Sequence alignment for CL0371

PF05356

A3L5S4_PSEAI/1-83MKGMKNQIAKFNPVRSFRNLCIAGTVTAASSMPVWAASVIDTSS-VEQAITDGKSDMSNIGGYIVGALVILAVAGLIYSM
Q9I5K5_PSEAE/1-82MKAMKQRIAKFSPVASFRNLCIAGSVTAATSLPAF.AGVIDTSA-VESAITDGQGDMKAIGGYIVGALVILAVAGLIYSM

PF10389

Q82W09_NITEU/22-67----------------------AS------------ARADLPED-VTTAITAAKADIAAAGALVITIVVGIKV----WKW
A0JC23_9VIRU/44-89----------------------GS------------AMAAVPTD-VATAMSDSKADTATLAGLALIIVIGIAT----FKY
Q87CX4_XYLFT/36-81----------------------AG------------GSGIDVGA-IIEAIKAAIGPVGQIGIAVLSVTVLLHV----YKW
B2U9N6_RALPJ/34-79----------------------AQ------------SSGIDVSA-VTGGVSDAKTAITTIGGSVLGVIVLVAV----FMW
Q2P3H8_XANOM/31-76----------------------SG------------GGGVDVGD-VVSAIQGAAGPIASIGGAVLTVLVGIKV----YKW
Q3QZB7_XYLFA/36-81----------------------AA------------GSGIDVGE-VVAAIKAAAGPIGTIGIAVLGVTVALHV----YKW

PF05371

CAPSD_BPIF1/22-73------------------------------------FAADDATSQAKAAFDSLTAQATEMSGYAWALVVLVVGATVGIKL
Q9T0Q9_BPFD/1-49------------------------------------AEGDDP...AKAAFDSLQASATEYIGYAWAMVVVIVGATIGIKL
CAPSD_BPZJ2/1-49------------------------------------AEGDDP...AKAAFDSLQASATEYIGYAWAMVVVIVGATIGIKL
Q9T0Q8_BPIKE/1-52------------------------------------AEPNAATNYATEAMDSLKTQAIDLISQTWPVVTTVVVAGLVIKL
CAPSD_BPM13/24-72------------------------------------AEGDDP...AKAAFNSLQASATEYIGYAWAMVVVIVGATIGIKL
CAPSD_BPI22/32-83------------------------------------DGTSTATSYATEAMNSLKTQATDLIDQTWPVVTSVAVAGLAIRL
CAPSD_BPIKE/30-81------------------------------------AEPNAATNYATEAMDSLKTQAIDLISQTWPVVTTVVVAGLVIRL

PF05356

A3L5S4_PSEAI/1-83LRKA----
Q9I5K5_PSEAE/1-82LRKA----

PF10389

Q82W09_NITEU/22-67ITRVF---
A0JC23_9VIRU/44-89MRRSV---
Q87CX4_XYLFT/36-81IRKAF---
B2U9N6_RALPJ/34-79ARRPI---
Q2P3H8_XANOM/31-76VRRAM---
Q3QZB7_XYLFA/36-81VRKAF---

PF05371

CAPSD_BPIF1/22-73FKKFVSRA
Q9T0Q9_BPFD/1-49FKKFTSKA
CAPSD_BPZJ2/1-49FKKFASKA
Q9T0Q8_BPIKE/1-52FKKFVSRA
CAPSD_BPM13/24-72FKKFTSKA
CAPSD_BPI22/32-83FKKFSSKA
CAPSD_BPIKE/30-81FKKFSSKA

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window