD-------------------------------------------------------------
Q6S7B0_ARATH/52-191-----...LMLGIINEHIN-------------------------------------------------------------
Q4SVI5_TETNG/54-195-----...TVCRALSTHLQ-------------------------------------------------------------
Q00ZU2_OSTTA/340-479-----...AVLAVLNAHLC-------------------------------------------------------------
Q9C2E3_NEUCS/92-233-----GGSTITFILQTFCQ-------------------------------------------------------------
Q7XB58_ORYSJ/50-168-----...VVLGIINERID-------------------------------------------------------------
A7RZJ8_NEMVE/60-199-----...LLLQLLSRNFS-------------------------------------------------------------
A3M063_PICST/168-310-----GGAILIRIINQYLD-------------------------------------------------------------
Q758K7_ASHGO/135-272-----GGSLLISIINQNLE-------------------------------------------------------------
A0JPI3_XENLA/182-321-----...QIWSIVQEHLY-------------------------------------------------------------
Q6DE31_XENLA/55-196-----...ALCKALALHIQ-------------------------------------------------------------
TAF5_ENCCU/4-142-----...YILKILNQHLD-------------------------------------------------------------
TAF73_SCHPO/45-187-----GSGIIIRLLNQYID-------------------------------------------------------------
Q2GXG5_CHAGB/85-226-----GGATITYILQTYCS-------------------------------------------------------------
A7TLK2_VANPO/155-296-----GGSLVISVINQNLE-------------------------------------------------------------

PF01348

YMF11_MARPO/546-691.AGSEGHSPAIPYTR
O03089_9ROSI/66-204.L.YRGRIWYLDIIC
Q35057_MARPO/978-1138TTRHPADRCSVIGCL
Q35058_MARPO/1090-1229...RGFNTKPISLIT
MATK_HORVD/363-502.S.HTERIWYLDIIG
O03133_TROAR/92-230.L.YRERIWYFDIIR
MATK_SINAL/356-494.L.YRVRVWYLDILY
YMF40_MARPO/355-492...FALSPPSDPRVL
Q03979_WHEAT/535-676...DPNNDGALNYMF
MATK_MARPO/220-354.....F..WYLNIIQ
Q35062_MARPO/661-802...PIARAEQVIDIS
O03101_9ROSI/151-289.L.YRGRIWYLYIIS
MATK_EPIVI/295-434.V.YISQFWYLNIYS
Q33759_ALLMA/562-727.L.TPFDPCWVCGSE
MATK_SAXIN/362-497.L.YRGRVWYLDIIC
Q02718_PODAN/556-726.I.NLFEPCWVCGNP
Q35059_MARPO/1119-1291QSKAKFNKCCVADCP
AI1M_YEAST/602-777KA.NFNKPCSICNST
AI2M_YEAST/638-799LS.LFSGICQICGSK
LTRA_LACLM/381-549ENRLKAKCCELCGTS
Q35056_MARPO/669-811.KGTPRDILGFWEIS
Q35063_MARPO/700-861...SRALRCSVKGRF
YMC6_SCHPO/585-729.WGFKSDKVKLNIRT
Q02717_PODAN/553-721VS.FFNYVCASCGAS
MATK_PINCO/357-493....RERIWHSDIPQ

PF08388

A6DJK4_9BACT/340-418---------------
Q8DMT0_THEEB/344-422---------------
Q84EW7_LACFE/24-103---------------
A3IQ70_9CHRO/380-459---------------
Q0HZ96_SHESR/345-423---------------
Q4BXG1_CROWT/91-169---------------
Q118Z9_TRIEI/28-106---------------
A7BUU9_9GAMM/362-442---------------
Q8TH39_METAC/313-391---------------
A6N5T0_PSEAI/316-394---------------
A1ZX32_9BACT/379-457---------------
Q92V78_RHIME/332-411---------------
Q1NMW5_9DELT/335-413---------------
A1T776_MYCVP/353-435---------------
Q1XA93_PARBD/411-489---------------
Q08724_9CYAN/368-446---------------
A6TN43_ALKMQ/221-299---------------
Q9F5E4_AGRRH/348-426---------------
A6WZI3_OCHA4/335-414---------------
Q94Z25_PYLLI/363-440---------------
Q5IX97_9RHIZ/317-395---------------
A7KG74_KLEPN/317-395---------------
Q75TN2_BACCS/287-366---------------
Q71EW7_9DELT/175-251---------------
Q5L096_GEOKA/288-367---------------
A6L278_BACV8/349-427---------------
Q121L7_POLSJ/346-425---------------
Q6LJ59_PHOPR/129-208---------------
Q8RSV8_9BACT/289-365---------------
A8MI91_ALKOO/292-371---------------
Q67R28_SYMTH/286-365---------------
Q4V1Q3_BACCZ/358-436---------------
Q2BCB5_9BACI/292-371---------------
A6L5N4_BACV8/347-425---------------
Q1VWX8_9FLAO/148-228---------------
Q64BS2_9ARCH/304-382---------------
A4XCB1_SALTO/367-443---------------
B0KBD2_THEP3/339-418---------------
Q8RSV7_9BACT/97-174---------------
Q7GEU5_CANPA/684-762---------------
Q4C1M3_CROWT/353-431---------------
A5VHP4_LACRD/329-408---------------
Q3F0V4_BACTI/313-390---------------
O99969_PORPU/347-422---------------
Q2THC8_SHIFL/276-360---------------
Q119D3_TRIEI/365-444---------------
A7N7X0_VIBHB/337-415---------------
Q8TM71_METAC/31-109---------------
A4BN29_9GAMM/57-135---------------
Q7NP80_GLOVI/345-423---------------
A4Y225_SHEPC/252-330---------------
Q10VN2_TRIEI/308-393---------------
A0L945_MAGSM/330-405---------------
Q94Z24_PYLLI/352-428---------------
Q1XGB6_PHYPA/398-476---------------
Q82RB7_STRAW/349-427---------------
A4VKJ2_PSEU5/358-436---------------
Q4E6A8_9RICK/143-220---------------
A1BAQ8_PARDP/313-391---------------
A4BSH6_9GAMM/128-208---------------
Q1KVR4_SCEOB/824-902---------------
A7Y2S3_VIBCL/293-372---------------
Q1VQF9_9FLAO/318-397---------------
A7V2J4_BACUN/347-425---------------
B4SCG3_PELPB/311-390---------------
Q10VN3_TRIEI/334-413---------------
A1BGI0_CHLPD/311-387---------------
Q6EI10_9CHLO/387-465---------------
A3IK29_9CHRO/370-448---------------
A4FC41_SACEN/223-301---------------
A4BSI5_9GAMM/26-104---------------
Q9S109_ECOLX/353-430---------------
A0YXC5_LYNSP/95-173---------------
Q92Y56_RHIME/377-468---------------
Q5P179_AROAE/107-185---------------
Q3B1V7_PELLD/340-418---------------
Q89TI6_BRAJA/98-173---------------
A5CZB8_PELTS/292-371---------------
Q2LRA6_SYNAS/211-289---------------
Q01P79_SOLUE/337-416---------------
A5LLN9_STRPN/155-234---------------
Q8YJX0_NOSS1/384-462---------------
Q81ZI4_NITEU/301-380---------------
A3ITJ4_9CHRO/375-453---------------
Q024N3_SOLUE/339-417---------------
Q4BZL5_CROWT/73-152---------------
Q2SF99_HAHCH/347-425---------------
Q0VRW5_ALCBS/345-423---------------
Q64A80_9ARCH/299-377---------------
Q0RWF2_RHOSR/343-419---------------
Q9AMP0_PSEAC/333-396---------------
Q4MP10_BACCE/356-434---------------
Q2JAX6_FRASC/343-420---------------
A0YYL7_LYNSP/367-444---------------
Q7UY81_RHOBA/354-431---------------
A6TTG9_ALKMQ/237-315---------------
Q11ZP2_POLSJ/335-414---------------
A5ZS99_9FIRM/8-87---------------
A3IVC5_9CHRO/352-437---------------
A4YPB0_BRASO/18-96---------------
A4G3U3_HERAR/349-427---------------
Q1D1V6_MYXXD/324-399---------------
Q1NNY7_9DELT/350-429---------------
A6TKY0_ALKMQ/313-390---------------
A6X7I7_OCHA4/354-431---------------
Q3M1M1_ANAVT/413-491---------------
A6TVZ8_ALKMQ/227-305---------------
B4S5R5_PROA2/311-390---------------
Q89BF9_BRAJA/341-418---------------
A9BGC0_PETMO/340-419---------------
Q5ZWK4_LEGPH/357-435---------------
A5G3H6_GEOUR/335-414---------------
A6TNL0_ALKMQ/222-301---------------
Q6WFV8_EUGMY/378-464---------------
A9B272_HERA2/344-422---------------
Q9AMW9_BRAJP/312-391---------------
A7BYN3_9GAMM/297-375---------------
Q7YAJ7_CHAVU/296-374---------------
A6FZM7_9DELT/259-338---------------
A5IEI2_LEGPC/352-430---------------
A6EY09_9ALTE/319-396---------------
Q0S063_RHOSR/344-424---------------
B4S633_PROA2/313-392---------------
A4JUE6_BURVG/312-391---------------
A3IWI4_9CHRO/365-443---------------
A0YT41_LYNSP/64-142---------------
Q93PB4_9BACT/329-408---------------
A5FDH6_FLAJ1/334-413---------------
A3WXE2_9BRAD/317-397---------------
Q877J2_PSESM/334-413---------------
Q1LRT7_RALME/348-426---------------
Q8A4I2_BACTN/337-416---------------
Q24WW9_DESHY/303-382---------------
Q5ZTU1_LEGPH/340-418---------------
Q4C1I8_CROWT/375-452---------------
A7LY43_BACOV/347-425---------------
A0YTU1_LYNSP/380-458---------------
A8KXN1_FRASN/320-396---------------
A0YZ77_LYNSP/366-429---------------
A5ZWA2_9FIRM/335-416---------------
Q4C6J4_CROWT/338-415---------------
Q8YLU0_NOSS1/360-436---------------
Q8TMH8_METAC/132-210---------------
Q73IV1_WOLPM/33-111---------------
A3ESY4_9BACT/349-427---------------
A0LB55_MAGSM/355-433---------------
A6DUJ5_9BACT/111-190---------------
A0YQ93_LYNSP/350-428---------------
Q6ED59_CANZE/334-409---------------
A0YP84_LYNSP/369-447---------------
A7BMD0_9GAMM/46-124---------------
Q1XGD2_PHYPA/395-473---------------
B7WSG4_COMTE/349-427---------------
A0LN71_SYNFM/335-414---------------
Q8A4Z2_BACTN/144-223---------------
A0L6Q1_MAGSM/246-325---------------
Q2FSK1_METHJ/343-421---------------
Q8A4I4_BACTN/315-393---------------
A4BP43_9GAMM/119-196---------------
Q12UG1_METBU/382-460---------------
A0YP86_LYNSP/368-446---------------
Q1VZ87_9FLAO/317-395---------------
Q97DG3_CLOAB/341-420---------------
Q6DKY2_GEOSE/289-368---------------

PF04494

Q0TXM2_PHANO/12-154---------------
Q6BLE6_DEBHA/159-301---------------
Q28YL4_DROPS/95-236---------------
A5DCG3_PICGU/117-259---------------
Q6PGV3_DANRE/54-195---------------
A4S3V7_OSTLU/9-148---------------
TAF5_SCHPO/42-184---------------
Q0CWI4_ASPTN/88-229---------------
A7TGM1_VANPO/215-355---------------
A2Q8R6_ASPNC/90-230---------------
Q67UR9_ORYSJ/38-177---------------
Q6CEN7_YARLI/135-279---------------
A6ZLD9_YEAS7/137-278---------------
Q7PZ11_ANOGA/47-186---------------
Q54KH7_DICDI/265-404---------------
A7EPZ0_SCLS1/162-304---------------
Q9VT91_DROME/308-446---------------
A6R542_AJECN/53-194---------------
TAF5L_HUMAN/55-196---------------
Q6FJL6_CANGA/118-259---------------
Q5A6L8_CANAL/179-321---------------
Q6S7B0_ARATH/52-191---------------
Q4SVI5_TETNG/54-195---------------
Q00ZU2_OSTTA/340-479---------------
Q9C2E3_NEUCS/92-233---------------
Q7XB58_ORYSJ/50-168---------------
A7RZJ8_NEMVE/60-199---------------
A3M063_PICST/168-310---------------
Q758K7_ASHGO/135-272---------------
A0JPI3_XENLA/182-321---------------
Q6DE31_XENLA/55-196---------------
TAF5_ENCCU/4-142---------------
TAF73_SCHPO/45-187---------------
Q2GXG5_CHAGB/85-226---------------
A7TLK2_VANPO/155-296---------------

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window