Sequence alignment for CL0384

PF03009

PGC1_SCHPO/37-267-HRGYKAKYP..........--------------------------------------.E-NTILAFQQAVKAGADCVET
GPC1B_CAEEL/349-649-HRGMGSSYTKNI.....GQ--------------------------------------RE-NTIFSLNEAARRGADYVEM
YQIK_BACSU/7-235-HRGASGQFP..........--------------------------------------.E-NTMLAFEKGIEAGADGIEL
Q9RZL4_DEIRA/249-566-HRGSSGTRP..........--------------------------------------.E-HTLESYRTAIEAGADFIEP
Q9X1V6_THEMA/6-217-HRGYSAKYL..........--------------------------------------.E-NTLEAFMKAIEAGANGVEL
Y2277_MYCTU/36-295-HRAGTRDFP..........--------------------------------------.E-NTVLAITNAVAAGVDGMWL
Q9RWX3_DEIRA/7-220-HRGSPREHT..........--------------------------------------.E-NTLASFQAALDAGLDGIEL
O07244_MYCTU/14-242-HRGFTSFRL..........--------------------------------------PM-NSMGAFQEAAKLGFRYIET
Q9SD81_ARATH/49-357-HRGSNGELP..........--------------------------------------.E-ETAPAYMRAIEEGADFIET
GPC1A_CAEEL/406-706-HRGAGNSYTKFA.....MA--------------------------------------RE-NTIHSLNTAAKNGADYVEF
O02322_CAEEL/73-322-HRGSAHDNI..........--------------------------------------PE-NSLEAFSAVKSEGGQLAEM
YHDW_BACSU/6-233-HRGASGYAP..........--------------------------------------.E-NTIAAFDLAVKMNADMIEL
GDE1_SCHPO/752-1061-HRGLGKNQPDRLS...LQL--------------------------------------GE-NTLQSFIKAADLGASYVEL
Q45201_BORHE/38-330-HRGASGYLP..........--------------------------------------.E-HTLEAKAYAYALGADYLEQ
Q9W2L6_DROME/349-632-HRGLGKSLTVTTN..AAPL--------------------------------------IE-NTVATMLASSELGADLVEF
O86738_STRCO/16-227-HRGDPYRHR..........--------------------------------------.E-NTLDSLRSALERGADAVET
GDE1_YEAST/877-1212-HRGLGKNNPNKS....LQI--------------------------------------GE-NTVESFIMAASLGASYVEF
Q9VQU3_DROME/375-661-HRGSGTSFKAKD....AVI--------------------------------------RE-NTITSLKNAAEHGADMVEF
Q9V208_PYRAB/12-236-HRGYMSKYP..........--------------------------------------.E-NTLLAFRKALEAGADGVEF
Q9Z3F4_XANEU/274-516-HRGLFDNHAG........I--------------------------------------PE-NSLASIDHAYEQGYRNLEL
GLPQ1_MYCTU/17-259-HRGASAARP..........--------------------------------------.E-HTLAAYDLALKEGADGVEC
PGC1_YEAST/7-246-HRAFKARYP..........--------------------------------------.E-NTLLAFEKAYAAGADVIET
Q9RKX8_STRCO/20-243-HRGGAADGL..........--------------------------------------.E-NTLRQFRRAVGAGYRYIET
Q9ZTU6_WHEAT/118-414-HNGASGDYP..........--------------------------------------.D-CTDLAYQKAVVDGADVIDC
GLPQ_BACSU/43-285-HRGASGYVP..........--------------------------------------.E-HTILSYETAQKMKADFIEL
GLPQ_ECOLI/36-350-HRGASGYLP..........--------------------------------------.E-HTLPAKAMAYAQGADYLEQ
GLPQ_HAEIN/40-355-HRGASGYLP..........--------------------------------------.E-HTLESKALAFAQHSDYLEQ
Q89384_PBCV1/5-217-HRGCSALFP..........--------------------------------------.E-NTMMSFRHV..IP.KAIEF
UGPQ_ECOLI/12-239-HRGGGKLAP..........--------------------------------------.E-NTLASIDVGAKYGHKMIEF
Q9SGA2_ARATH/39-318-HRGHGMNMSQSPDLRFSAL--------------------------------------KE-NSILSFNAASKFPLDFIEF
Q9YFI4_AERPE/15-220-HRANSGRIA..........--------------------------------------..-....IFYSM..VGIKAVEV
Q44028_CUPNE/17-245-HRGAGKLAP..........--------------------------------------.E-NTLAAFRHGAGFGYRMFEF
Q9RSP0_DEIRA/37-277-HQGGEALWP..........--------------------------------------.S-NTLTAYRGAVALGVDLLEM
Q9UAW8_CAEEL/68-331-HRGAPKSFP..........--------------------------------------.E-NSMAGFAQAKADGADLIEF

PF13653

A8I2Q7_CHLRE/208-237--------------------------------------------------------------------------------
C6JG09_9FIRM/261-290--------------------------------------------------------------------------------
Q97AF5_THEVO/125-154--------------------------------------------------------------------------------
C1EA09_MICSR/311-340--------------------------------------------------------------------------------
D3R0L3_CLOB3/197-226--------------------------------------------------------------------------------
Q53JJ0_ORYSJ/166-195--------------------------------------------------------------------------------
C2HMV5_LACAI/99-128--------------------------------------------------------------------------------
B5DF39_RAT/181-210--------------------------------------------------------------------------------
B3RWH1_TRIAD/177-217--------------------------------------------------------------------------------
B6A4H5_RHILW/237-277--------------------------------------------------------------------------------
C5XX04_SORBI/147-190--------------------------------------------------------------------------------
C3KNM3_RHISN/284-318--------------------------------------------------------------------------------
A1SJR5_NOCSJ/183-212--------------------------------------------------------------------------------
C5Y879_SORBI/258-287--------------------------------------------------------------------------------
C4H5M9_YERPE/194-223--------------------------------------------------------------------------------
D2QM66_SPILD/215-245--------------------------------------------------------------------------------
Q1M8H9_RHIL3/237-277--------------------------------------------------------------------------------
D3PWH3_STANL/239-274--------------------------------------------------------------------------------
A4F9Z1_SACEN/227-262--------------------------------------------------------------------------------
A3XKX4_LEEBM/206-236--------------------------------------------------------------------------------
A8M0I4_SALAI/230-265--------------------------------------------------------------------------------
A21_LOXAR/214-243--------------------------------------------------------------------------------
C2FUE7_9SPHI/240-270--------------------------------------------------------------------------------
A4AS02_MARSH/212-242--------------------------------------------------------------------------------
B2KBC_SICCD/215-244--------------------------------------------------------------------------------
A6CED4_9PLAN/229-259--------------------------------------------------------------------------------
C7PNH8_CHIPD/228-258--------------------------------------------------------------------------------
A1H1_LOXRE/220-249--------------------------------------------------------------------------------
B1H1_LOXIN/248-277--------------------------------------------------------------------------------
C5C387_BEUC1/626-661--------------------------------------------------------------------------------
B2L2_SICCD/215-244--------------------------------------------------------------------------------
A3HWH1_9BACT/215-245--------------------------------------------------------------------------------
Q6MRA8_BDEBA/253-282--------------------------------------------------------------------------------
A6WFY1_KINRD/264-299--------------------------------------------------------------------------------
A51_LOXIN/249-278--------------------------------------------------------------------------------
A7T397_NEMVE/56-86--------------------------------------------------------------------------------
C6W5T4_DYAFD/220-250--------------------------------------------------------------------------------
A5ZJ68_9BACE/227-257--------------------------------------------------------------------------------
B312_LOXSN/215-244--------------------------------------------------------------------------------
A71_LOXAR/216-245--------------------------------------------------------------------------------
C0Y618_BURPE/135-164--------------------------------------------------------------------------------
A612_LOXHI/216-245--------------------------------------------------------------------------------
B7Q3W8_IXOSC/213-242--------------------------------------------------------------------------------
D2QQ87_SPILD/603-633--------------------------------------------------------------------------------
C7NM04_KYTSD/250-284--------------------------------------------------------------------------------
Q010C1_OSTTA/112-141--------------------------------------------------------------------------------
Q7UF88_RHOBA/253-283--------------------------------------------------------------------------------
B1Q_LOXIN/246-275--------------------------------------------------------------------------------
A3ZUF0_9PLAN/222-252--------------------------------------------------------------------------------
A21_LOXVA/216-245--------------------------------------------------------------------------------
A6EG44_9SPHI/221-251--------------------------------------------------------------------------------
A41_LOXRU/216-245--------------------------------------------------------------------------------
B1R_LOXAS/214-243--------------------------------------------------------------------------------
A1LA_LOXAR/261-290--------------------------------------------------------------------------------
C7P9S2_CHIPD/217-247--------------------------------------------------------------------------------
B7QFM3_IXOSC/67-96--------------------------------------------------------------------------------
A412_LOXHI/219-248--------------------------------------------------------------------------------
B9XKB9_9BACT/233-263--------------------------------------------------------------------------------
E8W4Q9_STRFA/244-279--------------------------------------------------------------------------------
SMD_IXOSC/243-272--------------------------------------------------------------------------------
A312_LOXS4/219-248--------------------------------------------------------------------------------
B1S_LOXAS/217-246--------------------------------------------------------------------------------
A6EG56_9SPHI/219-249--------------------------------------------------------------------------------
A21_LOXSP/213-242--------------------------------------------------------------------------------
A1OB2_LOXVA/213-242--------------------------------------------------------------------------------
A5FEV6_FLAJ1/213-243--------------------------------------------------------------------------------
D7VYF5_9FLAO/219-249--------------------------------------------------------------------------------
Q4Z7T4_PLABA/27-60--------------------------------------------------------------------------------
A424_LOXLA/217-246--------------------------------------------------------------------------------
B9GJW3_POPTR/78-121--------------------------------------------------------------------------------
B7PW58_IXOSC/226-255--------------------------------------------------------------------------------
B1LB_SICPE/216-245--------------------------------------------------------------------------------
C6W721_DYAFD/221-251--------------------------------------------------------------------------------

PF00388

Q60450_CRIGR/286-429MDQPLSHYLVSSSHNTYLLE.............................DQLT.....GP.SSTEAYIRALCKGCRCLEL
A4I5X4_LEIIN/300-441MTHPLKDYFINSSHNTYLSG.............................DQFQ.....SS.SQIEMYRRALLAGCRCVEL
Q8IJR0_PLAF7/626-770MNLPLCNYWINSSHNSYLAR.............................KQIF.....ST.SNIEQYIYILLDGCRCVEF
PLC_STAAE/34-177INIPGSHDSGSFTLKDPVKS...............................VW.....AK.TQDKDYLTQMKSGVRFFDI
Q6BZ51_DEBHA/455-607FDHPLNEYFISSSHNTYLMG.............................RQVA.....GD.SSIEGYIKALQRGCRCVEV
PLCG2_MOUSE/314-457MNNPLSHYWISSSHNTYLTG.............................DQLR.....SE.SSTEAYIRCLRAGCRCIEL
PLCL1_HUMAN/400-543MTQPLSHYYINASHNTYLIE.............................DQFR.....GP.ADINGYIRALKMGCRSVEL
PLCD9_ARATH/109-254MNAPLSHYFIHTSLKSYFTG.............................NNVF.....GRLYSIEPIIDALKQGVRVVEL
PLCD1_ARATH/107-250MNQPLSHYFLYTGHNSYLTG.............................NQLN.....SN.SSIEPIVKALRNGVRVIEL
PLCD6_ARATH/139-282MTAPLSHYFIYTGHNSYLTG.............................NQLS.....SD.CSEVPVIKALQRGVRVIEL
A5DAA1_PICGU/440-595FDHPLNDYFISSSHNTYLIG.............................RQFV.....GD.SSIDGYIRAFQRGCKCVEI
Q636S2_BACCZ/57-195ISIPGTHDSGTFKLQNPIKQ.................................V...WGM.TQEYDFRYQMDHGARIFDI
A7MD68_DANRE/316-460MQQPLNHYFISSSHNTYLME.............................DQLK.....GP.SSTEAYIKALMKSCRCVEL
PLCD4_RAT/292-436MTQPLSHYYINSSHNTYLLG.............................DQFC.....GQ.SSVEGYIRALKRGCRCVEV
Q0PGC0_LISMN/61-200LSIPGTHDTMSYNGDMTWTL.............................TKPL.....AQ.TQTMSLYQQLEAGIRYIDI
PLCZ1_BOVIN/157-300MTHPLTDYFISSSHNTYLIS.............................DQLW.....GP.SDLWGYISALVKGCRCLEI
Q55WA1_CRYNB/160-302MTHPLQHYFISSSHNTYLVG.............................EQWK.....GE.STVEGYIRVLLAGCRCVEM
Q2YGU1_LILDA/57-200MTAPLSHYYIYSGHNSYLTG.............................NQLS.....SD.CSDVPIINSLQSGVRVIEL
PLCD3_ARATH/108-251MKAPLSHYFVYTGHNSYLTG.............................NQVN.....SR.SSVEPIVQALRKGVKVIEL
Q5JYS9_HUMAN/151-300MDHPLAHYFISSSHNTYLTG.............................RQFG.....GK.SSVEMYRQVLLAGCRCVEL
O97034_9METZ/308-451MDRPISHYWIASSHNTYLTG.............................NQYS.....SE.SSCECYSRALRMGCRCIEL
A5E691_LODEL/21-192FSHPLTDYYISSSHNTYLIG.............................RQVG.....GE.SSLEGYIKALKKGCRCVEI
Q16W08_AEDAE/315-464MDQPLSHYYINSSHNTYLSG.............................RQFG.....GK.SSVEMYRQTLLAGCRCVEL
PLCD5_ARATH/114-257MASPLSHYFIYTSHNSYLTG.............................NQIN.....SE.CSDVPLIKALKRGVRALEL
Q5QIB9_STRPU/301-444MKQPLAHYFINSSHNTYLLD.............................DQLR.....GP.SSTEAYISALQRGCRCVEL
Q6CSI9_KLULA/402-540YSRPLNEYFISSSHNTYLMG.............................KQVV.....DE.VSVEAYTRALQQGCRCIEI
A0FLF3_TOBAC/111-253MNEPLSHYFIYTGHNSYLTG.............................NQLS.....SD.CSDVPIIQALHRGVRVIEL
O97037_HYDVU/300-443MTRPLTDYFINSSHNTYLLN.............................DQVL.....GM.SSTKAYEKALKKGCKTLEL
PLCD3_HUMAN/339-483MNQPLAHYFISSSHNTYLTD.............................SQIG.....GP.SSTEAYVRAFAQGCRCVEL
Q385H1_TRYB2/248-393MTRPICEYFINSSHNTYLTG.............................DQLL.....SK.SSTDMYKRVLLDGCRCVEL
Q3TWI4_MOUSE/319-469MTQPLSAYFINSSHNTYLTA.............................GQLA.....GP.SSVEMYRQALLWGCRCVEL
P93620_VIGUN/106-249MNAPISHYFIYTGHNSYLTG.............................NQLS.....SD.CSDAPIIKALQRGVRVIEL
A2TF43_9LAMI/114-257MDSPMSHYFIYTGHNSYLTG.............................NQIS.....SD.ASEKPIVEALKRGVRVIEL
Q16ZC0_AEDAE/42-189MNLPLSQYYIASSHNTYLTG.............................HQLK.....GE.SSVELYSQVLLTGARCVEL
Q4S9T4_TETNG/359-525MTMPLSHYYISTSYRSYLLD.............................DQVH.....A..GRPRGLIKALQSGCRCVEL
O49950_SOLTU/113-256MTAPLSHYFIYTSHNTYLTG.............................NQLN.....SD.CSDVPIIKALQQGVRVIEL
Q4S530_TETNG/241-384MRQPLNHYFISSSHNTYLME.............................DQLK.....GP.SSTEAYINT.DEECRCVEL
PLCH1_HUMAN/301-445MDQPLCNYYIASSHNTYLTG.............................DQLL.....SQ.SKVDMYARVLQEGCRCVEV
Q45UQ8_NEUCS/110-360LSYPLSSYFISSSHNTYLTG.............................NQLS.....SE.SSVDAYRNVLLRGCRCIEV
Q4SKC0_TETNG/309-451MNNPLSHYWINSSHNTYLTG.............................DQLR.....SE.SSTEAYVRALRLGCRCVEL
A2QEJ2_ASPNC/86-262LSAPITDYFISTSHNTYLTG.............................NQLY.....SE.SKASAYTNVLLSGCRSVEI
Q4N7P5_THEPA/468-615LSLTLRDFWISSSHNTYLIG.............................DQLG.....GS.ATAGALAEALLRGCRCIEL
A7S279_NEMVE/319-466MNQPLSHYFINSSHNTYLVG.............................RQFG.....GR.SSVEMYRQCLIAGCRCIEL
PLC_DICDI/324-466TSKPLSYYFINSSHNTYLSG.............................HQLK.....GL.STSEMYTNTLRQGCKCVEL
Q5BFL6_EMENI/534-676FDRPLNEYFISSSHNTYLLG.............................RQVA.....GS.SSTEAYISALTQGCRCIEI
Q2HB23_CHAGB/553-696LDRPMNEYYISSSHNTYLIG.............................RQVA.....SI.SSHEGYISALLRGCRCIEV
A6RBI2_AJECN/84-320LSLPMNNYFISSSHNTYLTG.............................NQLY.....SE.SSTKVYRDVLLKGCRCLEI
Q1LWH7_DANRE/284-423MSQPLCHYFISSSHNTYLLE.............................DQIR.....GL.SSVEGYIRALKRGCRCVEV
A0CKY8_PARTE/271-413MTKPLSHYYINSSHNTYLTK.............................DQLA.....GD.SSVGQYVIALLNGCRCFEL
Q3UZ68_MOUSE/210-353MNNPLSHYWISSSHNTYLTG.............................DQFS.....SE.SSLEAYARCLRMGCRCIEL
Q5CLA7_CRYHO/367-509MDEPISHYWIASSHNTYLTG.............................DQLT.....SK.SEIGQYITVLLQGCRCVEL
E9AEI1_LEIMA/296-447MDHPLPHYFINSSHNTYLTG.............................NQLN.....SE.SSCNMYRDVLLAGCRCVEI
Q91423_9TELE/46-190MRQPINHYFISSSHNNYLMQ.............................EQLK.....GA.SSTEGYIRALLKSCRCVEL
Q9XWB7_CAEEL/306-468MREPINKYFINSSHNTYCSG.............................NQLVYAIGHCS.ADVEMYRQALLSGSRCVEL
Q8IA75_CAEEL/367-517MKQPFSRYFISSSRKSYLVE.............................DQL......GP.SSSDGFSSALKRNCRFLEF
PLC1_YEAST/382-521YSKPLNHYFIASSHNTYLLG.............................KQIA.....ET.PSVEGYIQVLQQGCRCVEI
Q4SCY8_TETNG/29-191MTYPLSHYFINSSHNTYLTA.............................GQLA.....GN.SSVEMYKQVLLSGCRCIEL
PLCE1_HUMAN/1394-1541LQLPLSYYYIESSHNTYLTG.............................HQLK.....GE.SSVELYSQVLLQGCRSVEL
Q6QAF2_LYTPI/318-467MEQPLSHYFINSSHNTYLTG.............................RQFG.....GK.SSVEMYRQVLLAGCRCVEL
A7RXP6_NEMVE/244-393MTQPISHYFINSSHNTYLTG.............................HQLT.....GK.SSVEMYRQTLLAGCRCIEL
Q2QNK1_ORYSJ/114-257MSAPFSHYYIYTGHNSYLTG.............................NQLN.....SD.SSDIPIIKALQRGVRVIEL
Q7QHE3_ANOGA/319-462MSRPLAHYWISSSHNTYLTG.............................DQFS.....SE.SSVEAYARALRMGCRCIEL
A0BLC4_PARTE/285-429EDFPLTDYWINSSHNTYLMG.............................DQLT.....SE.SSIQAYINAFQKGCRCVEL
Q6FY00_CANGA/381-519YSRPMNQYYIASSHNTYLTG.............................KQIG.....GA.PSVEGYIQALQQGCRSVEI
A0BLM0_PARTE/262-404LSQPITKYLINSSHNTYLET.............................NQLT.....GE.SSCFAYQDAFKMGFKCVEL
Q59LC4_CANAL/566-727YDYPLNEYFISSSHNTYLTG.............................RQVA.....GD.SSVEGYIRTLQRGCRCVEI
Q4T850_TETNG/115-259MEQPLCNYFIASSHNTYLTG.............................DQLL.....SH.SKTDMYAWVLQSGCRCVEV
Q9FSW1_9POAL/148-291MNAPLSHYFIHTGHNSYLTG.............................NQLS.....SD.CSDVPIIKALQLGVRVIEL
Q2UPV6_ASPOR/98-321YSAPISDYFISSSHNTYLTG.............................NQLY.....SD.SDASAYTNVLLNGCRCVEI
O97035_HYDVU/328-477LSFPIAHYFINSSHNTYLQG.............................HQLT.....GK.SSVEIYRQVLLAGCRCIEL
Q4PDE8_USTMA/122-279RSRPLSEYFVSSSHNTYLLA.............................HQLY.....GS.SSAVAYEHVLIAGARCVEI
Q9XEK4_BRANA/105-249MDAPISHYFIFTGHNSYLTG.............................NQLS.....SD.CSEVPIIDALKKGVRVIEL
A7T501_NEMVE/158-302MTRPLSHYFIASSHNTYLTG.............................DQLA.....SA.SSMDMYVRVLQSGCRCLEL
Q4RWH6_TETNG/299-443MSRPLAHYFISSSHNTYLTK.............................DQVT.....SA.SSTEPYIRALNQGCRCVEL
A5A2F9_TOBAC/110-253MNAPLSHYFIFTGHNSYLTG.............................NQLT.....SD.CSDVPIIKALKKGVRVIEL
A7ASE0_BABBO/522-670LKYPLNSFWIASSHNTYLTG.............................NQVG.....GA.AAAGALADALLRGCRCIEL
Q7ZU40_DANRE/294-438MNQPLSHYFISSSHNTYLME.............................DQLK.....GP.SSTEAYIKALLKGCRCVEL
Q45QJ6_RAT/314-464MTQPLNHYFINSSHNTYLTA.............................GQFS.....GP.SSAEMYRQVLLSGCRCVEL
Q0B816_BURCM/28-162LTLPGSHDSCAYTVDDPLVR.........................................TQRAPLAAQLAHGVRLLDI
Q4PA81_USTMA/724-872MTRPLSEYYISSSHNTYLVG.............................GQWK.....GD.STVEGYIRALLQGARSVEL
A7TR21_VANPO/381-520YSKPLNHYYIASSHNTYLLG.............................KQFG.....ET.PSVEGYIQVLQQGCRCVEI
Q75C92_ASHGO/397-535YSRPLSEYFISSSHNTYLLG.............................NQVG.....SM.ASVEGYIQALQQGCRSVEI
A7RPQ0_NEMVE/307-450MTQPLSHYFIASSHNTYLLD.............................NQLS.....GR.SSIEGYIAALQQGCRCVEL
Q5MG88_TOXGO/407-550MSLPLCNYWVKSSHNTYLCG.............................DQVV.....GK.SAVGQYIDALLRGCRCVEL
A7SXK4_NEMVE/94-237MNQPLSHYFIASSHNTYLLG.............................HQLK.....GS.SSVQAYRDVLERGCRCVEL
PHLC_TRYBB/54-199KLRSLPPYV..TFLLRFLTV................................GVSSRWGR.CQNLSIRQLLDHGVRYLDL
Q4S9B8_TETNG/321-464MKQPLSHYYINSSHNTYLIE.............................DQFR.....GP.SDVTGYIRALKMGCRSVEL
O07690_LISSE/61-200LSIPGTHDTMSYNGYITWQF.............................TRPL.....AQ.TQTMTLNEQLNAGIRFFDI
A4S165_OSTLU/1-153MTDELSHYFVNSSHNTYLDG.............................GQLF.....SR.STSSAIAWALERGCRVVEL
Q7PW25_ANOGA/289-436MDQPMAHYFINSSHNTYLTG.............................HQLT.....GK.SSVEIYRQSLLAGCRCVEL
Q4SDX6_TETNG/287-431MTQPLAHYFISSSHNTYLTK.............................DQLT.....GD.SSTEPYIRALSRGCRCVEL
A7RKT2_NEMVE/272-413MDQPLSDYFINSSHNTYLTG.............................HQLK.....GL.SSLEAYVRALLQGCRCIEL
Q4RKI8_TETNG/349-492MSQPLSHYYICSSHNTYLIE.............................DQIR.....GP.SDISGYIRALKMGCRCVEV
Q766D4_9BRYO/108-251MTQPLSHYFIFTGHNSYLTG.............................NQLS.....SD.SSDVPIAAALQRGVRVVEL
Q2PEW5_TRIPR/126-269MSLPLSHYYIHTGHNSYLTG.............................NQLS.....SD.CSDAPIINALQRGVRVIEL
A6RM87_BOTFB/546-665LDRPMHEYFISSSHNTYLMG.............................RQVA.....GE.SSVEAYISALIKGCR....
Q4RX70_TETNG/314-458MTQPLNHYFIATSHNTYLSG.............................DQLL.....SQ.SRVEMYAYVLQAGCRCVEV
A3LSB2_PICST/461-615MSYPLSEYYISSSHNTYLVG.............................RQVA.....GD.SSVEGYIRALQRGCRCVEV
A4EAJ4_9ACTN/13-159LSIPGTHDSGTCSVDNDTEP.............................QTSL.....AK.CQQDYIPTQLLEGIRYFDI
A3LNB7_PICST/20-167LSIPGTHNSAACHTALPSVQ.........................................CQGKSVTDQLKHGVRFLDI
Q6R6E0_LISIV/61-201LTIPGTHDTMSYKGNISWTL.............................TKSL.....AQ.TQKMSLFQQLEAGIRYIDI
Q24284_DROME/320-463MNLPLSSYWIASSHNTYLTG.............................DQFS.....SE.SSCEAYARALRMGCRCIEL
PLCH2_HUMAN/328-472MTQPLSHYFITSSHNTYLVG.............................DQLM.....SQ.SRVDMYAWVLQAGCRCVEV
Q0UVV5_PHANO/116-337ESYPISNYFISSSHNTYLTG.............................NQLS.....SE.SSTDAYKNVLMRGCRCVEI
Q4QBH9_LEIMA/195-340MDQIMCCYFISSSHNTYLTG.............................DQLT.....SK.SSAQMYKKGASRRVPVREA
PLCD4_HUMAN/292-436MTQPLNHYFICSSHNTYLVG.............................DQLC.....GQ.SSVEGYIRALKRGCRCVEV
Q0UE70_PHANO/101-258RNHPLPEYFISSSHNTYLMA.............................HQLF.....GE.SHASAYEIALYTGSRCVEI
A5AGR6_VITVI/112-255MNAPLSHYFIYTGHNSYLTG.............................NQLS.....SI.CSDVPVINSLQCGVRVIEL
B9DGG5_ARATH/8-150MDAPLSHYFIFTGHNSYLTG.............................NQLS.....SN.CSELPIADALRRGVRVVEL
Q4RLM8_TETNG/312-491MTQPLPHYFIKSSHNTYLTGSAQLSSARGFSDKQTPDDRWCSFFLLSTAGQFS.....GV.SSPEMYRQCLLAGCRCLEL
PLCL2_MOUSE/429-572MKQPLSHYFINSSHNTYLIE.............................DQFR.....GP.SDITGYIRALKMGCRSVEL
PLCZ1_CHICK/159-303MNHPLCDYFISSSHNTYLVS.............................DQLI.....GP.SDLNGYISALLKGCRCLEI
A2IB48_CHAVR/321-464MDQPLSYYWIASSHNTYLTE.............................NQYS.....SE.SSTEAYARVLQMGCRCIEL
PLCD4_XENLA/292-436MMQPLCHYFISSSHNTYLME.............................DQIR.....GQ.SSIEGYIRALKRGCRCVEV
Q3F156_BACTI/43-187LSIPGTHGSMALHGASVFDE.............................NLTR........NQTMNLSQQLNSGIRYVDM
Q2GUM5_CHAGB/104-264RSHPLPEYFISSSHNTYLMS.............................HQLF.....GA.SSAAAYETTLKAGARCIEI
Q7SE08_NEUCR/136-356LTYPISNYFISSSHNTYLEG.............................NQLS.....SK.SSAEAYKAVLRNGCRCIEI
Q21754_CAEEL/318-461MDQPLTHYFVNSSHNTYLTG.............................LQVK.....GE.ATVEGYISALRKGARLLEL
Q9GV33_WATSC/324-471MKLSLAAYYINSSHNTYLTG.............................HQLT.....GK.SSVEIYRQVLLTGCRCLEL
A7SDH9_NEMVE/209-352MRQPLSHYFIASSHNTYLME.............................DQLK.....GP.SSVDAYINAFNKGCRCVEL
Q6EZG7_CAEEL/342-492MDQPLCHYYINSSHNTYLTG.............................RQYG.....GK.SSSEIYRQVLLSGCRCIEL
Q6RY08_ASTMI/305-448LDQPLCNYLIASSHNTYLTG.............................DQIA.....SE.SSCEAYVRCLRMGCRCLEL
A4HCK9_LEIBR/248-393MDQTISCYFINTSHNTYLTG.............................DQLT.....SK.SSPEMYKRVLLDGCRCVEL
Q236T7_TETTS/368-513MDKPLSDYFINSSFRSYLVY.............................DLVT....QTK.DLTKAYIYLLQKGVRHLDI
Q9P866_CANAX/68-213LSIPGTHNSAACHTALPSVQ.........................................CQGASVTEQLEHGVRFLDI
O97036_HYDVU/314-460MNQPINHYFINSSHNTYLLG.............................RQVY.....GK.SSVEIYRQVLISGCRCIEL
O97033_9METZ/324-472MTQPLSHYFINSSHNTYLTG.............................HQLR.....SL.STVEMYRQCLLLGCRCVEL
PLC1_SCHPO/443-585MSRPLNEYLISSSHNTYLLG.............................KQFG.....GE.SSIEGYIRSLQRGCKCIEI
A6AS90_VIBHA/22-157ISIPGTHDSGTQKAPKGGPR.........................................TQNFGIYEQLSDGIRFLDI
Q013R6_OSTTA/119-269MTSEMSAYFVNSSHNTYLDG.............................DQLF.....SR.ASVAAIAGALDRGCRVIEL
Q75IL8_ORYSJ/119-262MGLPLSHYFIYTGHNSYLTG.............................NQLS.....SG.CSEVPIVKALHDGVRVIEL
O96101_TRYCR/248-393MNQPICNYFINSSHNTYLTG.............................DQLT.....SN.SSADMYRKALFDGCRCVEL
A6EGD5_9SPHI/56-190LSIPGTHDSGARTEPISGTA.......................................K.CQDLSIADQLTAGVRFLDI
PLCD8_ARATH/107-248MHAPLSHYFIHTSLNSYFTG.............................NVF......GK.YSILPIIEALEQGVRVVEL
Q4S959_TETNG/321-464MNQPLSHYYINSSHNASLLE.............................DHFW.....GS.SDVSSYIRALRMGCRSVEV
Q762E2_9BRYO/150-294MNAPLSDYYIFSSHNTYLMG.............................NQLC.....SP.SSTAPIVKALLDGCRVIEL
Q4RSB2_TETNG/98-242MDQPLSSYFISSSHNTYLTG.............................DQLV.....GK.SHLDAYVCALRKGCRCLEI
Q6CD33_YARLI/505-648LNRPLNEYYISTSHNTYLIG.............................RQVA.....DT.SSEEGYIRALQSGCRSVEI
A7UXE0_NEUCR/117-274RDYPLPEYFVSSSHNTYLCA.............................HQLF.....GE.SSTDPYRHTLQAGSRCVEI
A1D7Q8_NEOFI/96-331LSAPITDYYVSSSHNTYLTG.............................NQLY.....SD.AAAAAYTNVLLSGCRCVEI

PF00387

PLCD1_MOUSE/491-609-----------------------------------------------------------ELSDMVIYCKSVH....FGGF
Q29N33_DROPS/566-683-----------------------------------------------------------EISALVNYVQPIH....FSSF
PLCG2_HUMAN/929-1044-----------------------------------------------------------ELSDLVVYCKPTS....KTKD
PIPA_DROME/549-666-----------------------------------------------------------WLSSMVNYAQPIK....FQGF
Q6BZ51_DEBHA/661-779-----------------------------------------------------------TLSDLGIYLQGVK....FRNF
PLCH1_HUMAN/600-714-----------------------------------------------------------ELSDLVVYTNSVA....AQDI
A5DAA1_PICGU/647-765-----------------------------------------------------------ELSDLAIYIQGIK....FRNF
A7RXP6_NEMVE/449-566-----------------------------------------------------------ALSELVNYFQPVH....FKSF
A7RPQ0_NEMVE/491-608-----------------------------------------------------------ELSDLVSLCKSVT....FQDF
Q7ZU40_DANRE/483-600-----------------------------------------------------------ELSDIVIYCKSVP....FHGL
PLCB2_MOUSE/546-663-----------------------------------------------------------EMSSLVNYIQPTK....FISF
PLCL1_RAT/585-702-----------------------------------------------------------ELSDLVSICKSVQ....YRDF
Q4T850_TETNG/440-554-----------------------------------------------------------DLSNLVVFTNSVA....SQEC
Q55WA1_CRYNB/353-467-----------------------------------------------------------QLSELLVYTHGVK....YQGF
O96101_TRYCR/462-581-----------------------------------------------------------KLSRVVS.IESAG....FKGT
P78585_BOTFU/650-769-----------------------------------------------------------VLGELGIYSAGVK....FRGF
Q75C92_ASHGO/591-714-----------------------------------------------------------QLLQISA.IHGIT....FRNF
PLCZ1_MACFA/381-498-----------------------------------------------------------ALSDLVIYTKAEK....FKSF
Q4RX70_TETNG/609-725-----------------------------------------------------------ALSDLVKYTKSVR....VHDI
Q08JX0_ORYLA/549-666-----------------------------------------------------------AMSSIVNYIQPNK....FISF
O97033_9METZ/764-881-----------------------------------------------------------PLVDIINYCSGIT....FEGF
Q25285_LOLFO/513-630-----------------------------------------------------------EMSALVNYIQPVH....FTTF
A3LSB2_PICST/669-787-----------------------------------------------------------ELSDLGVYFQGLK....FRNF
A1D7Q8_NEOFI/374-488-----------------------------------------------------------SLSRLAVFTKGFS....FRQF
Q17CT3_AEDAE/941-1054-----------------------------------------------------------EMSDMIIYCRSVP....FKN.
Q4SKC0_TETNG/940-1053-----------------------------------------------------------EMSDLVVYCQPRS....KEKD
Q8CI86_MOUSE/590-707-----------------------------------------------------------EMSTLVNYVEPVK....FKSF
Q0UE70_PHANO/300-418-----------------------------------------------------------ELAELGVYAQSVK....PVNN
PLC1_YEAST/586-710-----------------------------------------------------------DVSNISG.IHGIK....FRNF
Q6NTX2_XENLA/945-1063-----------------------------------------------------------ELSELVIYCRPVP....FDEE
Q2UCJ8_ASPOR/565-684-----------------------------------------------------------PLSDLGVYTRGYK....WHSF
Q4QBH9_LEIMA/390-509-----------------------------------------------------------KLSAIVS.IESSK....YQGV
PLC_DICDI/538-653-----------------------------------------------------------EFEELI.YLVSHG....FKSG
Q0UVV5_PHANO/395-509-----------------------------------------------------------TLSKLGVYFGGYH....FKGL
Q4PA81_USTMA/992-1114-----------------------------------------------------------ALASLLIYTIGVK....CRGF
Q4SDX6_TETNG/473-589-----------------------------------------------------------ELSELVVYTCSVP....FKGF
A4S165_OSTLU/200-316-----------------------------------------------------------DIKALVS.LRNLK....FHGF
Q86RA6_DROVI/974-1087-----------------------------------------------------------EMSDLIIYFRSVP....FRD.
Q4RSB2_TETNG/292-409-----------------------------------------------------------ALSDLVVYTRSVK....FCSF
Q6RY08_ASTMI/926-1041-----------------------------------------------------------EFSDLIVYCRSVP....FRED
Q45UR4_NEUCS/413-527-----------------------------------------------------------SLSKMGIYTRGVS....FKSL
A7SMY6_NEMVE/399-515-----------------------------------------------------------ELSDLIVYCQPVP....FDIE
Q2HB23_CHAGB/789-908-----------------------------------------------------------VLGELGVYCMGIH....FDGF
PLCL2_HUMAN/617-734-----------------------------------------------------------ELSELVSICKSVQ....FKEF
Q59LC4_CANAL/795-913-----------------------------------------------------------ELSNLGIYTQGIK....FRNF
Q0UC00_PHANO/609-729-----------------------------------------------------------ELGTLGVYTRGVK....FTDF
Q4S959_TETNG/510-627-----------------------------------------------------------ELSDLVSLCKSVQ....FRDF
Q1LWH7_DANRE/476-593-----------------------------------------------------------ELSDCVVYCKSVH....FSSF
PLCD4_RAT/502-619-----------------------------------------------------------DLSALVVYLRTAP....FCSF
Q4RKI8_TETNG/560-677-----------------------------------------------------------ELSDLVTLCRSVR....FVDF
PLCD4_HUMAN/492-609-----------------------------------------------------------ALSSLVIYLKSVS....FRSF
O97037_HYDVU/475-592-----------------------------------------------------------EFSNIINYVESIT....FKSL
O97035_HYDVU/534-651-----------------------------------------------------------ELSELVNYFQPVH....FRGF
Q5QIB9_STRPU/494-610-----------------------------------------------------------ELSDLVT.LASVH....YGSF
A2QEJ2_ASPNC/322-436-----------------------------------------------------------ALSKLAVFTKGFH....FSNF
Q5IRA3_CRYPA/437-551-----------------------------------------------------------ALSALGIYTKAVS....FKSL
PLCD3_HUMAN/527-644-----------------------------------------------------------ELSALAVYCHATR....LRTL
Q2VYF9_9TRYP/452-571-----------------------------------------------------------KLSRLIS.IESIG....YKGV
A7TR21_VANPO/594-717-----------------------------------------------------------ELSEIAG.IQGLK....FRNF
Q6CSI9_KLULA/616-739-----------------------------------------------------------KVHEISG.IHGVR....FRNF
Q91423_9TELE/236-353-----------------------------------------------------------ELSDLVIYCKSVH....FNSF
Q013R6_OSTTA/351-466-----------------------------------------------------------DLKRIVS.VPNVK....FRSF
Q4SCY8_TETNG/264-356-----------------------------------------------------------EMSNLVIYIQPVK....FHSF
A7RPT6_NEMVE/606-723-----------------------------------------------------------HLSDLVAYTQSRA....FKGL
Q5B933_EMENI/339-453-----------------------------------------------------------SLSRHAIFTKGFS....FKQF
PLCD4_XENLA/485-602-----------------------------------------------------------ELSDCVIYCKSVP....FVSF
Q5JYS9_HUMAN/412-529-----------------------------------------------------------YLSTMINYAQPVK....FQGF
Q9XWB7_CAEEL/527-651-----------------------------------------------------------ELSAITNYMQAYETSRGVSTV
A7SDH9_NEMVE/402-519-----------------------------------------------------------ELSRCVNYISSVG....FKNF
PLCZ1_CHICK/376-493-----------------------------------------------------------GLSDLVIYTKSEK....FVSF
PLCH2_HUMAN/625-740-----------------------------------------------------------ALSDLVKYTKSVA....THDI
Q7QHE3_ANOGA/969-1085-----------------------------------------------------------EMSDLIIYCRSVP....FKHH
A7MD68_DANRE/509-626-----------------------------------------------------------ELSDLVVYCKSVH....FTSF
A7EE08_SCLS1/440-554-----------------------------------------------------------TLGKLGIYTHSEH....FVSF
A5E691_LODEL/252-371-----------------------------------------------------------VLSELGVYIQGIK....FRNF
Q6CD33_YARLI/706-822-----------------------------------------------------------ALGELGVYVQGLK....FRNF
Q2H4G2_CHAGB/404-521-----------------------------------------------------------ALSELAIYTHSQH....YTDD
PLC1_SCHPO/637-753-----------------------------------------------------------ELQQLAPYARSLK....FRNF
PLD3A_DANRE/505-621-----------------------------------------------------------ELSDLVVYCQSVP....FSGF
O97034_9METZ/947-1065-----------------------------------------------------------EMSDIIAYCRPVP....FDEN
A7SXK4_NEMVE/279-396-----------------------------------------------------------ELSQLINYISNEK....FKSF
A6RBI2_AJECN/377-491-----------------------------------------------------------SLSRLGIYTRGHT....FSKF
Q1LWW2_DANRE/14-131-----------------------------------------------------------EMSNMVVYCQSIK....KKTF
A2IB48_CHAVR/945-1060-----------------------------------------------------------EFSDLIVYCRSVP....FEPE
Q6FY00_CANGA/575-699-----------------------------------------------------------ELYELAG.LRGVK....FRNF
Q4SNU6_TETNG/496-627-----------------------------------------------------------ELSDMVIYCKSVH....FSGF

PF03009

PGC1_SCHPO/37-267DVR-------LTKDEVVCILHD..........RNLNRVFGVDV.....................DVRDLDYELDN.....
GPC1B_CAEEL/349-649DVQ-------LTKDLKTVVYHD..........FHVLVAVAGRDSPSSTPTAA...GENKSLHEIAIKDLTLAQLNLLHFE
YQIK_BACSU/7-235DVQ-------LTKDGRIVVIHD..........ERLNRTTSLKG.....................FVKDTAYDEVKTAN..
Q9RZL4_DEIRA/249-566DLV-------VTKDGVLVARHEPVIAAVDETGKVLEATTDVATRPEFRDRLTTKTLDGVKVHGYFVEDFTLAELRTLR..
Q9X1V6_THEMA/6-217DVR-------LSKDGKVVVSHD..........EDLKRLFGLDV.....................KIRDATVSELKELT..
Y2277_MYCTU/36-295TVQ-------VSSDGVPVLYRP..........SDLATLTDGAG.....................PVNSKTVQQLQQLN..
Q9RWX3_DEIRA/7-220DVR-------RLADGTLAVHHD.............AALPDGRQ......................LPHLTRAELPERV..
O07244_MYCTU/14-242DVR-------ATRDGVAVILHD..........RRLAPGVGLSG.....................AVDRLDWRDVRKAQ..
Q9SD81_ARATH/49-357DIL-------SSKDGVLICHHD..........VNLDDTTDVADHKEFADRKRTYEVQGMNMTGFFTVDFTLKELKTLG..
GPC1A_CAEEL/406-706DVQ-------LTKDRIAVIYHD..........FHVLVSVARRDGLAMPP........PMTREQLDSSNLDYHELPVKDLK
O02322_CAEEL/73-322DIQ-------ITMDGVPVICHD..........SNTVRVTGVDK.....................EISAMNITEFRKLR..
YHDW_BACSU/6-233DVQ-------LTKDRQIVVIHD..........DRVDRTTNGSG.....................FVKDFTLEELQKLD..
GDE1_SCHPO/752-1061DVQ-------MTKDMVPVVYHD..........FIVNETGTDAQ......................VHSLTLEQFLGASHS
Q45201_BORHE/38-330DIV-------LTKDNIPVIMHD..........PELDTTTNVAKLFPERA.........RENGRYYSVDFTLDELKSLSLS
Q9W2L6_DROME/349-632DVQ-------LTSDLVPIIHHD..........FSIRVCIDSKTPTSKD...........DLTEVLLKDISYEQLKDLKTY
O86738_STRCO/16-227DVR-------LTRDGVPVLLHD..........ETLKRLWQHDR.....................PLRSLSAEEVRGLT..
GDE1_YEAST/877-1212DVQ-------LTKDNVPVVYHD..........FLVAETGVDIPMHELT...........LEQFLDLNNADKEHIQRGAGH
Q9VQU3_DROME/375-661DVQ-------LSKDLVPVVYHD..........FMIYVSLKSKCSLQEH...........DFLALPMRELSLEQLKKLKVY
Q9V208_PYRAB/12-236DVW-------LTKDGKTIIMHD..........ETLDRTTNISG.....................RQKDMTLDEIKKAR..
Q9Z3F4_XANEU/274-516DVE-------VSSDGVPVLMHD..........FSIGRMAGDPQN...................RLVSQVPFAELREMP..
GLPQ1_MYCTU/17-259DVR-------LTRDGHLVCVHD..........RRLDRTSTGAG.....................LVSTMTLAQLRELE..
PGC1_YEAST/7-246DLQ-------MTSDGMVVVNHD..........SDTGRMWDKNL.....................VIGESTWEEVKRLR..
Q9RKX8_STRCO/20-243DVH-------ATRDGKLVAFHD..........GTLDRVTDGAG.....................RIADLPWENVRHAR..
Q9ZTU6_WHEAT/118-414DVQ-------VTKDGIPICMSS.........IDLMDVTTVASSQFASQAGVI...SDIKAVAGVYTFNLTWEDIANNLK.
GLPQ_BACSU/43-285DLQ-------MTKDGKLIVMHD..........EKLDRTTNGMG.....................WVKDHTLADIKKLD..
GLPQ_ECOLI/36-350DLV-------MTKDDNLVVLHD..........HYLDRVTDVADRFPDRA.........RKDGRYYAIDFTLDEIKSLKFT
GLPQ_HAEIN/40-355DLA-------MTKDGRLVVIHD..........HFLDGLTDVAKKFPYRH.........RKDGRYYVIDFTLKEIQSLEMT
Q89384_PBCV1/5-217DVR-------KTKDNIPVVFHD..........STLDRMTHSCG.....................KVKNFTLNELSNLS..
UGPQ_ECOLI/12-239DAK-------LSKDGEIFLLHD..........DNLERTSNGWG.....................VAGELNWQDLLRVD..
Q9SGA2_ARATH/39-318DVQ-------VTRDGCPIIFHD..........DFIYSEEQGVVY..................EKRVTEVCLSEFMSYGPQ
Q9YFI4_AERPE/15-220.DV-------SLKSGKPMALHG.........RPSVRRATPIGR......................LWGWIDYKLFYRD..
Q44028_CUPNE/17-245DVK-------LSADGKPVLMHD..........ATLDRTTSGQG.....................RVDALTLGELAQLD..
Q9RSP0_DEIRA/37-277DLH-------ATRDGALVLSHD..........ATLDRLTDTQG.....................RIADLTLEQVLRADAG
Q9UAW8_CAEEL/68-331DVA-------LTKDGKAVLMHD..........DDLDRTTDMKG.....................PIRDKTRAELDRCD..

PF13653

A8I2Q7_CHLRE/208-237--------------------------------------------------------------------------------
C6JG09_9FIRM/261-290--------------------------------------------------------------------------------
Q97AF5_THEVO/125-154--------------------------------------------------------------------------------
C1EA09_MICSR/311-340--------------------------------------------------------------------------------
D3R0L3_CLOB3/197-226--------------------------------------------------------------------------------
Q53JJ0_ORYSJ/166-195--------------------------------------------------------------------------------
C2HMV5_LACAI/99-128--------------------------------------------------------------------------------
B5DF39_RAT/181-210--------------------------------------------------------------------------------
B3RWH1_TRIAD/177-217--------------------------------------------------------------------------------
B6A4H5_RHILW/237-277--------------------------------------------------------------------------------
C5XX04_SORBI/147-190--------------------------------------------------------------------------------
C3KNM3_RHISN/284-318--------------------------------------------------------------------------------
A1SJR5_NOCSJ/183-212--------------------------------------------------------------------------------
C5Y879_SORBI/258-287--------------------------------------------------------------------------------
C4H5M9_YERPE/194-223--------------------------------------------------------------------------------
D2QM66_SPILD/215-245--------------------------------------------------------------------------------
Q1M8H9_RHIL3/237-277--------------------------------------------------------------------------------
D3PWH3_STANL/239-274--------------------------------------------------------------------------------
A4F9Z1_SACEN/227-262--------------------------------------------------------------------------------
A3XKX4_LEEBM/206-236--------------------------------------------------------------------------------
A8M0I4_SALAI/230-265--------------------------------------------------------------------------------
A21_LOXAR/214-243--------------------------------------------------------------------------------
C2FUE7_9SPHI/240-270--------------------------------------------------------------------------------
A4AS02_MARSH/212-242--------------------------------------------------------------------------------
B2KBC_SICCD/215-244--------------------------------------------------------------------------------
A6CED4_9PLAN/229-259--------------------------------------------------------------------------------
C7PNH8_CHIPD/228-258--------------------------------------------------------------------------------
A1H1_LOXRE/220-249--------------------------------------------------------------------------------
B1H1_LOXIN/248-277--------------------------------------------------------------------------------
C5C387_BEUC1/626-661--------------------------------------------------------------------------------
B2L2_SICCD/215-244--------------------------------------------------------------------------------
A3HWH1_9BACT/215-245--------------------------------------------------------------------------------
Q6MRA8_BDEBA/253-282--------------------------------------------------------------------------------
A6WFY1_KINRD/264-299--------------------------------------------------------------------------------
A51_LOXIN/249-278--------------------------------------------------------------------------------
A7T397_NEMVE/56-86--------------------------------------------------------------------------------
C6W5T4_DYAFD/220-250--------------------------------------------------------------------------------
A5ZJ68_9BACE/227-257--------------------------------------------------------------------------------
B312_LOXSN/215-244--------------------------------------------------------------------------------
A71_LOXAR/216-245--------------------------------------------------------------------------------
C0Y618_BURPE/135-164--------------------------------------------------------------------------------
A612_LOXHI/216-245--------------------------------------------------------------------------------
B7Q3W8_IXOSC/213-242--------------------------------------------------------------------------------
D2QQ87_SPILD/603-633--------------------------------------------------------------------------------
C7NM04_KYTSD/250-284--------------------------------------------------------------------------------
Q010C1_OSTTA/112-141--------------------------------------------------------------------------------
Q7UF88_RHOBA/253-283--------------------------------------------------------------------------------
B1Q_LOXIN/246-275--------------------------------------------------------------------------------
A3ZUF0_9PLAN/222-252--------------------------------------------------------------------------------
A21_LOXVA/216-245--------------------------------------------------------------------------------
A6EG44_9SPHI/221-251--------------------------------------------------------------------------------
A41_LOXRU/216-245--------------------------------------------------------------------------------
B1R_LOXAS/214-243--------------------------------------------------------------------------------
A1LA_LOXAR/261-290--------------------------------------------------------------------------------
C7P9S2_CHIPD/217-247--------------------------------------------------------------------------------
B7QFM3_IXOSC/67-96--------------------------------------------------------------------------------
A412_LOXHI/219-248--------------------------------------------------------------------------------
B9XKB9_9BACT/233-263--------------------------------------------------------------------------------
E8W4Q9_STRFA/244-279--------------------------------------------------------------------------------
SMD_IXOSC/243-272--------------------------------------------------------------------------------
A312_LOXS4/219-248--------------------------------------------------------------------------------
B1S_LOXAS/217-246--------------------------------------------------------------------------------
A6EG56_9SPHI/219-249--------------------------------------------------------------------------------
A21_LOXSP/213-242--------------------------------------------------------------------------------
A1OB2_LOXVA/213-242--------------------------------------------------------------------------------
A5FEV6_FLAJ1/213-243--------------------------------------------------------------------------------
D7VYF5_9FLAO/219-249--------------------------------------------------------------------------------
Q4Z7T4_PLABA/27-60--------------------------------------------------------------------------------
A424_LOXLA/217-246--------------------------------------------------------------------------------
B9GJW3_POPTR/78-121--------------------------------------------------------------------------------
B7PW58_IXOSC/226-255--------------------------------------------------------------------------------
B1LB_SICPE/216-245--------------------------------------------------------------------------------
C6W721_DYAFD/221-251--------------------------------------------------------------------------------

PF00388

Q60450_CRIGR/286-429DCW.......DGPNQ...E...----------------------------------------------------------
A4I5X4_LEIIN/300-441DCW.......DGKDN...D...----------------------------------------------------------
Q8IJR0_PLAF7/626-770DCY.......YFNKN.......----------------------------------------------------------
PLC_STAAE/34-177RGR.......ASADN...M...----------------------------------------------------------
Q6BZ51_DEBHA/455-607DIW.......DGYID...GMDD----------------------------------------------------------
PLCG2_MOUSE/314-457DCW.......DGPDG...K...----------------------------------------------------------
PLCL1_HUMAN/400-543DVS.......DGSDN...E...----------------------------------------------------------
PLCD9_ARATH/109-254DLL......PFGKDG.......----------------------------------------------------------
PLCD1_ARATH/107-250DLW......PNSSGK...E...----------------------------------------------------------
PLCD6_ARATH/139-282DLW......PNSTGT...D...----------------------------------------------------------
A5DAA1_PICGU/440-595DIW.......DGMSI...DGDL----------------------------------------------------------
Q636S2_BACCZ/57-195RGR.......LTDDN...T...----------------------------------------------------------
A7MD68_DANRE/316-460DIW.......DGANG...E...----------------------------------------------------------
PLCD4_RAT/292-436DTW.......DGPDG...E...----------------------------------------------------------
Q0PGC0_LISMN/61-200RAK..........DN.......----------------------------------------------------------
PLCZ1_BOVIN/157-300DCW.......DGSQN...E...----------------------------------------------------------
Q55WA1_CRYNB/160-302DVQ.......SGDVE.......----------------------------------------------------------
Q2YGU1_LILDA/57-200DLW......PNSTKD...N...----------------------------------------------------------
PLCD3_ARATH/108-251DLW......PNPSGN...A...----------------------------------------------------------
Q5JYS9_HUMAN/151-300DCW.......DGKGED.QE...----------------------------------------------------------
O97034_9METZ/308-451DCW.......DGPDG...N...----------------------------------------------------------
A5E691_LODEL/21-192DVW.......DGSGG...GASS----------------------------------------------------------
Q16W08_AEDAE/315-464DCW.......DGKGED.EE...----------------------------------------------------------
PLCD5_ARATH/114-257DMW......PNSTKD...D...----------------------------------------------------------
Q5QIB9_STRPU/301-444DCW.......DGPDN...D...----------------------------------------------------------
Q6CSI9_KLULA/402-540DIW.......QGDHG.......----------------------------------------------------------
A0FLF3_TOBAC/111-253DIW......PNSAKD...D...----------------------------------------------------------
O97037_HYDVU/300-443DCY.......DGENN...E...----------------------------------------------------------
PLCD3_HUMAN/339-483DCW.......EGPGG...E...----------------------------------------------------------
Q385H1_TRYB2/248-393DCW.......DGRKG...Q...----------------------------------------------------------
Q3TWI4_MOUSE/319-469DVW.......KGRPPE.EE...----------------------------------------------------------
P93620_VIGUN/106-249DLW......PNSNKD...D...----------------------------------------------------------
A2TF43_9LAMI/114-257DMW......PNSTKD...D...----------------------------------------------------------
Q16ZC0_AEDAE/42-189DCW.......DGDDG...T...----------------------------------------------------------
Q4S9T4_TETNG/359-525GVT.......DGPEG...EPLL----------------------------------------------------------
O49950_SOLTU/113-256DMW......PNSSKD...N...----------------------------------------------------------
Q4S530_TETNG/241-384DCW.......DGPNG...E...----------------------------------------------------------
PLCH1_HUMAN/301-445DCW.......DGPDG...E...----------------------------------------------------------
Q45UQ8_NEUCS/110-360DVW.......DGSDS...ESED----------------------------------------------------------
Q4SKC0_TETNG/309-451DCW.......EGP.G...E...----------------------------------------------------------
A2QEJ2_ASPNC/86-262DVW.......DGKAE....GFL----------------------------------------------------------
Q4N7P5_THEPA/468-615DCQ.......DGAEE.......----------------------------------------------------------
A7S279_NEMVE/319-466DCW.......DGQND...E...----------------------------------------------------------
PLC_DICDI/324-466DVW.......DGNDG...D...----------------------------------------------------------
Q5BFL6_EMENI/534-676DCW.......DGADG...R...----------------------------------------------------------
Q2HB23_CHAGB/553-696DCW.......DGEGN...Q...----------------------------------------------------------
A6RBI2_AJECN/84-320DVW.......DGEPD...SSDS----------------------------------------------------------
Q1LWH7_DANRE/284-423DCW.......DGPNG...E...----------------------------------------------------------
A0CKY8_PARTE/271-413DCW.......DSISD...R...----------------------------------------------------------
Q3UZ68_MOUSE/210-353DCW.......DGPDG...M...----------------------------------------------------------
Q5CLA7_CRYHO/367-509DVW.......NGPDG...L...----------------------------------------------------------
E9AEI1_LEIMA/296-447DCW.......DGPAG...V...----------------------------------------------------------
Q91423_9TELE/46-190DCW.......DGPNG...E...----------------------------------------------------------
Q9XWB7_CAEEL/306-468DMW.......DNKDK...DG..----------------------------------------------------------
Q8IA75_CAEEL/367-517DIW.......DPNEA...DGD.----------------------------------------------------------
PLC1_YEAST/382-521DIW.......DGENG.......----------------------------------------------------------
Q4SCY8_TETNG/29-191DCW.......KGRTTE.EE...----------------------------------------------------------
PLCE1_HUMAN/1394-1541DCW.......DGDDG...M...----------------------------------------------------------
Q6QAF2_LYTPI/318-467DCW.......DGRSED.QE...----------------------------------------------------------
A7RXP6_NEMVE/244-393DCW.......DGKTED.QE...----------------------------------------------------------
Q2QNK1_ORYSJ/114-257DMW......PNSAKN...N...----------------------------------------------------------
Q7QHE3_ANOGA/319-462DCW.......DGPDN...M...----------------------------------------------------------
A0BLC4_PARTE/285-429DCW.......DGDNN...Q...----------------------------------------------------------
Q6FY00_CANGA/381-519DMW.......DGESS.......----------------------------------------------------------
A0BLM0_PARTE/262-404DCW.......DGEDG...E...----------------------------------------------------------
Q59LC4_CANAL/566-727DIW.......NGDSN...TTTT----------------------------------------------------------
Q4T850_TETNG/115-259DCW.......DGPDG...E...----------------------------------------------------------
Q9FSW1_9POAL/148-291DIW......PNSSKD...D...----------------------------------------------------------
Q2UPV6_ASPOR/98-321DVW.......DGERS...SESA----------------------------------------------------------
O97035_HYDVU/328-477DCW.......DGKTEE.QE...----------------------------------------------------------
Q4PDE8_USTMA/122-279DAW.......DNEDD...PQ..----------------------------------------------------------
Q9XEK4_BRANA/105-249DIW......PNSNKN...D...----------------------------------------------------------
A7T501_NEMVE/158-302DCW.......DGKDG...E...----------------------------------------------------------
Q4RWH6_TETNG/299-443DCW.......DGDRG...E...----------------------------------------------------------
A5A2F9_TOBAC/110-253DIW......PNSDKD...D...----------------------------------------------------------
A7ASE0_BABBO/522-670DCQ.......DGPNG...E...----------------------------------------------------------
Q7ZU40_DANRE/294-438DCW.......DGSDG...E...----------------------------------------------------------
Q45QJ6_RAT/314-464DCW.......KGKPPD.EE...----------------------------------------------------------
Q0B816_BURCM/28-162RCR.......HRCDT.......----------------------------------------------------------
Q4PA81_USTMA/724-872DCW.......DGPNN...V...----------------------------------------------------------
A7TR21_VANPO/381-520DIW.......DDENG.......----------------------------------------------------------
Q75C92_ASHGO/397-535DIW.......DSDDG.......----------------------------------------------------------
A7RPQ0_NEMVE/307-450DCW.......DGPYD...E...----------------------------------------------------------
Q5MG88_TOXGO/407-550DCW.......DGSDG...E...----------------------------------------------------------
A7SXK4_NEMVE/94-237DCW.......DGDDE...E...----------------------------------------------------------
PHLC_TRYBB/54-199RMN......ISPDQE...NK..----------------------------------------------------------
Q4S9B8_TETNG/321-464DVW.......DGPDG...E...----------------------------------------------------------
O07690_LISSE/61-200RAK..........ED.......----------------------------------------------------------
A4S165_OSTLU/1-153DCY.......DGGSK...G...----------------------------------------------------------
Q7PW25_ANOGA/289-436DFW.......NGRTE...E...----------------------------------------------------------
Q4SDX6_TETNG/287-431DCW.......DGDKG...E...----------------------------------------------------------
A7RKT2_NEMVE/272-413DIW.......DGPDE.......----------------------------------------------------------
Q4RKI8_TETNG/349-492DVW.......DGSDG...E...----------------------------------------------------------
Q766D4_9BRYO/108-251DLW......PDDKGG.......----------------------------------------------------------
Q2PEW5_TRIPR/126-269DIW......PNASKE...D...----------------------------------------------------------
A6RM87_BOTFB/546-665......................----------------------------------------------------------
Q4RX70_TETNG/314-458DCW.......DGPDG...E...----------------------------------------------------------
A3LSB2_PICST/461-615DVW.......DGEVA...ESEE----------------------------------------------------------
A4EAJ4_9ACTN/13-159RLG.......KNDDK...G...----------------------------------------------------------
A3LNB7_PICST/20-167RAGRQLIKNDDPKQE.......----------------------------------------------------------
Q6R6E0_LISIV/61-201RAK..........ED.......----------------------------------------------------------
Q24284_DROME/320-463DCW.......NGPDN...L...----------------------------------------------------------
PLCH2_HUMAN/328-472DCW.......DGPDG...E...----------------------------------------------------------
Q0UVV5_PHANO/116-337DVW.......DGEPP...SDSS----------------------------------------------------------
Q4QBH9_LEIMA/195-340ICR.......NGPHG...E...----------------------------------------------------------
PLCD4_HUMAN/292-436DVW.......DGPSG...E...----------------------------------------------------------
Q0UE70_PHANO/101-258DAW.......DNDDN...KE..----------------------------------------------------------
A5AGR6_VITVI/112-255DMW......PNSTKD...D...----------------------------------------------------------
B9DGG5_ARATH/8-150DLW......PRGTDD.......----------------------------------------------------------
Q4RLM8_TETNG/312-491DCW.......KGKPPD.EE...----------------------------------------------------------
PLCL2_MOUSE/429-572DVW.......DGPDN...E...----------------------------------------------------------
PLCZ1_CHICK/159-303DCW.......DGSNN...D...----------------------------------------------------------
A2IB48_CHAVR/321-464DCW.......DGPDN...L...----------------------------------------------------------
PLCD4_XENLA/292-436DTW.......DGPNG...E...----------------------------------------------------------
Q3F156_BACTI/43-187RVK.......RVKDS.......----------------------------------------------------------
Q2GUM5_CHAGB/104-264DAW.......DNPDN...CT..----------------------------------------------------------
Q7SE08_NEUCR/136-356DVW.......NGAPS...RTPS----------------------------------------------------------
Q21754_CAEEL/318-461DLF.......DGEHG...E...----------------------------------------------------------
Q9GV33_WATSC/324-471DCW.......DGKDG...E...----------------------------------------------------------
A7SDH9_NEMVE/209-352DCW.......DGDNG...D...----------------------------------------------------------
Q6EZG7_CAEEL/342-492DCW.......DGTGENKGE...----------------------------------------------------------
Q6RY08_ASTMI/305-448DCW.......DGPEG...M...----------------------------------------------------------
A4HCK9_LEIBR/248-393DCW.......NGPHG...E...----------------------------------------------------------
Q236T7_TETTS/368-513YCQ.......DGESG...V...----------------------------------------------------------
Q9P866_CANAX/68-213RVGKLF.VGNDVKDL.......----------------------------------------------------------
O97036_HYDVU/314-460DCW.......DGPGV.......----------------------------------------------------------
O97033_9METZ/324-472DLW......PEGEDI.......----------------------------------------------------------
PLC1_SCHPO/443-585DCW.......DGPNG.......----------------------------------------------------------
A6AS90_VIBHA/22-157RVK...................----------------------------------------------------------
Q013R6_OSTTA/119-269DVY.......DGKKR...GDK.----------------------------------------------------------
Q75IL8_ORYSJ/119-262DLW......PNAAKD...A...----------------------------------------------------------
O96101_TRYCR/248-393DCW.......DGFAG...E...----------------------------------------------------------
A6EGD5_9SPHI/56-190RCR.......HIDNA.......----------------------------------------------------------
PLCD8_ARATH/107-248DLW......PDGRGS.......----------------------------------------------------------
Q4S959_TETNG/321-464IVW.......DGPDN...E...----------------------------------------------------------
Q762E2_9BRYO/150-294DCW.......NGSNK...R...----------------------------------------------------------
Q4RSB2_TETNG/98-242DCW.......DGADM...E...----------------------------------------------------------
Q6CD33_YARLI/505-648DIW.......DGPDD...R...----------------------------------------------------------
A7UXE0_NEUCR/117-274DVW.......DNPDN...LD..----------------------------------------------------------
A1D7Q8_NEOFI/96-331DVW.......DGDAD...DDSV----------------------------------------------------------

PF00387

PLCD1_MOUSE/491-609SSP-----------------------------------------------------------------------------
Q29N33_DROPS/566-683ENA-----------------------------------------------------------------------------
PLCG2_HUMAN/929-1044NL.-----------------------------------------------------------------------------
PIPA_DROME/549-666DKA-----------------------------------------------------------------------------
Q6BZ51_DEBHA/661-779SLP-----------------------------------------------------------------------------
PLCH1_HUMAN/600-714VD.-----------------------------------------------------------------------------
A5DAA1_PICGU/647-765SLP-----------------------------------------------------------------------------
A7RXP6_NEMVE/449-566DV.-----------------------------------------------------------------------------
A7RPQ0_NEMVE/491-608QY.-----------------------------------------------------------------------------
Q7ZU40_DANRE/483-600ED.-----------------------------------------------------------------------------
PLCB2_MOUSE/546-663EF.-----------------------------------------------------------------------------
PLCL1_RAT/585-702EL.-----------------------------------------------------------------------------
Q4T850_TETNG/440-554LNE-----------------------------------------------------------------------------
Q55WA1_CRYNB/353-467SKL-----------------------------------------------------------------------------
O96101_TRYCR/462-581SDM-----------------------------------------------------------------------------
P78585_BOTFU/650-769DDP-----------------------------------------------------------------------------
Q75C92_ASHGO/591-714SLP-----------------------------------------------------------------------------
PLCZ1_MACFA/381-498QH.-----------------------------------------------------------------------------
Q4RX70_TETNG/609-725ETQ-----------------------------------------------------------------------------
Q08JX0_ORYLA/549-666DN.-----------------------------------------------------------------------------
O97033_9METZ/764-881EA.-----------------------------------------------------------------------------
Q25285_LOLFO/513-630EQ.-----------------------------------------------------------------------------
A3LSB2_PICST/669-787SLP-----------------------------------------------------------------------------
A1D7Q8_NEOFI/374-488TQP-----------------------------------------------------------------------------
Q17CT3_AEDAE/941-1054.S.-----------------------------------------------------------------------------
Q4SKC0_TETNG/940-1053RF.-----------------------------------------------------------------------------
Q8CI86_MOUSE/590-707EA.-----------------------------------------------------------------------------
Q0UE70_PHANO/300-418SWF-----------------------------------------------------------------------------
PLC1_YEAST/586-710SLP-----------------------------------------------------------------------------
Q6NTX2_XENLA/945-1063KI.-----------------------------------------------------------------------------
Q2UCJ8_ASPOR/565-684SSA-----------------------------------------------------------------------------
Q4QBH9_LEIMA/390-509KDL-----------------------------------------------------------------------------
PLC_DICDI/538-653N..-----------------------------------------------------------------------------
Q0UVV5_PHANO/395-509DTP-----------------------------------------------------------------------------
Q4PA81_USTMA/992-1114NKK-----------------------------------------------------------------------------
Q4SDX6_TETNG/473-589EQ.-----------------------------------------------------------------------------
A4S165_OSTLU/200-316KEA-----------------------------------------------------------------------------
Q86RA6_DROVI/974-1087.H.-----------------------------------------------------------------------------
Q4RSB2_TETNG/292-409TH.-----------------------------------------------------------------------------
Q6RY08_ASTMI/926-1041NI.-----------------------------------------------------------------------------
Q45UR4_NEUCS/413-527MQP-----------------------------------------------------------------------------
A7SMY6_NEMVE/399-515NL.-----------------------------------------------------------------------------
Q2HB23_CHAGB/789-908DSP-----------------------------------------------------------------------------
PLCL2_HUMAN/617-734QV.-----------------------------------------------------------------------------
Q59LC4_CANAL/795-913SLP-----------------------------------------------------------------------------
Q0UC00_PHANO/609-729GCT-----------------------------------------------------------------------------
Q4S959_TETNG/510-627EI.-----------------------------------------------------------------------------
Q1LWH7_DANRE/476-593KH.-----------------------------------------------------------------------------
PLCD4_RAT/502-619TH.-----------------------------------------------------------------------------
Q4RKI8_TETNG/560-677PT.-----------------------------------------------------------------------------
PLCD4_HUMAN/492-609TH.-----------------------------------------------------------------------------
O97037_HYDVU/475-592DE.-----------------------------------------------------------------------------
O97035_HYDVU/534-651EK.-----------------------------------------------------------------------------
Q5QIB9_STRPU/494-610PA.-----------------------------------------------------------------------------
A2QEJ2_ASPNC/322-436AQP-----------------------------------------------------------------------------
Q5IRA3_CRYPA/437-551HQP-----------------------------------------------------------------------------
PLCD3_HUMAN/527-644HP.-----------------------------------------------------------------------------
Q2VYF9_9TRYP/452-571EDL-----------------------------------------------------------------------------
A7TR21_VANPO/594-717SLP-----------------------------------------------------------------------------
Q6CSI9_KLULA/616-739SLP-----------------------------------------------------------------------------
Q91423_9TELE/236-353EH.-----------------------------------------------------------------------------
Q013R6_OSTTA/351-466HEA-----------------------------------------------------------------------------
Q4SCY8_TETNG/264-356EA.-----------------------------------------------------------------------------
A7RPT6_NEMVE/606-723EVE-----------------------------------------------------------------------------
Q5B933_EMENI/339-453SQP-----------------------------------------------------------------------------
PLCD4_XENLA/485-602QH.-----------------------------------------------------------------------------
Q5JYS9_HUMAN/412-529HV.-----------------------------------------------------------------------------
Q9XWB7_CAEEL/527-651VNL-----------------------------------------------------------------------------
A7SDH9_NEMVE/402-519EH.-----------------------------------------------------------------------------
PLCZ1_CHICK/376-493EH.-----------------------------------------------------------------------------
PLCH2_HUMAN/625-740EME-----------------------------------------------------------------------------
Q7QHE3_ANOGA/969-1085PA.-----------------------------------------------------------------------------
A7MD68_DANRE/509-626EQ.-----------------------------------------------------------------------------
A7EE08_SCLS1/440-554DVG-----------------------------------------------------------------------------
A5E691_LODEL/252-371SLP-----------------------------------------------------------------------------
Q6CD33_YARLI/706-822AFP-----------------------------------------------------------------------------
Q2H4G2_CHAGB/404-521SSL-----------------------------------------------------------------------------
PLC1_SCHPO/637-753SLP-----------------------------------------------------------------------------
PLD3A_DANRE/505-621ET.-----------------------------------------------------------------------------
O97034_9METZ/947-1065KM.-----------------------------------------------------------------------------
A7SXK4_NEMVE/279-396IE.-----------------------------------------------------------------------------
A6RBI2_AJECN/377-491SQQ-----------------------------------------------------------------------------
Q1LWW2_DANRE/14-131ENY-----------------------------------------------------------------------------
A2IB48_CHAVR/945-1060KA.-----------------------------------------------------------------------------
Q6FY00_CANGA/575-699SLP-----------------------------------------------------------------------------
Q4SNU6_TETNG/496-627ED.-----------------------------------------------------------------------------

PF03009

PGC1_SCHPO/37-267..............................................GHFRTIQEPHEPL.....................
GPC1B_CAEEL/349-649HI......................................SRANGSSAESPVALSVTPSKTETD.............ELH
YQIK_BACSU/7-235.............................................AAAGHDQAYSDIKV.....................
Q9RZL4_DEIRA/249-566..............................................AVERLPQLRGKAYDGQ..................
Q9X1V6_THEMA/6-217...............................................DG.......KIT.....................
Y2277_MYCTU/36-295............................................AGWNFTTPGVEGHPYRQR.................A
Q9RWX3_DEIRA/7-220................................................................................
O07244_MYCTU/14-242.............................................LGAGQSIPTLEDLL.....................
Q9SD81_ARATH/49-357..............................................AKQR.YPFRDQQYNGK..................
GPC1A_CAEEL/406-706LSQLKLL.............................MLDHLSFPQ.KKENVKKLVEAG..EEEE..............DF
O02322_CAEEL/73-322............................................FIGTNVSLPTFEEAVA....................
YHDW_BACSU/6-233.............................................AGSWYGPAFQGERI.....................
GDE1_SCHPO/752-1061PSEEIKDDASDIQQKRRPRAYSSSFTPSGSQVNFGEFAEENARLKP.KVYKGNALGHTICA...................
Q45201_BORHE/38-330E.........................................RFDPASRN..PIYPNRFPLNE...............HD
Q9W2L6_DROME/349-632...........................................QIVGNKIVEYPAHNNVEPPE................Q
O86738_STRCO/16-227...............................................AGG..............................
GDE1_YEAST/877-1212SPHHVNGADTALQKYRGRS.....VDDSDVSTLRRAWDLHDNDPNG.KSNNAHWSDNRMRLTKTFKKNNFKGNARGHSIA
Q9VQU3_DROME/375-661H.........................................IAEGLSRETRSFHNDDC.LE.................H
Q9V208_PYRAB/12-236.....................................................VSGQEV.....................
Q9Z3F4_XANEU/274-516...............................................LVIRNPSDGNYV.....................
GLPQ1_MYCTU/17-259.............................................YGAWH.DSWRPDGSHGD..................
PGC1_YEAST/7-246...............................................CKEDGSLAMMTLK....................
Q9RKX8_STRCO/20-243.............................................VAGEEPVPLFEELL.....................
Q9ZTU6_WHEAT/118-414............................................PMISNPFGQISLSRNPRNR...............NA
GLPQ_BACSU/43-285.............................................AGSWFNEAYPEKAKPQYV................G
GLPQ_ECOLI/36-350E.........................................GFDIENGKKVQTYPGRFPMGK...............SD
GLPQ_HAEIN/40-355E.........................................NFETKDGKQAQVYPNRFPLWK...............SH
Q89384_PBCV1/5-217...............................................IRN....STEKI.....................
UGPQ_ECOLI/12-239.............................................AGSWYSKMFKGEPL.....................
Q9SGA2_ARATH/39-318R........................................DTGKTGKPLLRKSKEGKIHKWSV.............ATD
Q9YFI4_AERPE/15-220................................................................................
Q44028_CUPNE/17-245.............................................AGTWHSPAFAGEPV.....................
Q9RSP0_DEIRA/37-277Y.........................................TLTPAGGSGFPFRGQGVQ....................
Q9UAW8_CAEEL/68-331.............................................ISATFKRTAPGDHCRLATV..............SR

PF13653

A8I2Q7_CHLRE/208-237--------------------------------------------------------------------------------
C6JG09_9FIRM/261-290--------------------------------------------------------------------------------
Q97AF5_THEVO/125-154--------------------------------------------------------------------------------
C1EA09_MICSR/311-340--------------------------------------------------------------------------------
D3R0L3_CLOB3/197-226--------------------------------------------------------------------------------
Q53JJ0_ORYSJ/166-195--------------------------------------------------------------------------------
C2HMV5_LACAI/99-128--------------------------------------------------------------------------------
B5DF39_RAT/181-210--------------------------------------------------------------------------------
B3RWH1_TRIAD/177-217--------------------------------------------------------------------------------
B6A4H5_RHILW/237-277--------------------------------------------------------------------------------
C5XX04_SORBI/147-190--------------------------------------------------------------------------------
C3KNM3_RHISN/284-318--------------------------------------------------------------------------------
A1SJR5_NOCSJ/183-212--------------------------------------------------------------------------------
C5Y879_SORBI/258-287--------------------------------------------------------------------------------
C4H5M9_YERPE/194-223--------------------------------------------------------------------------------
D2QM66_SPILD/215-245--------------------------------------------------------------------------------
Q1M8H9_RHIL3/237-277--------------------------------------------------------------------------------
D3PWH3_STANL/239-274--------------------------------------------------------------------------------
A4F9Z1_SACEN/227-262--------------------------------------------------------------------------------
A3XKX4_LEEBM/206-236--------------------------------------------------------------------------------
A8M0I4_SALAI/230-265--------------------------------------------------------------------------------
A21_LOXAR/214-243--------------------------------------------------------------------------------
C2FUE7_9SPHI/240-270--------------------------------------------------------------------------------
A4AS02_MARSH/212-242--------------------------------------------------------------------------------
B2KBC_SICCD/215-244--------------------------------------------------------------------------------
A6CED4_9PLAN/229-259--------------------------------------------------------------------------------
C7PNH8_CHIPD/228-258--------------------------------------------------------------------------------
A1H1_LOXRE/220-249--------------------------------------------------------------------------------
B1H1_LOXIN/248-277--------------------------------------------------------------------------------
C5C387_BEUC1/626-661--------------------------------------------------------------------------------
B2L2_SICCD/215-244--------------------------------------------------------------------------------
A3HWH1_9BACT/215-245--------------------------------------------------------------------------------
Q6MRA8_BDEBA/253-282--------------------------------------------------------------------------------
A6WFY1_KINRD/264-299--------------------------------------------------------------------------------
A51_LOXIN/249-278--------------------------------------------------------------------------------
A7T397_NEMVE/56-86--------------------------------------------------------------------------------
C6W5T4_DYAFD/220-250--------------------------------------------------------------------------------
A5ZJ68_9BACE/227-257--------------------------------------------------------------------------------
B312_LOXSN/215-244--------------------------------------------------------------------------------
A71_LOXAR/216-245--------------------------------------------------------------------------------
C0Y618_BURPE/135-164--------------------------------------------------------------------------------
A612_LOXHI/216-245--------------------------------------------------------------------------------
B7Q3W8_IXOSC/213-242--------------------------------------------------------------------------------
D2QQ87_SPILD/603-633--------------------------------------------------------------------------------
C7NM04_KYTSD/250-284--------------------------------------------------------------------------------
Q010C1_OSTTA/112-141--------------------------------------------------------------------------------
Q7UF88_RHOBA/253-283--------------------------------------------------------------------------------
B1Q_LOXIN/246-275--------------------------------------------------------------------------------
A3ZUF0_9PLAN/222-252--------------------------------------------------------------------------------
A21_LOXVA/216-245--------------------------------------------------------------------------------
A6EG44_9SPHI/221-251--------------------------------------------------------------------------------
A41_LOXRU/216-245--------------------------------------------------------------------------------
B1R_LOXAS/214-243--------------------------------------------------------------------------------
A1LA_LOXAR/261-290--------------------------------------------------------------------------------
C7P9S2_CHIPD/217-247--------------------------------------------------------------------------------
B7QFM3_IXOSC/67-96--------------------------------------------------------------------------------
A412_LOXHI/219-248--------------------------------------------------------------------------------
B9XKB9_9BACT/233-263--------------------------------------------------------------------------------
E8W4Q9_STRFA/244-279--------------------------------------------------------------------------------
SMD_IXOSC/243-272--------------------------------------------------------------------------------
A312_LOXS4/219-248--------------------------------------------------------------------------------
B1S_LOXAS/217-246--------------------------------------------------------------------------------
A6EG56_9SPHI/219-249--------------------------------------------------------------------------------
A21_LOXSP/213-242--------------------------------------------------------------------------------
A1OB2_LOXVA/213-242--------------------------------------------------------------------------------
A5FEV6_FLAJ1/213-243--------------------------------------------------------------------------------
D7VYF5_9FLAO/219-249--------------------------------------------------------------------------------
Q4Z7T4_PLABA/27-60--------------------------------------------------------------------------------
A424_LOXLA/217-246--------------------------------------------------------------------------------
B9GJW3_POPTR/78-121--------------------------------------------------------------------------------
B7PW58_IXOSC/226-255--------------------------------------------------------------------------------
B1LB_SICPE/216-245--------------------------------------------------------------------------------
C6W721_DYAFD/221-251--------------------------------------------------------------------------------

PF00388

Q60450_CRIGR/286-429----------------................................................................
A4I5X4_LEIIN/300-441----------------................................................................
Q8IJR0_PLAF7/626-770----------------................................................................
PLC_STAAE/34-177----------------................................................................
Q6BZ51_DEBHA/455-607----------------ND..............................................................
PLCG2_MOUSE/314-457----------------................................................................
PLCL1_HUMAN/400-543----------------................................................................
PLCD9_ARATH/109-254----------------................................................................
PLCD1_ARATH/107-250----------------................................................................
PLCD6_ARATH/139-282----------------................................................................
A5DAA1_PICGU/440-595----------------DNN.............................................................
Q636S2_BACCZ/57-195----------------................................................................
A7MD68_DANRE/316-460----------------................................................................
PLCD4_RAT/292-436----------------................................................................
Q0PGC0_LISMN/61-200----------------................................................................
PLCZ1_BOVIN/157-300----------------................................................................
Q55WA1_CRYNB/160-302----------------................................................................
Q2YGU1_LILDA/57-200----------------................................................................
PLCD3_ARATH/108-251----------------................................................................
Q5JYS9_HUMAN/151-300----------------................................................................
O97034_9METZ/308-451----------------................................................................
A5E691_LODEL/21-192----------------LVLDGNSANTN.....................................................
Q16W08_AEDAE/315-464----------------................................................................
PLCD5_ARATH/114-257----------------................................................................
Q5QIB9_STRPU/301-444----------------................................................................
Q6CSI9_KLULA/402-540----------------................................................................
A0FLF3_TOBAC/111-253----------------................................................................
O97037_HYDVU/300-443----------------................................................................
PLCD3_HUMAN/339-483----------------................................................................
Q385H1_TRYB2/248-393----------------................................................................
Q3TWI4_MOUSE/319-469----------------................................................................
P93620_VIGUN/106-249----------------................................................................
A2TF43_9LAMI/114-257----------------................................................................
Q16ZC0_AEDAE/42-189----------------................................................................
Q4S9T4_TETNG/359-525----------------G...............................................................
O49950_SOLTU/113-256----------------................................................................
Q4S530_TETNG/241-384----------------................................................................
PLCH1_HUMAN/301-445----------------................................................................
Q45UQ8_NEUCS/110-360----------------DDGDAESVTSSSSSSSDDAYGSGEEGTASKLKRKAKSKLPSFLGGRKKSKDKKVPEPTTTTPPA
Q4SKC0_TETNG/309-451----------------................................................................
A2QEJ2_ASPNC/86-262----------------GHHKPSTSSGSSG...................................................
Q4N7P5_THEPA/468-615----------------................................................................
A7S279_NEMVE/319-466----------------................................................................
PLC_DICDI/324-466----------------................................................................
Q5BFL6_EMENI/534-676----------------................................................................
Q2HB23_CHAGB/553-696----------------................................................................
A6RBI2_AJECN/84-320----------------SASESDHGDPKVPQKNPKKNGKDRKGGTFNLSSLSNQLDR......................LS
Q1LWH7_DANRE/284-423----------------................................................................
A0CKY8_PARTE/271-413----------------................................................................
Q3UZ68_MOUSE/210-353----------------................................................................
Q5CLA7_CRYHO/367-509----------------................................................................
E9AEI1_LEIMA/296-447----------------................................................................
Q91423_9TELE/46-190----------------................................................................
Q9XWB7_CAEEL/306-468----------------................................................................
Q8IA75_CAEEL/367-517----------------................................................................
PLC1_YEAST/382-521----------------................................................................
Q4SCY8_TETNG/29-191----------------................................................................
PLCE1_HUMAN/1394-1541----------------................................................................
Q6QAF2_LYTPI/318-467----------------................................................................
A7RXP6_NEMVE/244-393----------------................................................................
Q2QNK1_ORYSJ/114-257----------------................................................................
Q7QHE3_ANOGA/319-462----------------................................................................
A0BLC4_PARTE/285-429----------------................................................................
Q6FY00_CANGA/381-519----------------................................................................
A0BLM0_PARTE/262-404----------------................................................................
Q59LC4_CANAL/566-727----------------TVIGTK..........................................................
Q4T850_TETNG/115-259----------------................................................................
Q9FSW1_9POAL/148-291----------------................................................................
Q2UPV6_ASPOR/98-321----------------SADDTSSSSSDSISERKIKQGSKRERLKSMAKRHSR............................
O97035_HYDVU/328-477----------------................................................................
Q4PDE8_USTMA/122-279----------------................................................................
Q9XEK4_BRANA/105-249----------------................................................................
A7T501_NEMVE/158-302----------------................................................................
Q4RWH6_TETNG/299-443----------------................................................................
A5A2F9_TOBAC/110-253----------------................................................................
A7ASE0_BABBO/522-670----------------................................................................
Q7ZU40_DANRE/294-438----------------................................................................
Q45QJ6_RAT/314-464----------------................................................................
Q0B816_BURCM/28-162----------------................................................................
Q4PA81_USTMA/724-872----------------................................................................
A7TR21_VANPO/381-520----------------................................................................
Q75C92_ASHGO/397-535----------------................................................................
A7RPQ0_NEMVE/307-450----------------................................................................
Q5MG88_TOXGO/407-550----------------................................................................
A7SXK4_NEMVE/94-237----------------................................................................
PHLC_TRYBB/54-199----------------................................................................
Q4S9B8_TETNG/321-464----------------................................................................
O07690_LISSE/61-200----------------................................................................
A4S165_OSTLU/1-153----------------................................................................
Q7PW25_ANOGA/289-436----------------................................................................
Q4SDX6_TETNG/287-431----------------................................................................
A7RKT2_NEMVE/272-413----------------................................................................
Q4RKI8_TETNG/349-492----------------................................................................
Q766D4_9BRYO/108-251----------------................................................................
Q2PEW5_TRIPR/126-269----------------................................................................
A6RM87_BOTFB/546-665----------------................................................................
Q4RX70_TETNG/314-458----------------................................................................
A3LSB2_PICST/461-615----------------GVQ.............................................................
A4EAJ4_9ACTN/13-159----------------................................................................
A3LNB7_PICST/20-167----------------................................................................
Q6R6E0_LISIV/61-201----------------................................................................
Q24284_DROME/320-463----------------................................................................
PLCH2_HUMAN/328-472----------------................................................................
Q0UVV5_PHANO/116-337----------------SDEEEMQKYGAPKVEKKNKDKKEKLSLRKRLELR..............................
Q4QBH9_LEIMA/195-340----------------................................................................
PLCD4_HUMAN/292-436----------------................................................................
Q0UE70_PHANO/101-258----------------................................................................
A5AGR6_VITVI/112-255----------------................................................................
B9DGG5_ARATH/8-150----------------................................................................
Q4RLM8_TETNG/312-491----------------................................................................
PLCL2_MOUSE/429-572----------------................................................................
PLCZ1_CHICK/159-303----------------................................................................
A2IB48_CHAVR/321-464----------------................................................................
PLCD4_XENLA/292-436----------------................................................................
Q3F156_BACTI/43-187----------------................................................................
Q2GUM5_CHAGB/104-264----------------................................................................
Q7SE08_NEUCR/136-356----------------KSPNGEHRRHISNVSAMSRTSVRHGSSLSVDQPG..............................
Q21754_CAEEL/318-461----------------................................................................
Q9GV33_WATSC/324-471----------------................................................................
A7SDH9_NEMVE/209-352----------------................................................................
Q6EZG7_CAEEL/342-492----------------................................................................
Q6RY08_ASTMI/305-448----------------................................................................
A4HCK9_LEIBR/248-393----------------................................................................
Q236T7_TETTS/368-513----------------................................................................
Q9P866_CANAX/68-213----------------................................................................
O97036_HYDVU/314-460----------------................................................................
O97033_9METZ/324-472----------------................................................................
PLC1_SCHPO/443-585----------------................................................................
A6AS90_VIBHA/22-157----------------................................................................
Q013R6_OSTTA/119-269----------------................................................................
Q75IL8_ORYSJ/119-262----------------................................................................
O96101_TRYCR/248-393----------------................................................................
A6EGD5_9SPHI/56-190----------------................................................................
PLCD8_ARATH/107-248----------------................................................................
Q4S959_TETNG/321-464----------------................................................................
Q762E2_9BRYO/150-294----------------................................................................
Q4RSB2_TETNG/98-242----------------................................................................
Q6CD33_YARLI/505-648----------------................................................................
A7UXE0_NEUCR/117-274----------------................................................................
A1D7Q8_NEOFI/96-331----------------SGDDTSSSSSSESNSDEENPSRRKKQDVPKTDGSTQSTKAAS.................RRKGL

PF00387

PLCD1_MOUSE/491-609--------------------------------------------------------------------------------
Q29N33_DROPS/566-683--------------------------------------------------------------------------------
PLCG2_HUMAN/929-1044--------------------------------------------------------------------------------
PIPA_DROME/549-666--------------------------------------------------------------------------------
Q6BZ51_DEBHA/661-779--------------------------------------------------------------------------------
PLCH1_HUMAN/600-714--------------------------------------------------------------------------------
A5DAA1_PICGU/647-765--------------------------------------------------------------------------------
A7RXP6_NEMVE/449-566--------------------------------------------------------------------------------
A7RPQ0_NEMVE/491-608--------------------------------------------------------------------------------
Q7ZU40_DANRE/483-600--------------------------------------------------------------------------------
PLCB2_MOUSE/546-663--------------------------------------------------------------------------------
PLCL1_RAT/585-702--------------------------------------------------------------------------------
Q4T850_TETNG/440-554--------------------------------------------------------------------------------
Q55WA1_CRYNB/353-467--------------------------------------------------------------------------------
O96101_TRYCR/462-581--------------------------------------------------------------------------------
P78585_BOTFU/650-769--------------------------------------------------------------------------------
Q75C92_ASHGO/591-714--------------------------------------------------------------------------------
PLCZ1_MACFA/381-498--------------------------------------------------------------------------------
Q4RX70_TETNG/609-725--------------------------------------------------------------------------------
Q08JX0_ORYLA/549-666--------------------------------------------------------------------------------
O97033_9METZ/764-881--------------------------------------------------------------------------------
Q25285_LOLFO/513-630--------------------------------------------------------------------------------
A3LSB2_PICST/669-787--------------------------------------------------------------------------------
A1D7Q8_NEOFI/374-488--------------------------------------------------------------------------------
Q17CT3_AEDAE/941-1054--------------------------------------------------------------------------------
Q4SKC0_TETNG/940-1053--------------------------------------------------------------------------------
Q8CI86_MOUSE/590-707--------------------------------------------------------------------------------
Q0UE70_PHANO/300-418--------------------------------------------------------------------------------
PLC1_YEAST/586-710--------------------------------------------------------------------------------
Q6NTX2_XENLA/945-1063--------------------------------------------------------------------------------
Q2UCJ8_ASPOR/565-684--------------------------------------------------------------------------------
Q4QBH9_LEIMA/390-509--------------------------------------------------------------------------------
PLC_DICDI/538-653--------------------------------------------------------------------------------
Q0UVV5_PHANO/395-509--------------------------------------------------------------------------------
Q4PA81_USTMA/992-1114--------------------------------------------------------------------------------
Q4SDX6_TETNG/473-589--------------------------------------------------------------------------------
A4S165_OSTLU/200-316--------------------------------------------------------------------------------
Q86RA6_DROVI/974-1087--------------------------------------------------------------------------------
Q4RSB2_TETNG/292-409--------------------------------------------------------------------------------
Q6RY08_ASTMI/926-1041--------------------------------------------------------------------------------
Q45UR4_NEUCS/413-527--------------------------------------------------------------------------------
A7SMY6_NEMVE/399-515--------------------------------------------------------------------------------
Q2HB23_CHAGB/789-908--------------------------------------------------------------------------------
PLCL2_HUMAN/617-734--------------------------------------------------------------------------------
Q59LC4_CANAL/795-913--------------------------------------------------------------------------------
Q0UC00_PHANO/609-729--------------------------------------------------------------------------------
Q4S959_TETNG/510-627--------------------------------------------------------------------------------
Q1LWH7_DANRE/476-593--------------------------------------------------------------------------------
PLCD4_RAT/502-619--------------------------------------------------------------------------------
Q4RKI8_TETNG/560-677--------------------------------------------------------------------------------
PLCD4_HUMAN/492-609--------------------------------------------------------------------------------
O97037_HYDVU/475-592--------------------------------------------------------------------------------
O97035_HYDVU/534-651--------------------------------------------------------------------------------
Q5QIB9_STRPU/494-610--------------------------------------------------------------------------------
A2QEJ2_ASPNC/322-436--------------------------------------------------------------------------------
Q5IRA3_CRYPA/437-551--------------------------------------------------------------------------------
PLCD3_HUMAN/527-644--------------------------------------------------------------------------------
Q2VYF9_9TRYP/452-571--------------------------------------------------------------------------------
A7TR21_VANPO/594-717--------------------------------------------------------------------------------
Q6CSI9_KLULA/616-739--------------------------------------------------------------------------------
Q91423_9TELE/236-353--------------------------------------------------------------------------------
Q013R6_OSTTA/351-466--------------------------------------------------------------------------------
Q4SCY8_TETNG/264-356--------------------------------------------------------------------------------
A7RPT6_NEMVE/606-723--------------------------------------------------------------------------------
Q5B933_EMENI/339-453--------------------------------------------------------------------------------
PLCD4_XENLA/485-602--------------------------------------------------------------------------------
Q5JYS9_HUMAN/412-529--------------------------------------------------------------------------------
Q9XWB7_CAEEL/527-651--------------------------------------------------------------------------------
A7SDH9_NEMVE/402-519--------------------------------------------------------------------------------
PLCZ1_CHICK/376-493--------------------------------------------------------------------------------
PLCH2_HUMAN/625-740--------------------------------------------------------------------------------
Q7QHE3_ANOGA/969-1085--------------------------------------------------------------------------------
A7MD68_DANRE/509-626--------------------------------------------------------------------------------
A7EE08_SCLS1/440-554--------------------------------------------------------------------------------
A5E691_LODEL/252-371--------------------------------------------------------------------------------
Q6CD33_YARLI/706-822--------------------------------------------------------------------------------
Q2H4G2_CHAGB/404-521--------------------------------------------------------------------------------
PLC1_SCHPO/637-753--------------------------------------------------------------------------------
PLD3A_DANRE/505-621--------------------------------------------------------------------------------
O97034_9METZ/947-1065--------------------------------------------------------------------------------
A7SXK4_NEMVE/279-396--------------------------------------------------------------------------------
A6RBI2_AJECN/377-491--------------------------------------------------------------------------------
Q1LWW2_DANRE/14-131--------------------------------------------------------------------------------
A2IB48_CHAVR/945-1060--------------------------------------------------------------------------------
Q6FY00_CANGA/575-699--------------------------------------------------------------------------------
Q4SNU6_TETNG/496-627--------------------------------------------------------------------------------

PF03009

PGC1_SCHPO/37-267...PTYEQFLHE.......LTKHPGVNLLVDIKPVNDLLIIPR....MVDAMLRVNSDLD.........FWKDKVSFCLW
GPC1B_CAEEL/349-649VPFPSLAQVLRH.......VDENVGLNIEIKYPMYMQDGSHEC...QGYFEQNKFVDIILAE...VAEHAGNRRIIFSCF
YQIK_BACSU/7-235...PLLEDVLS..........WAVKKDFLINIELKNSVIRYEG....MEEKVLEAVKRFN..........VEDRVILSTF
Q9RZL4_DEIRA/249-566FTVPTLEEIIAL........VRDVEAKTGRKVGIYPETKHPTYMAEVAKVNTSQLLIDTLKR....LNFTDPARVFIQSF
Q9X1V6_THEMA/6-217....TLKEVFEN.........VSDDKIINIEIKEREAADAVLEI...SKKRKNLIFSSFD............LDLLDEKF
Y2277_MYCTU/36-295TPIPTLEQAIGA.........TPPDMTLFLDLKQTPPQPLVSAVAQVLTRTGAAGRSIVYS.........TNADITAAAS
Q9RWX3_DEIRA/7-220...PTLPEVLA..........WAVDCEAYVNLELKWESPLPDD....RVVRMLDSIRVHG..........LSRRVIVSSF
O07244_MYCTU/14-242...TALPDMR...........VNIDIKAASAIEPTVNVIERCN...AHNRVLIGSFSERR........RRRALRLL..TK
Q9SD81_ARATH/49-357FPIITFDEYISIAL....DAPRVVGIYPEIKNPVFMNQQVKWADGKKFEDKFVETLKKYGYKGSYLSEDWLKQPIFIQSF
GPC1A_CAEEL/406-706KPFPTLLEALTK.......VDPDVGFNVEVKYPMMQNNGEHEC...DHYFERNLFVDVILAD...VMKHAGNRRIMFSSF
O02322_CAEEL/73-322...HCVANNIMM........IWDVKNVDENLLKQFVIQIRTYN...LYSKVLVSGFNPIDTY...LVKMADPKILTGFTW
YHDW_BACSU/6-233...PTLEAVLKR.........YHKKIGLLIELKGHPSQVGIEE...EVGQLLGQFSFSIN..............NIVQSF
GDE1_SCHPO/752-1061.PFTTLKDVLKE.......VPQSVGLNVEFKYPMLSEAEEEKLL..PIAYDYNFYVDTILSI...IKKYGGKRKYIFSSF
Q45201_BORHE/38-330FKIPTLEEEIQF........IQGLNKSTGRNVGIYPEIKKPLWH.KQQGKDISKIVIEILNK...YGYKSKEDKIYLQTF
Q9W2L6_DROME/349-632RLFPTLQDFFER.......VNLSTGFDIEIKWPQQRADGLFES...EQTLDKNLFADRILAV...VRRHGCGRLNVIKSF
O86738_STRCO/16-227..VPTLAEALAA.........TDGARLMLDLPGGPGERAVRRVV..DVVRECGARDRVYY.............TAG....
GDE1_YEAST/877-1212SSFVTLKELFKK.......IPANVGFNIECKFPMLDEAEEEELG..QIMMEMNHWVDTVLKV...VFDNANGRDIIFSSF
Q9VQU3_DROME/375-661QPFPQLCDVLDA.......LDVHVGFNIEIKWSQRLEDGKMEEE.FEHVVDRNLYIDCILDV...ILRKAGNRRIVLSCF
Q9V208_PYRAB/12-236...PTLEEAFSV.........LPEDALVNIEIKDVDAVKEVAS....IVKENNPERVMVS..................SF
Q9Z3F4_XANEU/274-516...KTDQTIAGV.........EQMLEHVLKKPEPMSVALDCKENTGEAVAMLLMRRPDLR........KAAAIKVYAKYY
GLPQ1_MYCTU/17-259TSLLTLDALVSLV......LDWHRPVKIFVETKHPVRYGSLVE....NKLLALLHRFGIAAP....AS.ADRSRAVVMSF
PGC1_YEAST/7-246...EILTWAVCH.........PGAKLMLDIKFTNEKIIMIKTFVIMLEVKNDLKFWQERITW...GLWLLDWYDFGIETG
Q9RKX8_STRCO/20-243...ETFPAVR...........WNVDVKAEPALEPLLELIGRHN...AWDRICVGSFSEAR........VVRAQRLA..GP
Q9ZTU6_WHEAT/118-414GKFMRLSDFLAF.........AKGEDLSGIMITVEHASFMAEKLGFGVVDAVIKAVDDSGY......SKQTAKKVMIQST
GLPQ_BACSU/43-285LKVPTLEEVLDR.........FGKHANYYIETKSPDTYPGMEEK..LIASLQKHKLLGKH.........SKPGQVIIQSF
GLPQ_ECOLI/36-350FRVHTFEEEIEF........VQGLNHSTGKNIGIYPEIKAPWFH.HQEGKDIAAKTLEVLKK...YGYTGKDDKVYLQCF
GLPQ_HAEIN/40-355FRIHTFEDEIEF........IQGLEKSTGKKVGIYPEIKAPWFH.HQNGKDIATETLKVLKK...YGYDKKTDMVYLQTF
Q89384_PBCV1/5-217...PTLNQVLDE.........FKDEYTYDIEIKSSDTASAVVET...IQKSNIPYENTLV..........T.......SF
UGPQ_ECOLI/12-239...PLLSQVAER........CREHGMMANIEIKPTTGTGPLTG...KMVALAARELWAG..........MTPPLLS..SF
Q9SGA2_ARATH/39-318DSFCTLQEAFEKV......ENPNLGFNIELKLDDNVFYSSDHLS..RLLLPILQVVSDIG..........NDRTIIFSSF
Q9YFI4_AERPE/15-220...PLYKPMP...........LANWLERLWSMGFTKVVIDVKSG..GIDPTLLASEVERG..........WPGQVIYTSE
Q44028_CUPNE/17-245...PTLAAIARY........TQANGLMVNIEIKPVPGTEARTG...AAVALDAQSLWAAA.........AVPPLLS..SF
Q9RSP0_DEIRA/37-277..VAQLKDVLR..........EFPNTPLIIELKQASPSIAAPFC.AELRRAGATGRVIAAS.......FSDAALNEFRRL
Q9UAW8_CAEEL/68-331ERVPDMEDVVKWAVENNTRMLFDVKDSDNELVDQIANLFQKYN...LYDKAIVCSFFPWVVY...RIKKGDQKILTGLTW

PF13653

A8I2Q7_CHLRE/208-237--------------------------------------------------------------------------------
C6JG09_9FIRM/261-290--------------------------------------------------------------------------------
Q97AF5_THEVO/125-154--------------------------------------------------------------------------------
C1EA09_MICSR/311-340--------------------------------------------------------------------------------
D3R0L3_CLOB3/197-226--------------------------------------------------------------------------------
Q53JJ0_ORYSJ/166-195--------------------------------------------------------------------------------
C2HMV5_LACAI/99-128--------------------------------------------------------------------------------
B5DF39_RAT/181-210--------------------------------------------------------------------------------
B3RWH1_TRIAD/177-217--------------------------------------------------------------------------------
B6A4H5_RHILW/237-277--------------------------------------------------------------------------------
C5XX04_SORBI/147-190--------------------------------------------------------------------------------
C3KNM3_RHISN/284-318--------------------------------------------------------------------------------
A1SJR5_NOCSJ/183-212--------------------------------------------------------------------------------
C5Y879_SORBI/258-287--------------------------------------------------------------------------------
C4H5M9_YERPE/194-223--------------------------------------------------------------------------------
D2QM66_SPILD/215-245--------------------------------------------------------------------------------
Q1M8H9_RHIL3/237-277--------------------------------------------------------------------------------
D3PWH3_STANL/239-274--------------------------------------------------------------------------------
A4F9Z1_SACEN/227-262--------------------------------------------------------------------------------
A3XKX4_LEEBM/206-236--------------------------------------------------------------------------------
A8M0I4_SALAI/230-265--------------------------------------------------------------------------------
A21_LOXAR/214-243--------------------------------------------------------------------------------
C2FUE7_9SPHI/240-270--------------------------------------------------------------------------------
A4AS02_MARSH/212-242--------------------------------------------------------------------------------
B2KBC_SICCD/215-244--------------------------------------------------------------------------------
A6CED4_9PLAN/229-259--------------------------------------------------------------------------------
C7PNH8_CHIPD/228-258--------------------------------------------------------------------------------
A1H1_LOXRE/220-249--------------------------------------------------------------------------------
B1H1_LOXIN/248-277--------------------------------------------------------------------------------
C5C387_BEUC1/626-661--------------------------------------------------------------------------------
B2L2_SICCD/215-244--------------------------------------------------------------------------------
A3HWH1_9BACT/215-245--------------------------------------------------------------------------------
Q6MRA8_BDEBA/253-282--------------------------------------------------------------------------------
A6WFY1_KINRD/264-299--------------------------------------------------------------------------------
A51_LOXIN/249-278--------------------------------------------------------------------------------
A7T397_NEMVE/56-86--------------------------------------------------------------------------------
C6W5T4_DYAFD/220-250--------------------------------------------------------------------------------
A5ZJ68_9BACE/227-257--------------------------------------------------------------------------------
B312_LOXSN/215-244--------------------------------------------------------------------------------
A71_LOXAR/216-245--------------------------------------------------------------------------------
C0Y618_BURPE/135-164--------------------------------------------------------------------------------
A612_LOXHI/216-245--------------------------------------------------------------------------------
B7Q3W8_IXOSC/213-242--------------------------------------------------------------------------------
D2QQ87_SPILD/603-633--------------------------------------------------------------------------------
C7NM04_KYTSD/250-284--------------------------------------------------------------------------------
Q010C1_OSTTA/112-141--------------------------------------------------------------------------------
Q7UF88_RHOBA/253-283--------------------------------------------------------------------------------
B1Q_LOXIN/246-275--------------------------------------------------------------------------------
A3ZUF0_9PLAN/222-252--------------------------------------------------------------------------------
A21_LOXVA/216-245--------------------------------------------------------------------------------
A6EG44_9SPHI/221-251--------------------------------------------------------------------------------
A41_LOXRU/216-245--------------------------------------------------------------------------------
B1R_LOXAS/214-243--------------------------------------------------------------------------------
A1LA_LOXAR/261-290--------------------------------------------------------------------------------
C7P9S2_CHIPD/217-247--------------------------------------------------------------------------------
B7QFM3_IXOSC/67-96--------------------------------------------------------------------------------
A412_LOXHI/219-248--------------------------------------------------------------------------------
B9XKB9_9BACT/233-263--------------------------------------------------------------------------------
E8W4Q9_STRFA/244-279--------------------------------------------------------------------------------
SMD_IXOSC/243-272--------------------------------------------------------------------------------
A312_LOXS4/219-248--------------------------------------------------------------------------------
B1S_LOXAS/217-246--------------------------------------------------------------------------------
A6EG56_9SPHI/219-249--------------------------------------------------------------------------------
A21_LOXSP/213-242--------------------------------------------------------------------------------
A1OB2_LOXVA/213-242--------------------------------------------------------------------------------
A5FEV6_FLAJ1/213-243--------------------------------------------------------------------------------
D7VYF5_9FLAO/219-249--------------------------------------------------------------------------------
Q4Z7T4_PLABA/27-60--------------------------------------------------------------------------------
A424_LOXLA/217-246--------------------------------------------------------------------------------
B9GJW3_POPTR/78-121--------------------------------------------------------------------------------
B7PW58_IXOSC/226-255--------------------------------------------------------------------------------
B1LB_SICPE/216-245--------------------------------------------------------------------------------
C6W721_DYAFD/221-251--------------------------------------------------------------------------------

PF00388

Q60450_CRIGR/286-429.........................................P........IIYH...GYTFT...SK..ILFYDVLRAIR
A4I5X4_LEIIN/300-441.........................................P........VIYH...GHTRT...SK..IRFVDVIDTIR
Q8IJR0_PLAF7/626-770.........................................I........VVYHGFYGYKLT...SS..ILFCDTLIACK
PLC_STAAE/34-177.........................................I........SVHH...GMVYL....H..HELGKFLDDAK
Q6BZ51_DEBHA/455-607....................................KTNNEP........IVSH...GRTFT...SS..ISLNNVFKTIK
PLCG2_MOUSE/314-457.........................................P........IIYH...GWTRT...TK..IKFDDVVQAIR
PLCL1_HUMAN/400-543.........................................P........ILCN...RNNMT...TH..VSFRSVIEVIN
PLCD9_ARATH/109-254.........................................I........CVRP...KWNFE...KP..LELQECLDAIK
PLCD1_ARATH/107-250.........................................A........EVRH...GGTLT...SR..EDLQKCLNVVK
PLCD6_ARATH/139-282.........................................I........NVLH...GRTLT...TP..VPLMKCLKSIR
A5DAA1_PICGU/440-595..................................ESEGIKGP........IVNH...GRSFT...SS..ISLKNVLSTVK
Q636S2_BACCZ/57-195.........................................I........VLHH...GPLYL....Y..VTLHEFINEAK
A7MD68_DANRE/316-460.........................................P........VIYY...GHTLT...SK..VPFKDVIKAIK
PLCD4_RAT/292-436.........................................P........VVYH...GRTLT...SR..ILFKDVLATLA
Q0PGC0_LISMN/61-200.........................................L........KIYH...GPIYL....N..ASLSGVLETIT
PLCZ1_BOVIN/157-300.........................................P........VVYH...GYTFT...SK..LLFKTVIQAIN
Q55WA1_CRYNB/160-302.........................................P........VVYH...RKTLT...SS..VPVRDICRAIK
Q2YGU1_LILDA/57-200.........................................I........DILH...GRTLT...TP..VDLIKCLKSIK
PLCD3_ARATH/108-251.........................................A........EVRH...GRTLT...SH..EDLQKCLTAIK
Q5JYS9_HUMAN/151-300.........................................P........IITH...GKAMC...TD..ILFKDVIQAIK
O97034_9METZ/308-451.........................................P........IIYH...GRTLT...SK..IRFIDVIKTIK
A5E691_LODEL/21-192..........................TNGGTSAATIAVVAEP........VVNH...GRTFT...KS..IKFSDVIRTIK
Q16W08_AEDAE/315-464.........................................P........IITH...GMAMC...SD..ILFKDVIYALR
PLCD5_ARATH/114-257.........................................I........LVLH...GWAWT...PP..VELVKCLRSIK
Q5QIB9_STRPU/301-444.........................................P........IVYH...GHTLT...SK..IKFRDIIEVVD
Q6CSI9_KLULA/402-540.........................................P........VVCH...GL.FT...QS..IPLEDVVKTIR
A0FLF3_TOBAC/111-253.........................................V........EVLH...GGTLT...TP..VALIKCLRSIK
O97037_HYDVU/300-443.........................................P........IVYH...GFTLT...SK..ILFKDVIDTIA
PLCD3_HUMAN/339-483.........................................P........VIYH...GHTLT...SK..ILFRDVVQAVR
Q385H1_TRYB2/248-393.........................................P........VVYH...GYTRT...SK..LWFRDCISTIK
Q3TWI4_MOUSE/319-469.........................................P........FITH...GFTMT...TE..VPLRDVLEAIA
P93620_VIGUN/106-249.........................................I........DVVH...GRTLT...TP..VSLLRCLKSIK
A2TF43_9LAMI/114-257.........................................I........DIMH...GGTLT...SP..VKLIKCLKAIK
Q16ZC0_AEDAE/42-189.........................................P........VIYH...GHTFT...TK..IPFRAVVEAIN
Q4S9T4_TETNG/359-525.....................................VDYGPDISRQHHHHHHHHHHHHHQH...TP..ITIRSALEVIN
O49950_SOLTU/113-256.........................................V........DILH...GGTLT...PP..VELIQCLKSIK
Q4S530_TETNG/241-384.........................................P........IIYH...GYTIT...SK..VLFRDVIKAIK
PLCH1_HUMAN/301-445.........................................P........VVHH...GYTLT...SK..ILFRDVVETIN
Q45UQ8_NEUCS/110-360AATTTEAAPVGLSAETNPLERCKSGGSASLFQTLSRKSTKEP........RVLH...GYTLT...KD..ITFRDVCEAIK
Q4SKC0_TETNG/309-451.........................................P........IIYH...GWTRT...TK..IKFEDVVKAIN
A2QEJ2_ASPNC/86-262.........................ESKASGSAIPVPGKPEP........RVLH...GHTLT...RE..TSFREVCYAIR
Q4N7P5_THEPA/468-615.........................................P........VLCHAWKNCHLT...GS..VTLREGLIAIK
A7S279_NEMVE/319-466.........................................P........IITH...GNAMC...TK..ILFKDVIEAIR
PLC_DICDI/324-466.........................................P........IIFH...GNTLT...SQ..IKFSHVCETIK
Q5BFL6_EMENI/534-676.........................................P........IVSH...GRTMT...TS..VLFADCITVIN
Q2HB23_CHAGB/553-696.........................................P........VVTH...GHTLT...TS..ISFLEVIKTIN
A6RBI2_AJECN/84-320RGSTTQPQVAGAETAVVTTTASMSPPGDAGTAASAVQLRREP........LVFH...GYTLT...KE..ITFRDVCNTIR
Q1LWH7_DANRE/284-423.........................................P........IVYH...GHTFT...SK..IFFKDVVTVLG
A0CKY8_PARTE/271-413........................................NP........VVYH...GYTLT...SK..ILFEDAILALD
Q3UZ68_MOUSE/210-353.........................................P........VIYH...GHTLT...TK..IKFSDVLHTIK
Q5CLA7_CRYHO/367-509.........................................P........IIYH...GHTLT...SK..VYFEDVIRACK
E9AEI1_LEIMA/296-447.........................................P........VVYH...GHTMT...TK..IAFDDVVRTIN
Q91423_9TELE/46-190.........................................P........VIYH...GHTLT...SK..VLFKDVIKAIN
Q9XWB7_CAEEL/306-468........................................EP........VITH...GPTAVMGMNE..IGLKEVCEAIK
Q8IA75_CAEEL/367-517.......................................TEP........MVQN...GQTAT...SK..ITISSALRIIR
PLC1_YEAST/382-521.........................................P........VVCH...GF.LT...SA..IPLKTVIRVIK
Q4SCY8_TETNG/29-191.........................................P........VITH...GFTMT...TE..ISFKEVIEAIA
PLCE1_HUMAN/1394-1541.........................................P........IIYH...GHTLT...TK..IPFKEVVEAID
Q6QAF2_LYTPI/318-467.........................................P........IITH...GLAMC...TD..IQFRDVIQAIR
A7RXP6_NEMVE/244-393.........................................P........VITH...GMTLC...TE..ISFKDVIEAIA
Q2QNK1_ORYSJ/114-257.........................................I........DILH...GGTLT...AP..VQIIKCLKSIK
Q7QHE3_ANOGA/319-462.........................................P........LIFH...GHTFT...TR..IKFMDVIRTIK
A0BLC4_PARTE/285-429.........................................P........IIYH...GFTMT...SK..ISFESVIETIK
Q6FY00_CANGA/381-519.........................................P........VVCH...GV.LT...SA..LPLSSVTQIIR
A0BLM0_PARTE/262-404.........................................P........KVTH...GHTLV...ND..IKFKDVISTVR
Q59LC4_CANAL/566-727................................DDDDKNEYEP........IVNH...GRTFT...KP..ISFANVIRAIK
Q4T850_TETNG/115-259.........................................P........MVQH...GYTLT...SK..IPFRFVIETIN
Q9FSW1_9POAL/148-291.........................................I........DVLH...GRTLT...AP..VSLIKCLRSIK
Q2UPV6_ASPOR/98-321.LGSMSTKLGGLIGRKSSPEDVPLDSSAPVDPATEVPPPPEP........QVLH...GHTLT...KG..TTFRDVCYAIR
O97035_HYDVU/328-477.........................................P........VITH...GMTLC...TE..VLFKDVIEAIK
Q4PDE8_USTMA/122-279........................................EP........KVTH...GYTLA...SH..VPFRAVCETMK
Q9XEK4_BRANA/105-249.........................................I........DVLH...GRTLT...SP..VELIKCLRAIK
A7T501_NEMVE/158-302.........................................P........VVYH...GYTMT...SK..VKFRYVILNIN
Q4RWH6_TETNG/299-443.........................................P........VIYH...GHTLT...SK..VPFKEVIETIA
A5A2F9_TOBAC/110-253.........................................I........HVLH...GRTVT...TP..VELIRCLKSIK
A7ASE0_BABBO/522-670.........................................P........VLCHSWKNCQLT...GS..ITLSEALIACK
Q7ZU40_DANRE/294-438.........................................P........VIYH...GYTLT...SK..ILFKDVIKAIK
Q45QJ6_RAT/314-464.........................................P........IITH...GFTMT...TD..ILFKEAVEAIA
Q0B816_BURCM/28-162.........................................F........DIHH...GGIAL....G..MSFDDVLADCT
Q4PA81_USTMA/724-872.........................................P........QITH...GRTLT...SR..VPFQDVISAIA
A7TR21_VANPO/381-520.........................................P........VVCH...SF.LT...SS..IPLLDVASVIR
Q75C92_ASHGO/397-535.........................................P........VVCH...GK.LT...SS..LPLRNVVDVIN
A7RPQ0_NEMVE/307-450.........................................P........IIYH...GHTLT...SK..IMFKETVEAIE
Q5MG88_TOXGO/407-550.........................................P........SLFHGVGGYQLT...SR..IKFKDVIQACK
A7SXK4_NEMVE/94-237.........................................P........IVYH...GHTLT...SK..VLFKDIVQAIK
PHLC_TRYBB/54-199.......................................IYT........THFH...........IS..VPLQEVLKDVK
Q4S9B8_TETNG/321-464.........................................P........VIYT...GHTMT...SQ..VSFRSVIDVVN
O07690_LISSE/61-200.........................................L........NIYH...GPIYL....N..ASLEEVLHTFI
A4S165_OSTLU/1-153.........................................P........IITH...GGTAV...RP..MLFKDAIAVIN
Q7PW25_ANOGA/289-436.........................................P........VIVH...GYTFV...PE..ICAKDVLEAIA
Q4SDX6_TETNG/287-431.........................................P........VIYH...GHTLT...SK..VPFVEVVQTIN
A7RKT2_NEMVE/272-413.........................................P........IITH...GRTLT...SK..IRFRDVVQIIK
Q4RKI8_TETNG/349-492.........................................P........VVCT...GHTLS...PP..LALHSVLEAIE
Q766D4_9BRYO/108-251.........................................I........KVTH...GNTLT...SP..VAFEKCIKAIK
Q2PEW5_TRIPR/126-269.........................................V........DVLH...GRTLT...TP..VALIKCLTSIK
A6RM87_BOTFB/546-665..................................................................P..IMFSDVMYTIA
Q4RX70_TETNG/314-458.........................................P........IIHH...GYTLT...SK..ILFKDVIETIN
A3LSB2_PICST/461-615...................................FQHDKEP........IVNH...GRTFT...TA..ISFSNVISTIK
A4EAJ4_9ACTN/13-159........................................DP........GIDH...GICYLLKKDGGYMQLSNVIGYFK
A3LNB7_PICST/20-167.........................................L........QVIH...GKFPVRIPFP..IQLEDVLKEVY
Q6R6E0_LISIV/61-201.........................................L........QIYH...GPIYL....D..ASLKGVLETTV
Q24284_DROME/320-463.........................................P........YIFH...GHTIT...SK..IKFMDVIKTIK
PLCH2_HUMAN/328-472.........................................P........IVHH...GYTLT...SK..ILFKDVIETIN
Q0UVV5_PHANO/116-337....FGRKGASEEKERSLSPSGKGEEKVEPWRSDSYAYRAEP........RVLH...GYTLT...KD..LPFRAVCATIR
Q4QBH9_LEIMA/195-340.........................................P........IVCH...GYTRT...SC..IAFEECVKMIR
PLCD4_HUMAN/292-436.........................................P........VVYH...GHTLT...SR..ILFKDVVATVA
Q0UE70_PHANO/101-258........................................EP........KVTH...GYTLV...SN..IPFRTVCETLR
A5AGR6_VITVI/112-255.........................................I........DVLH...GRTLT...TP..VKLSKCLISIK
B9DGG5_ARATH/8-150.........................................V........CVKH...GRTLT...KE..VKLGKCLESIK
Q4RLM8_TETNG/312-491.........................................P........IITH...GFTMT...TE..ILFKDVIEAIA
PLCL2_MOUSE/429-572.........................................P........VIYT...GHTMT...SQ..IVFRSVIDIIN
PLCZ1_CHICK/159-303.........................................P........VVYH...GHTLT...SK..ITFCSVIHVVD
A2IB48_CHAVR/321-464.........................................P........HIYH...GHTLT...SK..IRFMDVLYTIK
PLCD4_XENLA/292-436.........................................P........IVYH...GRTFT...SK..ILFKDVISAID
Q3F156_BACTI/43-187.........................................F........AMHH...GIVYQ....K..AMFEDVLKETI
Q2GUM5_CHAGB/104-264........................................EP........KVTH...GYTLV...SN..IPFRVVCETIR
Q7SE08_NEUCR/136-356...LYTMRTPRDSGTSLDPKELSDRMDRSTSSSSGSVKRGEP........IVHH...HGTMT...TT..VPFREVCKAVR
Q21754_CAEEL/318-461.........................................P........VITH...KRTFI...ES..ITLRNSLEAIK
Q9GV33_WATSC/324-471.........................................P........IITH...GFTMC...TE..VSFEDVVHAIG
A7SDH9_NEMVE/209-352.........................................P........IVYH...GHTLT...SK..IKFKDIIQAVA
Q6EZG7_CAEEL/342-492.........................................P........IITH...GKAMC...TD..VFFKDVLVQIR
Q6RY08_ASTMI/305-448.........................................P........IIYH...GLTLT...SK..IKFMDVLKTIK
A4HCK9_LEIBR/248-393.........................................P........IVHH...GYTPT...SR..IAFRDCITVIR
Q236T7_TETTS/368-513.........................................P........EALQ...GVFQV...TP..VSVEDIFKAIK
Q9P866_CANAX/68-213..................................................QVIH...GKFPVKIPFP..LKLKDTLEEVY
O97036_HYDVU/314-460.........................................P........IITH...GKAMC...TN..VLFSDVVQAIA
O97033_9METZ/324-472..................................................IITH...GGTLC...TK..IPFKDVVEAIS
PLC1_SCHPO/443-585.........................................P........VVCH...GHTFT...SM..IKFNDVIDAIR
A6AS90_VIBHA/22-157.........................................PNGPELDPLNIYH...GDFSC....G..ISFGDVLNDCL
Q013R6_OSTTA/119-269.......................................PRP........IVTH...GGTAV...RP..MYFEDAIKVIA
Q75IL8_ORYSJ/119-262.........................................V........EVLH...GRTLT...SP..VGLMKCLEAIR
O96101_TRYCR/248-393.........................................P........IVYH...GHTRT...SK..ISFLSCIKVIK
A6EGD5_9SPHI/56-190.........................................F........AIHH...GAIYQ....N..LNFNDVLNACI
PLCD8_ARATH/107-248.........................................I........CVRP...SWNFE...KP..LKLQECLDSIK
Q4S959_TETNG/321-464.........................................P........VVYV...GSSVA...SH..LVFSKIVDIIN
Q762E2_9BRYO/150-294.........................................I........DVLH...GGTLT...KA..VPFEDCVKAIK
Q4RSB2_TETNG/98-242.........................................P........VVYH...GYTLT...TK..ILFKEVITTVE
Q6CD33_YARLI/505-648.........................................P........VVKH...GRTFT...SS..VSVEDVCSAIR
A7UXE0_NEUCR/117-274........................................EP........KVTH...GYTLV...SN..IPFREVCKIIL
A1D7Q8_NEOFI/96-331SSKLGSLLGRKSSPPNGATDKPASTATAAAVDAAQTLRRPEP........RVLH...GHTLT...KG..TKFRDVCYAIR

PF00387

PLCD1_MOUSE/491-609----------------------------------------STSGQ..AFYEMASFSESRALRLLQ.ES..GNS..FVRHN
Q29N33_DROPS/566-683----------------------------------------EKKNR...CYEMSSFDEKQATTLLK.ER..PIE..FVNYN
PLCG2_HUMAN/929-1044----------------------------------------ENPD....FREIRSFVETKADSIIR.QK..PVD..LLKYN
PIPA_DROME/549-666----------------------------------------IEKNI...AHNMSSFAESAGMNYLK.QS..SID..FVNYN
Q6BZ51_DEBHA/661-779----------------------------------------ESKT....FNHCFSLSEKSINTMLK.DDIKCTS..IDKHN
PLCH1_HUMAN/600-714----------------------------------------DGTT.....GNVLSFSETRAHQVVQ.QK..SEQ..FMIYN
A5DAA1_PICGU/647-765----------------------------------------ESKT....FNHCISLSEKSFNSLLS.DEEKRLS..LAKHN
A7RXP6_NEMVE/449-566----------------------------------------SAKRN..RSYEMSSFVETVATTQLK.EK..PVE..FVNYN
A7RPQ0_NEMVE/491-608----------------------------------------SADNQ..KFWELCSLNEALARRLGN.AY..PEE..FVNYN
Q7ZU40_DANRE/483-600----------------------------------------SREKH..SFYEMASFKEGKALKLAE.ES..ATE..YIRHN
PLCB2_MOUSE/546-663----------------------------------------SAQKN..RSYVVSSFTELKAYELLS.KA..SMQ..FVDYN
PLCL1_RAT/585-702----------------------------------------SMKTQ..NYWEICSFSETLASRIAN.EY..PED..FVNYN
Q4T850_TETNG/440-554----------------------------------------GT......PADVLSFSETRAQSLVN.HR..AEQ..FLAFN
Q55WA1_CRYNB/353-467----------------------------------------NEYL....PSHQFSVSERTAAKILK...VNKVD..WIKHN
O96101_TRYCR/462-581----------------------------------------SYLEK.RQPYQCTSFVESKAKKIAV.SN..AME..FKLIN
P78585_BOTFU/650-769----------------------------------------ESKA....YNHIFSFMESTFDRNSK.TQIDRRA..MTRHN
Q75C92_ASHGO/591-714----------------------------------------ESKT....PTHCFSLSERSFDNLAN.DDLQRLA..IDKHN
PLCZ1_MACFA/381-498----------------------------------------SRLYQ..QFNENNSIGETQARKLSK.LR..AHE..FIFHT
Q4RX70_TETNG/609-725----------------------------------------AFTN....SWQVSSLNETVMNQIIQ.LK..PSE..LVRLN
Q08JX0_ORYLA/549-666----------------------------------------ARKKN..KSYVISSFVETKGEAMIS.KT..AVE..FVEYN
O97033_9METZ/764-881----------------------------------------AEKTN..CSFYQSSFNEDKGVSLVK.VT..ARE..FVKYN
Q25285_LOLFO/513-630----------------------------------------AQKKD..RHYEMSSMVETQALNKLE.DN..PED..FVDYN
A3LSB2_PICST/669-787----------------------------------------ESKT....YNHCFSLSEKSINSMLK.DETKKAS..IDKHN
A1D7Q8_NEOFI/374-488----------------------------------------EAKV....PGHVFSLSESAAREAYA...KDRDA..LLEHN
Q17CT3_AEDAE/941-1054----------------------------------------GWV.....FYEMSSFPETKAEKYFL.QQETK.L..FVRYH
Q4SKC0_TETNG/940-1053----------------------------------------..DSY..TYKEIRSFVENKVPGKNR.....TKE..FLLYN
Q8CI86_MOUSE/590-707----------------------------------------ARKRN..KCFEMSSFVETKAMEQLT.KS..PME..FVEYN
Q0UE70_PHANO/300-418----------------------------------------EGNLENAPHHQLINVSESGLKAHLP.SN..SAK..IARHN
PLC1_YEAST/586-710----------------------------------------ESKT....IAHCFSLNERKVEYMIK.DKHLKLS..LDKHN
Q6NTX2_XENLA/945-1063----------------------------------------GTEKA..CYRDMSSFPETKAEKYVN.KMKGK.K..FLQYN
Q2UCJ8_ASPOR/565-684----------------------------------------ESQR....YNHVYSFAERSFEGICR.DAENKAL..FEKHN
Q4QBH9_LEIMA/390-509----------------------------------------SYLKD.KQPHHCSSYSERKGKAIVR.EA..HNA..LVCIN
PLC_DICDI/538-653----------------------------------------TTKEI..PSYKIHSLVEEKVKQLVQ.SE..PRE..VVEAS
Q0UVV5_PHANO/395-509----------------------------------------EASI....PTHVFSLSEKALMEVHE...TNPAG..LFNHN
Q4PA81_USTMA/992-1114----------------------------------------ESYA....TQHMVSLSEKTALKMIR.DPISNEA..LIKHN
Q4SDX6_TETNG/473-589----------------------------------------AAERP...AAEMSSFSESKALRLIK.DS..GIH..FVRHN
A4S165_OSTLU/200-316----------------------------------------KDLG....TKFSCSWSENKAKKLVEKSS..QKD..LLEFT
Q86RA6_DROVI/974-1087----------------------------------------SWI.....FQEMSSFPETKAEKQFI.QQNMP.L..FLSYH
Q4RSB2_TETNG/292-409----------------------------------------SRDNQ..HSYENTSLEENKARKLLK.SS..GAD..FVGHN
Q6RY08_ASTMI/926-1041----------------------------------------PGK.....YYDMSSFPETKVERYLT.AIKSK.L..LLCYN
Q45UR4_NEUCS/413-527----------------------------------------EANM....PTHIFSLSESGVMDVHK...ESRSA..LFEHN
A7SMY6_NEMVE/399-515----------------------------------------GNGK....HYEMSSFPETKAERYIS.RKYSK.E..FVKYH
Q2HB23_CHAGB/789-908----------------------------------------DAKK....FNHIFSFKEKTFAEKNQ.LSEGKRA..LYRHN
PLCL2_HUMAN/617-734----------------------------------------SFQVQ..KYWEVCSFNEVLASKYAN.EN..PGD..FVNYN
Q59LC4_CANAL/795-913----------------------------------------ESKT....FNHCFSLGEKSINRMIK.DDDKKIS..LDKHN
Q0UC00_PHANO/609-729----------------------------------------DANT....FNHVFSLNERKFETLTKAGSREKYL..LEEHN
Q4S959_TETNG/510-627----------------------------------------TKREQ..KHWEICSFNEVDANRYAN.EF..PEE..FVCYN
Q1LWH7_DANRE/476-593----------------------------------------SRNHS..KFYEISSFTESKARKHIR.EA..GAE..FVLHN
PLCD4_RAT/502-619----------------------------------------SKENY..HIYDISSFSESKAKNLIR.EA..GNE..FVQHN
Q4RKI8_TETNG/560-677----------------------------------------SSKSQ..KSWELCSFHETLALRLAT.ES..PRD..FVNHN
PLCD4_HUMAN/492-609----------------------------------------SKEHY..HFYEISSFSETKAKRLIK.EA..GNE..FVQHN
O97037_HYDVU/475-592----------------------------------------GLATQ..KYFQNVSLGEKKLLQLGR.DE..PKK..LIEYS
O97035_HYDVU/534-651----------------------------------------AEKRK..CYYEMSSFGENTATNLLK.EQ..PVE..FVNYN
Q5QIB9_STRPU/494-610----------------------------------------SKEKY..KCHQMSSFGEAKAFGLAE.DK..PGD..YVEHN
A2QEJ2_ASPNC/322-436----------------------------------------EAKV....PSHVFSLSEKAVREAHA...TDGDA..LFEHN
Q5IRA3_CRYPA/437-551----------------------------------------EATM....PSHVFSLGEKSVREVHE...KQGQD..LFEHN
PLCD3_HUMAN/527-644----------------------------------------APNAP..QPCQVSSLSERKAKKLIR.EA..GNS..FVRHN
Q2VYF9_9TRYP/452-571----------------------------------------SYLET.RQPYHCSSFTEGKAGKIAS.SN..QEE..FVAVN
A7TR21_VANPO/594-717----------------------------------------ESKT....RIHCFSLNEKKLEHLCK.DTTQKLA..VDKHN
Q6CSI9_KLULA/616-739----------------------------------------ESKT....TTHCFSLSEKKFINLDK.DETQKLA..INKHN
Q91423_9TELE/236-353----------------------------------------SREKQ..ACYEMSSFKESKAKNLAE.HS..ATE..FIQHN
Q013R6_OSTTA/351-466----------------------------------------RDV.....PRFSCSWSERKLKLKIEKES..SKD..IIEFT
Q4SCY8_TETNG/264-356----------------------------------------SKILS..R..............................YN
A7RPT6_NEMVE/606-723----------------------------------------EDGEN...HWEVISIPEPRAYRFTD.TK..ATQ..FTRYT
Q5B933_EMENI/339-453----------------------------------------EAKV....PGHVFSLSERAARQADE...KYGKE..LFEHN
PLCD4_XENLA/485-602----------------------------------------SRAHY..ILYEMSSVTEYKARKLVR.EP..GND..FVRHN
Q5JYS9_HUMAN/412-529----------------------------------------AEERN..IHYNMSSFNESVGLGYLK.TH..AIE..FVNYN
Q9XWB7_CAEEL/527-651----------------------------------------ENATK.DIVPCIVSADENTVYNCLRANS..IDK..VQNLN
A7SDH9_NEMVE/402-519----------------------------------------SKENA..KFYQMSSFVESKVATLAQ.NK..AAG..FVEYN
PLCZ1_CHICK/376-493----------------------------------------SLAHQ..KCYENNSIGELKAQKFVK.HA..ANQ..FVSHT
PLCH2_HUMAN/625-740----------------------------------------AAS.....SWQVSSFSETKAHQILQ.QK..PAQ..YLRFN
Q7QHE3_ANOGA/969-1085----------------------------------------AWV.....FYEMSSFPETKAEKYFL.QAETRAL..FVRYH
A7MD68_DANRE/509-626----------------------------------------SRKKQ..AFYEMASFKEGKAMNLAE.QS..ANA..FIRHN
A7EE08_SCLS1/440-554----------------------------------------AATK....PSHIFSVGEKVILELHE...SNREQ..MFAHN
A5E691_LODEL/252-371----------------------------------------ESKV....YNHCFSLSEKATNKMLK.DEVKRTS..LDKHN
Q6CD33_YARLI/706-822----------------------------------------ESKT....TNHCFSFSERKFISICK.DPENREQ..MMKHN
Q2H4G2_CHAGB/404-521----------------------------------------DTCQA...PSHIFSLSEDSFEALTE.DHNKLQK..MLKHN
PLC1_SCHPO/637-753----------------------------------------ESKT....YSHIFSFSERTIKKHGK...AMVPR..LSKHN
PLD3A_DANRE/505-621----------------------------------------ANQRP...PSVITSFSENEALKLIK.DS..GKL..FVRNN
O97034_9METZ/947-1065----------------------------------------.NDMG..KYYNMCSFVETRVEKIVH.NKSLAAQ..FLVHA
A7SXK4_NEMVE/279-396----------------------------------------SMEMG..HFSQTHSFVESEMLYFLD.KS..ASE..FVEFN
A6RBI2_AJECN/377-491----------------------------------------EATQ....PNHIFSLSESAVRDAYE...NERQA..LFEHN
Q1LWW2_DANRE/14-131----------------------------------------N.......YKEVRSLPDNIIPKEGN.ESGMEKSDCILEYN
A2IB48_CHAVR/945-1060----------------------------------------PGN.....YYDMSSFPETKGEKSLN.RKDAA.I..LMKYN
Q6FY00_CANGA/575-699----------------------------------------ESKT....LYHCFSLDERRLDKMLG.DAQVAAA..VDKHN
Q4SNU6_TETNG/496-627----------------------------------------ARKNL..SFYEMSSFKEGKAVKLAE.ES..ANE..YIRHN

PF03009

PGC1_SCHPO/37-267SHRFIPA-CDRYAP.....SIPLY---HIG-FNFAYAERH.........FVMHPRVKGVSMAVALFLLPHS.........
GPC1B_CAEEL/349-649EPDICTM-ITKKQH.....KYPVS---FLV-VGATNRYMPFQDIRSDCSKIAANFAAGCELLGVNFHSEELLI.......
YQIK_BACSU/7-235NHDSLAL-CARLAP.....HIERA---VLT-SDVLYQADR...........YIASIPASGYHPKINSPGVT.........
Q9RZL4_DEIRA/249-566EVGNLKD-LNTRIMPAAGVKLPLV---QLI-SSPDEAPYDW...AAAGDGRKYDALTNDASLREIATYANGVGAYKRWI.
Q9X1V6_THEMA/6-217KGTKYGY-LIDEEN......YGSI---ENF-VERVEKERP...........YSLHVPYQAFELEYAVEVLR.........
Y2277_MYCTU/36-295RQEGLQV-AESRDVT..RQRLFNM---ALN-HHCDPQPDPGK.WAGFELHRDVTVTEEFTLGSGISAVNAELW.......
Q9RWX3_DEIRA/7-220NPLLLRA-ARELAP.....EVERG---LLY-HRPYRLGPL......NLPEAVGRWVDCAALHPQHQLIDAP.........
O07244_MYCTU/14-242RVASSAG-TGALLA.....WLTAR---PLG-S.RAYAWRM.......M..RDIDCVQLPSRLGGVPVITPA.........
Q9SD81_ARATH/49-357AATSLVY-ISNMTD......SPKL---FLI-DDVTILTED........TNKTYAEITSDAYLDYIKPYVIGIGPWKDTIV
GPC1A_CAEEL/406-706DPDICSM-VATKQN.....KYPVL---FLC-VGETQRYTPFQDQRTSTSMTAVNFAAGADLLGVNFNSEDLLK.......
O02322_CAEEL/73-322RSWELST-TDEAAT.....TPRFT---GTL-HAVASVLDV.......LAFGLARSLIIPKFLGSDVIFYHVSD.......
YHDW_BACSU/6-233QFRSVQR-FRELYP.....SIPTA---VIT-RPNFGMLSR..........NQMKAFRSFANYVNIKHTRLNR........
GDE1_SCHPO/752-1061NPDICIL-LSLKST......NPVL---FLT-EGGTAYRTDV...RAASLRQALKFASQWSFLGIVSACEPLIM.......
Q45201_BORHE/38-330DFDELKR-IREELG....YQGKLI---MLV-GENDWDEAP..........TDYEYIKSEEGMAEVAKYSDGIGPWIPQ..
Q9W2L6_DROME/349-632DADLCSL-LRFKQH.....MYPVL---FLS-SSKENVFNDP...RTSTVEQSVNFAQAFDLGGVSPNAVFVKA.......
O86738_STRCO/16-227.AATMLA-VRAADP.....AAEIA---MTW-TTAAPPRAG...........LLAAVRPRWLNYRFGLVDRA.........
GDE1_YEAST/877-1212HPDICIM-LSLKQP.....VIPIL---FLT-EGGSEQMA.DL..RASSLQNGIRFAKKWNLLGIVSAAAPILK.......
Q9VQU3_DROME/375-661DPDICTI-LRFKQN.....RYPVM---FLT-LGRTTKYQKYMDPRGNSMELAVWHAVAMEFLGVVAHTEDLLR.......
Q9V208_PYRAB/12-236IIEALRE-YRKYDE.....ETILG---LLI-DREEVVPMI......P...KLKEELNLWSVNVPMEAIPIIGFE......
Q9Z3F4_XANEU/274-516TGGFDQF-LSNLYK.....HYQIN---PLH-SQDAPRRAA.......LD.RLLAKINVVPVLSQGMLNDERL........
GLPQ1_MYCTU/17-259SAAAVWR-IRRAAP.....LLPTV---LLG-KTPRYLTSS...........AATAVGATAVGPSLPALKEY.........
PGC1_YEAST/7-246VLKDFKV-IVISLS......LDIA---SQF-VKRSLTLND..........PHYKLFGISVHFVSSWTSQFR.........
Q9RKX8_STRCO/20-243RLATSCG-TRGVLG......LRLR---SWG-..VPVAPR...........RSAVAAQVPETQSGVPVVDHR.........
Q9ZTU6_WHEAT/118-414NSSTLVK-FKQLAKY..NLVYKID---EVV-KDAAPSSLA.....DIKKFADAVSVSTKSVYPESSNFLINQT.......
GLPQ_BACSU/43-285SKESLVK-VHQLQP.....NLPTV---QLL-EAKQMASMT.........DAALEEIKTYAVGAGPDYKALNQ........
GLPQ_ECOLI/36-350DADELKR-IKNELEPKMGMELNLV---QLI-AYTDWNETQQKQPDGSWVNYNYDWMFKPGAMKQVAEYADGIGPDYHMLI
GLPQ_HAEIN/40-355DFNELKR-IKTELLPQMGMDLKLV---QLI-AYTDWKETQEKDPKGYWVNYNYDWMFKPGAMAEVVKYADGVGPGWYMLV
Q89384_PBCV1/5-217KWDEIQH-VRTIDD.....KIPTG---LIS-VIRPAKTIR...........FAHKLGCKVVVLNHHLVNRE.........
UGPQ_ECOLI/12-239EIDALEA-AQQAAP.....ELPRG---LLL-D..EWRDDW.......R..ELTARLGCVSIHLNHKLLNKA.........
Q9SGA2_ARATH/39-318HPDAALL-VRKLQT.....TYPVF---FLT-NGGTEMYHDT...RRNSLEEAIKVCLEGGLQGIVSEVKGVFR.......
Q9YFI4_AERPE/15-220NHRYLRR-LREEAS.....AVVYT---TYS-ILPVDVADP............ALKAGAEGVSIRFDLAIEDN........
Q44028_CUPNE/17-245SEEALAA-AARVAP.....DLPRA---LLL-D..QLPADW.......L..ERLRRLGCVALDANHRELDAG.........
Q9RSP0_DEIRA/37-277CPEVMTS-MTEREL......RPLV---LLS-KVGLSALAP..........TPGQVAQVPVRSGGIEIVTPA.........
Q9UAW8_CAEEL/68-331RLKFWSY-HDIENIRP.RYSGPKQ---MLF-EMIDVAHVW......LLKKVTPWYLGADLLLTNNLDISQA.........

PF13653

A8I2Q7_CHLRE/208-237--------------------------------------------------------------------------------
C6JG09_9FIRM/261-290--------------------------------------------------------------------------------
Q97AF5_THEVO/125-154--------------------------------------------------------------------------------
C1EA09_MICSR/311-340--------------------------------------------------------------------------------
D3R0L3_CLOB3/197-226--------------------------------------------------------------------------------
Q53JJ0_ORYSJ/166-195--------------------------------------------------------------------------------
C2HMV5_LACAI/99-128--------------------------------------------------------------------------------
B5DF39_RAT/181-210--------------------------------------------------------------------------------
B3RWH1_TRIAD/177-217--------------------------------------------------------------------------------
B6A4H5_RHILW/237-277--------------------------------------------------------------------------------
C5XX04_SORBI/147-190--------------------------------------------------------------------------------
C3KNM3_RHISN/284-318--------------------------------------------------------------------------------
A1SJR5_NOCSJ/183-212--------------------------------------------------------------------------------
C5Y879_SORBI/258-287--------------------------------------------------------------------------------
C4H5M9_YERPE/194-223--------------------------------------------------------------------------------
D2QM66_SPILD/215-245--------------------------------------------------------------------------------
Q1M8H9_RHIL3/237-277--------------------------------------------------------------------------------
D3PWH3_STANL/239-274--------------------------------------------------------------------------------
A4F9Z1_SACEN/227-262--------------------------------------------------------------------------------
A3XKX4_LEEBM/206-236--------------------------------------------------------------------------------
A8M0I4_SALAI/230-265--------------------------------------------------------------------------------
A21_LOXAR/214-243--------------------------------------------------------------------------------
C2FUE7_9SPHI/240-270--------------------------------------------------------------------------------
A4AS02_MARSH/212-242--------------------------------------------------------------------------------
B2KBC_SICCD/215-244--------------------------------------------------------------------------------
A6CED4_9PLAN/229-259--------------------------------------------------------------------------------
C7PNH8_CHIPD/228-258--------------------------------------------------------------------------------
A1H1_LOXRE/220-249--------------------------------------------------------------------------------
B1H1_LOXIN/248-277--------------------------------------------------------------------------------
C5C387_BEUC1/626-661--------------------------------------------------------------------------------
B2L2_SICCD/215-244--------------------------------------------------------------------------------
A3HWH1_9BACT/215-245--------------------------------------------------------------------------------
Q6MRA8_BDEBA/253-282--------------------------------------------------------------------------------
A6WFY1_KINRD/264-299--------------------------------------------------------------------------------
A51_LOXIN/249-278--------------------------------------------------------------------------------
A7T397_NEMVE/56-86--------------------------------------------------------------------------------
C6W5T4_DYAFD/220-250--------------------------------------------------------------------------------
A5ZJ68_9BACE/227-257--------------------------------------------------------------------------------
B312_LOXSN/215-244--------------------------------------------------------------------------------
A71_LOXAR/216-245--------------------------------------------------------------------------------
C0Y618_BURPE/135-164--------------------------------------------------------------------------------
A612_LOXHI/216-245--------------------------------------------------------------------------------
B7Q3W8_IXOSC/213-242--------------------------------------------------------------------------------
D2QQ87_SPILD/603-633--------------------------------------------------------------------------------
C7NM04_KYTSD/250-284--------------------------------------------------------------------------------
Q010C1_OSTTA/112-141--------------------------------------------------------------------------------
Q7UF88_RHOBA/253-283--------------------------------------------------------------------------------
B1Q_LOXIN/246-275--------------------------------------------------------------------------------
A3ZUF0_9PLAN/222-252--------------------------------------------------------------------------------
A21_LOXVA/216-245--------------------------------------------------------------------------------
A6EG44_9SPHI/221-251--------------------------------------------------------------------------------
A41_LOXRU/216-245--------------------------------------------------------------------------------
B1R_LOXAS/214-243--------------------------------------------------------------------------------
A1LA_LOXAR/261-290--------------------------------------------------------------------------------
C7P9S2_CHIPD/217-247--------------------------------------------------------------------------------
B7QFM3_IXOSC/67-96--------------------------------------------------------------------------------
A412_LOXHI/219-248--------------------------------------------------------------------------------
B9XKB9_9BACT/233-263--------------------------------------------------------------------------------
E8W4Q9_STRFA/244-279--------------------------------------------------------------------------------
SMD_IXOSC/243-272--------------------------------------------------------------------------------
A312_LOXS4/219-248--------------------------------------------------------------------------------
B1S_LOXAS/217-246--------------------------------------------------------------------------------
A6EG56_9SPHI/219-249--------------------------------------------------------------------------------
A21_LOXSP/213-242--------------------------------------------------------------------------------
A1OB2_LOXVA/213-242--------------------------------------------------------------------------------
A5FEV6_FLAJ1/213-243--------------------------------------------------------------------------------
D7VYF5_9FLAO/219-249--------------------------------------------------------------------------------
Q4Z7T4_PLABA/27-60--------------------------------------------------------------------------------
A424_LOXLA/217-246--------------------------------------------------------------------------------
B9GJW3_POPTR/78-121--------------------------------------------------------------------------------
B7PW58_IXOSC/226-255--------------------------------------------------------------------------------
B1LB_SICPE/216-245--------------------------------------------------------------------------------
C6W721_DYAFD/221-251--------------------------------------------------------------------------------

PF00388

Q60450_CRIGR/286-429DYAFKAS.P...........YPVI---LSL-ENHC.SLEQ----------------------------------------
A4I5X4_LEIIN/300-441RHAFTAS.P...........FPVI---LSL-EVHT.SDEQ----------------------------------------
Q8IJR0_PLAF7/626-770MFGFTTS.P...........YPII---LSL-EIHC.KNKH----------------------------------------
PLC_STAAE/34-177YYLSAYP.N...........ETIV---MSM-KKDY...DS----------------------------------------
Q6BZ51_DEBHA/455-607KYAFITS.P...........FPLI---ISL-EINC.SIDN----------------------------------------
PLCG2_MOUSE/314-457DHAFVTS.S...........FPVI---LSI-EEHC.SVEQ----------------------------------------
PLCL1_HUMAN/400-543KFAFVAS.E...........YPLI---LCL-GNHC.SLPQ----------------------------------------
PLCD9_ARATH/109-254QHAFTPTRS...........YPVI---ITI-KDSL.KPDL----------------------------------------
PLCD1_ARATH/107-250ENAFQVS.A...........YPVV---LTL-EDHL.TPIL----------------------------------------
PLCD6_ARATH/139-282DYAFSSS.P...........YPVI---ITL-EDHL.TPDL----------------------------------------
A5DAA1_PICGU/440-595KYAFSSS.S...........WPVI---LSL-EVHC.NAEN----------------------------------------
Q636S2_BACCZ/57-195QFLKDNP.S...........ETII---MSL-KKEY.....----------------------------------------
A7MD68_DANRE/316-460DYAFKAS.P...........YPVI---LSL-ENHC.SLEQ----------------------------------------
PLCD4_RAT/292-436QYAFQSS.D...........YPLI---LSL-DNHC.TWEQ----------------------------------------
Q0PGC0_LISMN/61-200QFLKKNP.K...........ETII---MRL-KDE..QNSN----------------------------------------
PLCZ1_BOVIN/157-300KYAFLAS.E...........YPVV---LSL-ENHC.SPSQ----------------------------------------
Q55WA1_CRYNB/160-302QYGFVTS.P...........YPII---IST-EIHC.ASEQ----------------------------------------
Q2YGU1_LILDA/57-200EYAFVAS.P...........YPVI---ITL-EDHL.TPDL----------------------------------------
PLCD3_ARATH/108-251DNAFHVS.D...........YPVI---ITL-EDHL.PPKL----------------------------------------
Q5JYS9_HUMAN/151-300ETAFVTS.E...........YPVI---LSF-ENHC.SKYQ----------------------------------------
O97034_9METZ/308-451DHAFVTS.E...........YPII---LSI-EQHC.DIQQ----------------------------------------
A5E691_LODEL/21-192EYAFESS.P...........YPVI---LSL-EINC.SANY----------------------------------------
Q16W08_AEDAE/315-464DTAFVTS.D...........YPVI---LSF-ENHC.CRSQ----------------------------------------
PLCD5_ARATH/114-257EHAFYAS.A...........YPVI---LTL-EDHL.TPDL----------------------------------------
Q5QIB9_STRPU/301-444KYAFAAS.E...........YPLI---LSF-ENHC.SVEQ----------------------------------------
Q6CSI9_KLULA/402-540KYAFITS.P...........YPLI---VSL-EIHC.KKDY----------------------------------------
A0FLF3_TOBAC/111-253EHAFSVS.E...........YPVV---ITL-EDHL.TPDL----------------------------------------
O97037_HYDVU/300-443MGAFVQS.E...........YPVI---LSF-ENHC.SPEQ----------------------------------------
PLCD3_HUMAN/339-483DHAFTLS.P...........YPVI---LSL-ENHC.GLEQ----------------------------------------
Q385H1_TRYB2/248-393KYAFVNS.I...........YPVI---LSL-EVHT.SLRQ----------------------------------------
Q3TWI4_MOUSE/319-469EAAFKTS.P...........YPVI---LSF-ENHVDSAKQ----------------------------------------
P93620_VIGUN/106-249EYAFVKS.Q...........YPLV---ITL-EDHL.TPDL----------------------------------------
A2TF43_9LAMI/114-257EHAFIAS.E...........YPVI---LTL-EDHL.TPDL----------------------------------------
Q16ZC0_AEDAE/42-189KSAFVQS.A...........YPVI---LSI-ENHC.SVTQ----------------------------------------
Q4S9T4_TETNG/359-525KYAFLTS.Q...........YPLL---LYL-CHRC.SPAQ----------------------------------------
O49950_SOLTU/113-256EHAFVAS.E...........YPVI---ITL-EDHL.TPDL----------------------------------------
Q4S530_TETNG/241-384DYAFKTS.Q...........YPVI---LSL-ENHC.SVDQ----------------------------------------
PLCH1_HUMAN/301-445KHAFVKN.E...........FPVI---LSI-ENHC.SIQQ----------------------------------------
Q45UQ8_NEUCS/110-360DYGFATT.D...........LPLI---VSL-EVHC.SAEQ----------------------------------------
Q4SKC0_TETNG/309-451DHAFVTS.E...........FPVI---LSI-EEHC.PIEQ----------------------------------------
A2QEJ2_ASPNC/86-262DSAFVAS.D...........LPVI---VSL-EVHT.CLEQ----------------------------------------
Q4N7P5_THEPA/468-615ESAFESN.K...........LPVI---LSF-EMHC.SDEF----------------------------------------
A7S279_NEMVE/319-466DSAFQTS.D...........FPVI---LSF-ENHC.SKHQ----------------------------------------
PLC_DICDI/324-466ARGFETS.P...........YPVI---LSL-EVHC.SVPQ----------------------------------------
Q5BFL6_EMENI/534-676RYAFFSS.E...........FPLV---ISL-EVHC.NPEQ----------------------------------------
Q2HB23_CHAGB/553-696KYAFAKS.R...........FPLW---ISL-EVRC.SPNT----------------------------------------
A6RBI2_AJECN/84-320DHAFVTS.D...........LPII---VSL-EVHA.CLEQ----------------------------------------
Q1LWH7_DANRE/284-423NYSFKAS.E...........YPVI---LSI-ENHC.SVEQ----------------------------------------
A0CKY8_PARTE/271-413KFGFMFS.S...........YPII---LSL-ELHC.SIDQ----------------------------------------
Q3UZ68_MOUSE/210-353EHAFVAS.E...........YPVI---LSI-EDHC.SIAQ----------------------------------------
Q5CLA7_CRYHO/367-509DYAFQIS.P...........YPII---LSL-EMHA.SDKQ----------------------------------------
E9AEI1_LEIMA/296-447DYAFQNP.SNNQEAAWNPRELPVI---VSL-EVHT.SPEQ----------------------------------------
Q91423_9TELE/46-190EYAFKTS.E...........YPVI---LSL-ENHC.SVEQ----------------------------------------
Q9XWB7_CAEEL/306-468ECAFKTS.P...........YPVI---LSI-ENHL.GRKQ----------------------------------------
Q8IA75_CAEEL/367-517EFAFERS.R...........YPLL---LKV-SVHC.STDW----------------------------------------
PLC1_YEAST/382-521KYAFITS.P...........YPLI---ISL-EINC.NKDN----------------------------------------
Q4SCY8_TETNG/29-191ECAFKTS.P...........FPII---LSF-ENHVDSPKQ----------------------------------------
PLCE1_HUMAN/1394-1541RSAFINS.D...........LPII---ISI-ENHC.SLPQ----------------------------------------
Q6QAF2_LYTPI/318-467DTAFVTS.D...........FPVI---LSF-ENHC.SKPQ----------------------------------------
A7RXP6_NEMVE/244-393ECAFKTS.D...........YPVI---LSF-ENHC.TPKQ----------------------------------------
Q2QNK1_ORYSJ/114-257EYAFCAS.P...........YPLV---ITL-EDHL.TPDL----------------------------------------
Q7QHE3_ANOGA/319-462EHAFITS.E...........YPLI---LSI-EQNC.SLTQ----------------------------------------
A0BLC4_PARTE/285-429EYGFKYS.K...........YPLI---LSL-EVHC.CVKQ----------------------------------------
Q6FY00_CANGA/381-519KYAFITS.P...........YPLI---ISM-EVRC.NSKN----------------------------------------
A0BLM0_PARTE/262-404DFAFYKD.N...........NPAI---LSL-EMHC.CLKQ----------------------------------------
Q59LC4_CANAL/566-727KFAFIVS.P...........WPLI---LSL-EIHC.SPEC----------------------------------------
Q4T850_TETNG/115-259KYAFINN.Q...........FPVI---LSI-ENHC.TIQQ----------------------------------------
Q9FSW1_9POAL/148-291QYAFVAS.P...........YPVI---ITL-EDHL.TPDL----------------------------------------
Q2UPV6_ASPOR/98-321DSAFVTS.D...........LPVI---VSL-EVHA.SLEQ----------------------------------------
O97035_HYDVU/328-477ESAFKTS.E...........YPVI---LSF-ENHC.SAKQ----------------------------------------
Q4PDE8_USTMA/122-279QAIQKEQDEAQRD..HSFKVAPIL---LSL-ENHC.GHAG----------------------------------------
Q9XEK4_BRANA/105-249THAFEVS.D...........YPVV---VTL-EDHL.TPEL----------------------------------------
A7T501_NEMVE/158-302DFAFLNN.R...........YPVI---LSL-ENHC.SVEQ----------------------------------------
Q4RWH6_TETNG/299-443QYAFKAS.P...........YPLI---LSL-ENHC.SVEQ----------------------------------------
A5A2F9_TOBAC/110-253EHAFVAS.P...........YPLV---ITL-EDHL.TPDL----------------------------------------
A7ASE0_BABBO/522-670ETAFKFS.K...........LPVI---LSM-QMHC.TDEC----------------------------------------
Q7ZU40_DANRE/294-438EYAFKTS.E...........YPVI---LSL-ENHC.GVEQ----------------------------------------
Q45QJ6_RAT/314-464ESAFKTS.P...........YPVI---LSF-ENHVDSPRQ----------------------------------------
Q0B816_BURCM/28-162RFLDAHP.R...........ECIV---MSV-KDEW.....----------------------------------------
Q4PA81_USTMA/724-872RYAFVTS.P...........YPLI---LSL-EVHA.DPPQ----------------------------------------
A7TR21_VANPO/381-520KYAFITS.P...........YPLI---ISL-ETNC.NKIN----------------------------------------
Q75C92_ASHGO/397-535KYAFITS.P...........YPLI---LSL-EIHC.RSEG----------------------------------------
A7RPQ0_NEMVE/307-450EHAFDVS.P...........YPVI---LSI-ENHC.CVKQ----------------------------------------
Q5MG88_TOXGO/407-550DYGFQRS.K...........FPII---LSL-EMHC.STKQ----------------------------------------
A7SXK4_NEMVE/94-237ESAFKVS.P...........YPVI---VSL-ENHC.SVQF----------------------------------------
PHLC_TRYBB/54-199DFLTTPA.SA.........NEFVI---LDF-LHFY.GFNE----------------------------------------
Q4S9B8_TETNG/321-464KYAFVAS.E...........FPVI---LCL-ENHC.SLKQ----------------------------------------
O07690_LISSE/61-200SFLKENP.K...........EVVI---MRL-KDE..NKSE----------------------------------------
A4S165_OSTLU/1-153DRAHVAS.E...........YPVI---VTL-ENHA.SRET----------------------------------------
Q7PW25_ANOGA/289-436ETAFKTS.E...........FPVI---LSF-ENHC.NPRQ----------------------------------------
Q4SDX6_TETNG/287-431EYAFKSS.P...........YPLI---LSL-ENHC.SVEQ----------------------------------------
A7RKT2_NEMVE/272-413EYAFEVS.E...........YPLI---LSL-ENHC.NIQQ----------------------------------------
Q4RKI8_TETNG/349-492KCAFVAS.D...........YPLI---VCI-ENHC.SYQQ----------------------------------------
Q766D4_9BRYO/108-251ANAFVSS.K...........YPVV---ITL-EDHL.SSPL----------------------------------------
Q2PEW5_TRIPR/126-269QYAFVAS.E...........YPVV---ITL-EDHL.TPDL----------------------------------------
A6RM87_BOTFB/546-665KYAFVKS.H...........FPLW---ISL-EVHC.NDAQ----------------------------------------
Q4RX70_TETNG/314-458KHAFTKS.Q...........YPVI---LSI-ENHC.SVPQ----------------------------------------
A3LSB2_PICST/461-615KYAFFTS.P...........YPLV---ISL-EINC.SVAS----------------------------------------
A4EAJ4_9ACTN/13-159TFLNEHP.S...........EALI---MLV-SRGN.DEAT----------------------------------------
A3LNB7_PICST/20-167DFLDDNK.S...........ETVI---VSL-KQEG.SNDW----------------------------------------
Q6R6E0_LISIV/61-201NFLKEHP.K...........ETII---MRL-KDEN.NHKN----------------------------------------
Q24284_DROME/320-463DHAFTSS.E...........YPVI---LSI-EQNC.SLEQ----------------------------------------
PLCH2_HUMAN/328-472KYAFIKN.E...........YPVI---LSI-ENHC.SVIQ----------------------------------------
Q0UVV5_PHANO/116-337DYAFKTS.N...........LPLI---VSL-EVHT.CPEQ----------------------------------------
Q4QBH9_LEIMA/195-340QYAFTAS.A...........YLVI---LSL-GVHT.SVEQ----------------------------------------
PLCD4_HUMAN/292-436QYAFQTS.D...........YPVI---LSL-ETHC.SWEQ----------------------------------------
Q0UE70_PHANO/101-258DVVDKEAAEER.......HAAPIM---ISL-ENHC.DAHG----------------------------------------
A5AGR6_VITVI/112-255KYAFVAS.E...........YPVI---ITL-EDHL.TPDL----------------------------------------
B9DGG5_ARATH/8-150ANAFAIS.K...........YPVI---ITL-EDHL.TPKL----------------------------------------
Q4RLM8_TETNG/312-491ESAFKTS.Q...........YPVI---LSF-ENHVDTVKQ----------------------------------------
PLCL2_MOUSE/429-572KYAFFAS.E...........YPLI---LCL-ENHC.SIKQ----------------------------------------
PLCZ1_CHICK/159-303KYAFAAS.D...........YPVV---LSL-ENHC.STKQ----------------------------------------
A2IB48_CHAVR/321-464ANAFLVS.E...........YPII---LSI-ENHC.SLLQ----------------------------------------
PLCD4_XENLA/292-436KYAFRVS.D...........YPVI---LSL-ENHC.GVEQ----------------------------------------
Q3F156_BACTI/43-187QFLRDHP.K...........ETIL---MRL-KEDT.DPEN----------------------------------------
Q2GUM5_CHAGB/104-264DVVDHEETAARGR...GYTPAPIL---VSL-ENHC.DRNG----------------------------------------
Q7SE08_NEUCR/136-356EEAFVTN.H...........LPII---VSL-EVGA.DREQ----------------------------------------
Q21754_CAEEL/318-461RTAFETS.P...........YPVI---LTL-ENHV.GFVQ----------------------------------------
Q9GV33_WATSC/324-471ECAFKVS.E...........YPVI---LSF-ENHC.SVPQ----------------------------------------
A7SDH9_NEMVE/209-352EHAFKVS.D...........YPVI---LSL-ENHC.NIEN----------------------------------------
Q6EZG7_CAEEL/342-492DTAFARS.D...........FPVV---LSF-ENHC.SKSN----------------------------------------
Q6RY08_ASTMI/305-448EHAWVQS.D...........LPII---LSI-ENHC.TLIQ----------------------------------------
A4HCK9_LEIBR/248-393QHAFTAS.P...........YPVI---LSL-EVHA.SVAQ----------------------------------------
Q236T7_TETTS/368-513QYGFERS.V...........YPII---INL-EHEC.SVNQ----------------------------------------
Q9P866_CANAX/68-213KFLAHNS.S...........ETVI---VSI-KQEG.SDDW----------------------------------------
O97036_HYDVU/314-460DTAFLTS.P...........YPVV---LSF-ENHC.SLPQ----------------------------------------
O97033_9METZ/324-472EYAFITS.E...........FPVI---LSI-ENHC.RHKP----------------------------------------
PLC1_SCHPO/443-585KYAFVVS.P...........YPLF---ISL-EIHC.CPDQ----------------------------------------
A6AS90_VIBHA/22-157NFLSENP.S...........EAVV---MLM-NAAT.SGDK----------------------------------------
Q013R6_OSTTA/119-269ERAHVAS.E...........YPVI---VTL-ENHA.SKET----------------------------------------
Q75IL8_ORYSJ/119-262EYAFVAS.P...........YPVI---LTL-EDHL.TPDL----------------------------------------
O96101_TRYCR/248-393EYAFKAS.E...........YPVI---LSI-EVHT.SSAQ----------------------------------------
A6EGD5_9SPHI/56-190GFLNSNP.T...........ETII---MSV-KEEH.TPSN----------------------------------------
PLCD8_ARATH/107-248EHAFTKC.T...........YPLI---ITF-KDGL.KPEL----------------------------------------
Q4S959_TETNG/321-464QYAFESS.E...........YPLI---LCL-VTHC.CIPQ----------------------------------------
Q762E2_9BRYO/150-294DNAFTTS.A...........YPVV---VTI-ESHL.DLEH----------------------------------------
Q4RSB2_TETNG/98-242QHAFEKS.P...........YPVI---LSL-ENHC.CKEQ----------------------------------------
Q6CD33_YARLI/505-648KYGFIAS.P...........NPLI---LSL-EIHC.SASN----------------------------------------
A7UXE0_NEUCR/117-274QVVEEEEESGGG....GGGGAPVL---ISL-ENHC.GAQG----------------------------------------
A1D7Q8_NEOFI/96-331DSAFVAS.D...........LPVI---VSL-EVHT.CIEQ----------------------------------------

PF00387

PLCD1_MOUSE/491-609VGHLSRI-------------YPAG...WRT.DSSNY.SPV----------------------------------------
Q29N33_DROPS/566-683KHQLSRV-------------YPAG...TRF.DSSNF.MPQ----------------------------------------
PLCG2_HUMAN/929-1044QKGLTRV-------------YPKG...QRV.DSSNY.DPF----------------------------------------
PIPA_DROME/549-666KRQMSRI-------------YPKG...TRA.DSSNY.MPQ----------------------------------------
Q6BZ51_DEBHA/661-779RKYFMRV-------------YPSN...IRL.KSSNF.LPM----------------------------------------
PLCH1_HUMAN/600-714QKQLTRI-------------YPSA...YRI.DSSNF.NPL----------------------------------------
A5DAA1_PICGU/647-765RKFLMRV-------------YPSK...MRI.GSSNF.NPI----------------------------------------
A7RXP6_NEMVE/449-566KRQLSRI-------------YPKG...TRV.GSENY.MPQ----------------------------------------
A7RPQ0_NEMVE/491-608KRCLSRI-------------YPSG...KRV.GSSNY.NPQ----------------------------------------
Q7ZU40_DANRE/483-600TDKLSRI-------------YPGG...MRT.DSSNY.NPV----------------------------------------
PLCB2_MOUSE/546-663KRQMSRV-------------YPKG...TRM.DSSNY.MPQ----------------------------------------
PLCL1_RAT/585-702KKFLSRV-------------YPSA...MRI.DSSNL.NPQ----------------------------------------
Q4T850_TETNG/440-554QRQLSRI-------------YPSA...YRI.DSSNF.NPQ----------------------------------------
Q55WA1_CRYNB/353-467FKHISRV-------------YPRG...TRL.GSTNF.NPV----------------------------------------
O96101_TRYCR/462-581QHCLSRI-------------YPAG...SRV.GSSNY.NPQ----------------------------------------
P78585_BOTFU/650-769MRYLMRV-------------YPNG...WRV.ASTNF.DPL----------------------------------------
Q75C92_ASHGO/591-714RRHLMRV-------------YPHA...FRY.KSSNY.DPI----------------------------------------
PLCZ1_MACFA/381-498RKFITRI-------------YPKA...TRA.DSSNF.NPQ----------------------------------------
Q4RX70_TETNG/609-725QRQLLRV-------------YPSN...YRV.DSSNF.NPQ----------------------------------------
Q08JX0_ORYLA/549-666KRQMSRI-------------YPKG...TRM.DSSNY.SPQ----------------------------------------
O97033_9METZ/764-881MRQMSRI-------------YPQG...GRI.NSSNY.MPQ----------------------------------------
Q25285_LOLFO/513-630KKQLTRI-------------YPKG...TRV.DSSNY.VPQ----------------------------------------
A3LSB2_PICST/669-787RRYLMRV-------------YPSK...IRV.RSSNF.LPL----------------------------------------
A1D7Q8_NEOFI/374-488RHFFMRV-------------YPYG...LRV.NSSNP.DPT----------------------------------------
Q17CT3_AEDAE/941-1054RNQISRV-------------YPKG...QRL.DSSNY.NPV----------------------------------------
Q4SKC0_TETNG/940-1053RKALSRI-------------YPKG...QRV.ESSNY.DPY----------------------------------------
Q8CI86_MOUSE/590-707KQQLSRI-------------YPKG...TRV.DSSNY.MPQ----------------------------------------
Q0UE70_PHANO/300-418AHHLMRV-------------FPKG...TRI.SSKNL.APV----------------------------------------
PLC1_YEAST/586-710RRYLMRV-------------YPHV...LRY.KSSNF.NPI----------------------------------------
Q6NTX2_XENLA/945-1063RRQLSRI-------------YPKG...QRL.DSSNY.DPL----------------------------------------
Q2UCJ8_ASPOR/565-684RKYLTRV-------------YPSG...FRL.RSSNF.DPL----------------------------------------
Q4QBH9_LEIMA/390-509DTCLSRV-------------FPAG...SRI.DSSNY.RPL----------------------------------------
PLC_DICDI/538-653QNHLLRV-------------YPRG...TRF.DSSNF.DPM----------------------------------------
Q0UVV5_PHANO/395-509KHFFMRA-------------YPKG...LRL.NSSNL.NPS----------------------------------------
Q4PA81_USTMA/992-1114RSHLTRI-------------YPSMMSFARLHASRNF.VPL----------------------------------------
Q4SDX6_TETNG/473-589SQKLSRI-------------YPSG...QRL.QSSNY.NPQ----------------------------------------
A4S165_OSTLU/200-316KAHLLRT-------------YPGG...QRI.MSNNY.DPS----------------------------------------
Q86RA6_DROVI/974-1087RNQISRV-------------YPKG...QRL.DSSNF.NPV----------------------------------------
Q4RSB2_TETNG/292-409QRFLSRI-------------YPAG...SRT.SSSNY.NPQ----------------------------------------
Q6RY08_ASTMI/926-1041QHQVSRT-------------YPKG...QRF.DSSNY.DPV----------------------------------------
Q45UR4_NEUCS/413-527KHYLMRA-------------YPSG...MRI.LSSNL.DPA----------------------------------------
A7SMY6_NEMVE/399-515RRQISRV-------------YPKG...SRI.DSSNY.DPV----------------------------------------
Q2HB23_CHAGB/789-908MRHLMRV-------------YPNG...GRI.SSSNF.DPL----------------------------------------
PLCL2_HUMAN/617-734KRFLARV-------------FPSP...MRI.DSSNM.NPQ----------------------------------------
Q59LC4_CANAL/795-913RRYLMRV-------------YPSG...TRL.KSSNF.NPL----------------------------------------
Q0UC00_PHANO/609-729VRCLMRV-------------YPHA...FRI.TSTNF.DPL----------------------------------------
Q4S959_TETNG/510-627KRFLSRV-------------YPTP...MRI.DASNM.NPQ----------------------------------------
Q1LWH7_DANRE/476-593ARQLSRV-------------YPSG...LRT.DSSNF.NPQ----------------------------------------
PLCD4_RAT/502-619ARQLCRV-------------YPSG...LRT.DSSNY.NPQ----------------------------------------
Q4RKI8_TETNG/560-677KHFLSRV-------------YPCP...MRI.DSSNM.NPQ----------------------------------------
PLCD4_HUMAN/492-609TWQLSRV-------------YPSG...LRT.DSSNY.NPQ----------------------------------------
O97037_HYDVU/475-592NKFLVRT-------------YPKG...SRI.DSSNY.NPT----------------------------------------
O97035_HYDVU/534-651KFQNSRI-------------YPKG...SRV.SSDNY.IPQ----------------------------------------
Q5QIB9_STRPU/494-610KIFLSRI-------------YPGG...LRT.NSSNY.SPV----------------------------------------
A2QEJ2_ASPNC/322-436RHFFMRV-------------YPNG...LRV.DSSNM.DPT----------------------------------------
Q5IRA3_CRYPA/437-551RKYLMRA-------------YPSG...FRV.GSSNL.DPT----------------------------------------
PLCD3_HUMAN/527-644ARQLTRV-------------YPLG...LRM.NSANY.SPQ----------------------------------------
Q2VYF9_9TRYP/452-571NRCLSRI-------------YPTG...TRI.GSSNF.HPQ----------------------------------------
A7TR21_VANPO/594-717RRFLMRI-------------YPHA...LRY.KSSNF.DPI----------------------------------------
Q6CSI9_KLULA/616-739RRHLMRI-------------YPHM...LRY.KSSNF.NPI----------------------------------------
Q91423_9TELE/236-353MDKLSRI-------------YPAG...TRT.DSSNY.SPV----------------------------------------
Q013R6_OSTTA/351-466NAHLLRT-------------YPAG...HRI.FSNNY.DPS----------------------------------------
Q4SCY8_TETNG/264-356KLQLSRI-------------YPKG...TRV.DSSNY.NPQ----------------------------------------
A7RPT6_NEMVE/606-723RYKLCRI-------------YPAG...YRI.DSSNP.NPQ----------------------------------------
Q5B933_EMENI/339-453RKYFMRV-------------YPYG...LRV.NSSNL.DPT----------------------------------------
PLCD4_XENLA/485-602AWQLMRI-------------YPTG...LRT.DSSNY.NPQ----------------------------------------
Q5JYS9_HUMAN/412-529KRQMSRI-------------YPKG...GRV.DSSNY.MPQ----------------------------------------
Q9XWB7_CAEEL/527-651KSKITRI-------------YPKA...SRI.YSTNY.NPM----------------------------------------
A7SDH9_NEMVE/402-519TRQLSRT-------------YPAG...SRV.DSSNY.NPQ----------------------------------------
PLCZ1_CHICK/376-493SRFITRI-------------YPKG...TRA.GSSNY.NPQ----------------------------------------
PLCH2_HUMAN/625-740QQQLSRI-------------YPSS...YRV.DSSNY.NPQ----------------------------------------
Q7QHE3_ANOGA/969-1085RNHLSRV-------------YPKG...QRL.DSSNY.HPT----------------------------------------
A7MD68_DANRE/509-626IDKLSRI-------------YPAG...SRT.DSSNY.NPV----------------------------------------
A7EE08_SCLS1/440-554RNYFMRA-------------FPAG...KRF.DSSNL.DPS----------------------------------------
A5E691_LODEL/252-371RKYFLRV-------------YPSR...FRL.KSSNF.IPI----------------------------------------
Q6CD33_YARLI/706-822RRYLTRI-------------YPSG...YRV.KSSNL.NPL----------------------------------------
Q2H4G2_CHAGB/404-521RDFFMRI-------------YPKG...LRV.DSSNP.DPS----------------------------------------
PLC1_SCHPO/637-753LRYLCRV-------------YPGP...LRV.GSTNF.NPQ----------------------------------------
PLD3A_DANRE/505-621SRQLSRI-------------YPSA...QRL.QSSNF.DPQ----------------------------------------
O97034_9METZ/947-1065HTYLNRV-------------YPKG...QRL.DSSNY.DPV----------------------------------------
A7SXK4_NEMVE/279-396KHQISRI-------------YPGN...LRV.DSSNY.DPI----------------------------------------
A6RBI2_AJECN/377-491REYMMRT-------------YPSG...LRV.NSSNL.DPS----------------------------------------
Q1LWW2_DANRE/14-131RTALTRV-------------YPSG...ARV.DSSNF.DPC----------------------------------------
A2IB48_CHAVR/945-1060KYQLSRV-------------YPKG...SRI.DSSNY.DPQ----------------------------------------
Q6FY00_CANGA/575-699RRHMMRV-------------YPHA...LRY.RSTNFEDPV----------------------------------------
Q4SNU6_TETNG/496-627AEKLSRI-------------YPAG...VRT.DSSNY.NPV----------------------------------------

PF03009

PGC1_SCHPO/37-267............QDFVDLVH--------------AQG.KQVFAW-TL-----------NT--------------P.....
GPC1B_CAEEL/349-649...........DQKPIEIAE--------------KYG.LIKFVW-GD-----------DL--------------NS....
YQIK_BACSU/7-235.............DEVLKKM--------------RNGLIKVRPY-TV-----------NR--------------P.....
Q9RZL4_DEIRA/249-566.....IDGEGHTTDFVTRAH--------------TAG.LLVHSW-TF-----------RN--------------EPTYLL
Q9X1V6_THEMA/6-217.................SFR--------------KKG.IVIFVW-TL-----------ND--------------P.....
Y2277_MYCTU/36-295...........DEASVDCFR--------------SQSGMKVMGF-AV-----------KT--------------V.....
Q9RWX3_DEIRA/7-220..............LISMAR--------------RRG.WRVNAW-TV-----------NE--------------V.....
O07244_MYCTU/14-242..............RVRGFH--------------AAG.RQVHAW-TV-----------DE--------------P.....
Q9SD81_ARATH/49-357P..VNNNRLMTPTDLVARAH--------------SRN.LQVHPY-TY-----------RN--------------ENQFLH
GPC1A_CAEEL/406-706...........DPMPVKKAN--------------EFG.MVTFVW-GE-----------DL--------------DK....
O02322_CAEEL/73-322...........ISRFLKTDA--------------AANNIYLAGW-TS-----------NN--------------Q.....
YHDW_BACSU/6-233.............LMIGSIN--------------KNG.LNIFAW-TV-----------NN--------------Q.....
GDE1_SCHPO/752-1061...........CPRLIKAVK--------------QLG.LSCYTY-GV-----------LN--------------ND....
Q45201_BORHE/38-330.....IIIEGKITDLTSLAH--------------KHN.MEVHPY-TF-----------RI--------------DALPSY
Q9W2L6_DROME/349-632...........DPGLVQRAK--------------AQV.PIVLLW-GS-----------DL--------------KD....
O86738_STRCO/16-227..............LAERVH--------------RDG.FLLSVW-TP-----------DT--------------R.....
GDE1_YEAST/877-1212...........APRLVQVVK--------------SNG.LVCVTY-GV-----------DN--------------ND....
Q9VQU3_DROME/375-661...........DPSQVNLAK--------------ERG.LVLFCW-GD-----------DN--------------NS....
Q9V208_PYRAB/12-236..........KTVEAIKWAR--------------SLG.LKVVLW-TE-----------ND--------------ELF...
Q9Z3F4_XANEU/274-516............R.GFFRSN--------------EQG.AAGLAD-TA-----------MQ--------------W.....
GLPQ1_MYCTU/17-259............PQLVDRSA--------------AQG.RAVYCW-NV-----------DE--------------Y.....
PGC1_YEAST/7-246.............LRLLPVL--------------MKNDIKVYLW-TV-----------NK--------------P.....
Q9RKX8_STRCO/20-243..............FLRAAH--------------ARG.LQVHVW-TV-----------ND--------------A.....
Q9ZTU6_WHEAT/118-414............NPLVKSLQ--------------SAG.LPVYVY-LL-----------RN--------------EFFSQP
GLPQ_BACSU/43-285.............ENVRMIR--------------SHG.LLLHPY-TV-----------NN--------------E.....
GLPQ_ECOLI/36-350E.ETSQPGNIKLTGMVQDAQ--------------QNK.LVVHPY-TV-----------RS--------------DKLPEY
GLPQ_HAEIN/40-355NKEESKPDNIVYTPLVKELA--------------QYN.VEVHPY-TV-----------RK--------------DALPEF
Q89384_PBCV1/5-217..............IVKFAT--------------DRN.INVYAY-TV-----------ND--------------Y.....
UGPQ_ECOLI/12-239..............RVMQLK--------------DAG.LRILVY-TV-----------NK--------------P.....
Q9SGA2_ARATH/39-318...........NPALVNKIK--------------ESK.LSLMTY-GK-----------LN--------------NV....
Q9YFI4_AERPE/15-220..............VIRALR--------------QSG.LKVVVW-TV-----------NT--------------E.....
Q44028_CUPNE/17-245..............VIAAAH--------------AAG.FRVLCY-TV-----------ND--------------P.....
Q9RSP0_DEIRA/37-277..............FVRALH--------------ARG.VAVQVW-TI-----------DD--------------E.....
Q9UAW8_CAEEL/68-331..............LIMDQR--------------RRG.MRVAVW-TV-----------ND--------------M.....

PF13653

A8I2Q7_CHLRE/208-237---------------------------------------QLYAW.TI...........NH..............A-----
C6JG09_9FIRM/261-290---------------------------------------RLYIY.TV...........ND..............L-----
Q97AF5_THEVO/125-154---------------------------------------PVIPW.TV...........DD..............V-----
C1EA09_MICSR/311-340---------------------------------------HVVSW.VV...........DD..............E-----
D3R0L3_CLOB3/197-226---------------------------------------GLSVW.TV...........DE..............S-----
Q53JJ0_ORYSJ/166-195---------------------------------------KVYAW.TV...........DD..............A-----
C2HMV5_LACAI/99-128---------------------------------------TQRIW.TV...........DN..............P-----
B5DF39_RAT/181-210---------------------------------------SVNLY.TV...........NA..............P-----
B3RWH1_TRIAD/177-217---------------------------------------SAGAW.TI...........YKMTLSE...KELKASD-----
B6A4H5_RHILW/237-277---------------------------------------RVDAW.TFTLKDPEAGFSDEE..............W-----
C5XX04_SORBI/147-190---------------------------------------TVFVG.VL...........KNEFMNLGFDFFADPTI-----
C3KNM3_RHISN/284-318---------------------------------------ETDAW.TV...........NP..............G-----
A1SJR5_NOCSJ/183-212---------------------------------------VVMTW.PI...........DD..............L-----
C5Y879_SORBI/258-287---------------------------------------RVFAW.TV...........DD..............S-----
C4H5M9_YERPE/194-223---------------------------------------KILLI.GI...........NS..............A-----
D2QM66_SPILD/215-245---------------------------------------PFRFW.AI..........PDT..............P-----
Q1M8H9_RHIL3/237-277---------------------------------------RVDAW.TFT.........LKD..............P-----
D3PWH3_STANL/239-274---------------------------------------QVRFW.ATPDE.....AGANR..............E-----
A4F9Z1_SACEN/227-262---------------------------------------RVRFW.ATPDA.....ALPNR..............E-----
A3XKX4_LEEBM/206-236---------------------------------------PFRFWASP...........DT..............K-----
A8M0I4_SALAI/230-265---------------------------------------RVRFWATP...........DEPG.........AQRE-----
A21_LOXAR/214-243---------------------------------------KVYVW.TI...........DK..............Y-----
C2FUE7_9SPHI/240-270---------------------------------------PFRFW.GN..........HDS..............P-----
A4AS02_MARSH/212-242---------------------------------------PFRFW.GC..........PDT..............P-----
B2KBC_SICCD/215-244---------------------------------------KVYAW.TL...........VR..............K-----
A6CED4_9PLAN/229-259---------------------------------------RIRFWATP...........ES..............E-----
C7PNH8_CHIPD/228-258---------------------------------------KVRLWASP...........EN..............P-----
A1H1_LOXRE/220-249---------------------------------------KVYYW.TV...........DK..............R-----
B1H1_LOXIN/248-277---------------------------------------KVYTW.SI...........DK..............E-----
C5C387_BEUC1/626-661---------------------------------------RVRFW.NT...........PDAAG........PARD-----
B2L2_SICCD/215-244---------------------------------------KVYAW.TL...........VK..............Y-----
A3HWH1_9BACT/215-245---------------------------------------PVRFW.GS..........PDS..............K-----
Q6MRA8_BDEBA/253-282---------------------------------------RIFLG.PI...........EN..............E-----
A6WFY1_KINRD/264-299---------------------------------------EVRFWNTP...........DAPG.........PARD-----
A51_LOXIN/249-278---------------------------------------KVYYW.TV...........DK..............Y-----
A7T397_NEMVE/56-86---------------------------------------QTYIW.VL...........NK..............K-----
C6W5T4_DYAFD/220-250---------------------------------------KVRIWATP...........DN..............I-----
A5ZJ68_9BACE/227-257---------------------------------------AARFW.GC..........PDT..............K-----
B312_LOXSN/215-244---------------------------------------KVYTW.TV...........DY..............Y-----
A71_LOXAR/216-245---------------------------------------KVYYW.TV...........DK..............Y-----
C0Y618_BURPE/135-164---------------------------------------SILLI.GV...........NS..............A-----
A612_LOXHI/216-245---------------------------------------KVYYW.TV...........DK..............E-----
B7Q3W8_IXOSC/213-242---------------------------------------KVYHW.TI...........DL..............S-----
D2QQ87_SPILD/603-633---------------------------------------KLRLWASP...........ED..............P-----
C7NM04_KYTSD/250-284---------------------------------------QVRFWATP...........DTIW..........LRE-----
Q010C1_OSTTA/112-141---------------------------------------DVIPW.IV...........DD..............E-----
Q7UF88_RHOBA/253-283---------------------------------------RVRFWATP...........DH..............Q-----
B1Q_LOXIN/246-275---------------------------------------KVYTW.SV...........DK..............Y-----
A3ZUF0_9PLAN/222-252---------------------------------------QIRFWGTP...........DT..............P-----
A21_LOXVA/216-245---------------------------------------KVYVW.TV...........DK..............V-----
A6EG44_9SPHI/221-251---------------------------------------PVRFW.GN..........PDT..............K-----
A41_LOXRU/216-245---------------------------------------KVYYW.TI...........EK..............Y-----
B1R_LOXAS/214-243---------------------------------------KVYTW.TI...........DK..............S-----
A1LA_LOXAR/261-290---------------------------------------KVYYW.TV...........DK..............R-----
C7P9S2_CHIPD/217-247---------------------------------------KVRFW.GM..........ADN..............V-----
B7QFM3_IXOSC/67-96---------------------------------------KVYFW.TT...........DS..............K-----
A412_LOXHI/219-248---------------------------------------KVYHW.TV...........DK..............Y-----
B9XKB9_9BACT/233-263---------------------------------------RIRFWDAP...........DR..............P-----
E8W4Q9_STRFA/244-279---------------------------------------RVRFW.ATPDI.....AGPER..............D-----
SMD_IXOSC/243-272---------------------------------------KVYYW.TV...........DK..............V-----
A312_LOXS4/219-248---------------------------------------KIYYW.SV...........DK..............V-----
B1S_LOXAS/217-246---------------------------------------KVYAW.TY...........DK..............E-----
A6EG56_9SPHI/219-249---------------------------------------PFRFWATK...........DN..............P-----
A21_LOXSP/213-242---------------------------------------KVYYW.TA...........DK..............Y-----
A1OB2_LOXVA/213-242---------------------------------------KVYYW.TV...........DK..............R-----
A5FEV6_FLAJ1/213-243---------------------------------------KIRFWATQ...........DN..............V-----
D7VYF5_9FLAO/219-249---------------------------------------PVRFY.GA..........PDF..............P-----
Q4Z7T4_PLABA/27-60---------------------------------------KVMIYWGT...........ED..............Q-----
A424_LOXLA/217-246---------------------------------------KVYFW.TI...........QA..............Y-----
B9GJW3_POPTR/78-121---------------------------------------SVYVE.TF...........NNEFV.......SQAWD-----
B7PW58_IXOSC/226-255---------------------------------------KAYFW.TT...........DL..............K-----
B1LB_SICPE/216-245---------------------------------------KVYTW.SI...........DE..............E-----
C6W721_DYAFD/221-251---------------------------------------PFRFWASP...........DN..............I-----

PF00388

Q60450_CRIGR/286-429-----------Q..QVMARH--------------LKAILGPMLLDQP-----------LD--------------G.....
A4I5X4_LEIIN/300-441-----------S..MVMADH--------------LRTILGDMLMTAK-----------DI--------------......
Q8IJR0_PLAF7/626-770-----------K..NLIAKI--------------LISILGNQLYIPK-----------TT--------------......
PLC_STAAE/34-177-----------D..SKVTKT--------------FEEIFREYYYNNP-----------QY--------------QNL...
Q6BZ51_DEBHA/455-607-----------Q..LKVVRT--------------LKEVLGDTLITQP-----------ID--------------......
PLCG2_MOUSE/314-457-----------Q..RHMAKV--------------FKEVLGDMLLTKP-----------TE--------------A.....
PLCL1_HUMAN/400-543-----------Q..KVMAQQ--------------MKKVFGNKLYTEA-----------PL--------------P.....
PLCD9_ARATH/109-254-----------Q..SKVTQM--------------IDQTFGDMVYHED-----------PQ--------------Q.....
PLCD1_ARATH/107-250-----------Q..KKVAKM--------------VSKTFGGSLFQCT-----------.D--------------E.....
PLCD6_ARATH/139-282-----------Q..AKVAEM--------------ATQIFGQMLYYPE-----------SD--------------......
A5DAA1_PICGU/440-595-----------Q..LKIKKL--------------LKDILGESLVTDM-----------LD--------------......
Q636S2_BACCZ/57-195-----------EDMKGAEGS--------------FSNTFEKNYFVDP-----------IF--------------......
A7MD68_DANRE/316-460-----------Q..KIVAMH--------------LTTILGSALLTQP-----------LG--------------Q.....
PLCD4_RAT/292-436-----------Q..KTMAHH--------------LIAILGEQLLSTT-----------LE--------------E.....
Q0PGC0_LISMN/61-200-----------DSFAYRIQP--------------LINIYKDYFYTTS-----------RT--------------......
PLCZ1_BOVIN/157-300-----------Q..EVMADS--------------LLATFGDALLSYT-----------LD--------------N.....
Q55WA1_CRYNB/160-302-----------Q..NRLAII--------------LKEVFGDMLVSAP-----------LV--------------E.....
Q2YGU1_LILDA/57-200-----------Q..AKVAKM--------------VTETFGDMLYFPD-----------.S--------------D.....
PLCD3_ARATH/108-251-----------Q..AQVAKM--------------LTKTYRGMLFRRV-----------.S--------------E.....
Q5JYS9_HUMAN/151-300-----------Q..YKMSKY--------------CEDLFGDLLLKQA-----------LE--------------SHP...
O97034_9METZ/308-451-----------Q..RIMARQ--------------FKEVFGDALLTEL-----------VD--------------L.....
A5E691_LODEL/21-192-----------Q..RSVVTI--------------IKETLGKSLVTET-----------IN--------------......
Q16W08_AEDAE/315-464-----------Q..YKLAKY--------------CDEILGDLLLKEP-----------LP--------------DYP...
PLCD5_ARATH/114-257-----------Q..AKAAEM--------------MKEIFMDMVYFPE-----------.A--------------G.....
Q5QIB9_STRPU/301-444-----------Q..KVMAQI--------------CVSILKDKLYTNN-----------NL--------------H.....
Q6CSI9_KLULA/402-540-----------Q..LMITKI--------------MKEILGDLIFVIP-----------..--------------......
A0FLF3_TOBAC/111-253-----------Q..AKVAEM--------------ITQTFGDMLFSPD-----------.S--------------......
O97037_HYDVU/300-443-----------Q..IVMAQH--------------LKEKLGKMLFDGD-----------VD--------------L.....
PLCD3_HUMAN/339-483-----------Q..AAMARH--------------LCTILGDMLVTQA-----------LD--------------S.....
Q385H1_TRYB2/248-393-----------Q..DRMAEI--------------LCETLGDMLFCSP-----------WG--------------AG....
Q3TWI4_MOUSE/319-469-----------Q..AKMAEY--------------CRSIFGDALLIDP-----------LD--------------KYP...
P93620_VIGUN/106-249-----------Q..AKVAKM--------------ATQVFGELLHYPQ-----------.T--------------D.....
A2TF43_9LAMI/114-257-----------Q..AKVAEM--------------VTETFEDVLVCST-----------.T--------------E.....
Q16ZC0_AEDAE/42-189-----------Q..QRMAAI--------------FQAIFGEKLVTNF-----------LF--------------DQD...
Q4S9T4_TETNG/359-525-----------Q..RTMAQH--------------LKKVLGSRLYTPE-----------AL--------------PVS...
O49950_SOLTU/113-256-----------Q..AKAAEM--------------VTQVFGDILFTCG-----------.A--------------E.....
Q4S530_TETNG/241-384-----------Q..KLMAHH--------------LISILGDALLTAP-----------LG--------------K.....
PLCH1_HUMAN/301-445-----------Q..RKIAQY--------------LKGIFGDKLDLSS-----------VD--------------T.....
Q45UQ8_NEUCS/110-360-----------Q..ERMVDI--------------MRQIWGDLLLPEP-----------EE--------------......
Q4SKC0_TETNG/309-451-----------Q..RQMARI--------------FRDVFGDKLLSEP-----------VE--------------Q.....
A2QEJ2_ASPNC/86-262-----------Q..QTMVEI--------------MEEAWKGMLVEVT-----------PE--------------LE....
Q4N7P5_THEPA/468-615-----------K..FQSFEL--------------VTQILGDELLTLD-----------ND--------------DP....
A7S279_NEMVE/319-466-----------Q..YKMACY--------------CMDILGDMLVTKP-----------LE--------------SCP...
PLC_DICDI/324-466-----------Q..IMMANH--------------MKEIFGEMLPTPL-----------PE--------------......
Q5BFL6_EMENI/534-676-----------Q..IAMVKI--------------MKETFGEKLILEP-----------LS--------------......
Q2HB23_CHAGB/553-696-----------Q..INMAKI--------------MIDIFGDKLVRAP-----------LD--------------P.....
A6RBI2_AJECN/84-320-----------Q..KVMVDI--------------ITQAWEGMLIELP-----------AD--------------IEAK..
Q1LWH7_DANRE/284-423-----------Q..KIMAQH--------------LTQILGDKLLKST-----------LD--------------G.....
A0CKY8_PARTE/271-413-----------Q..EVLGQI--------------MRAQFKDELYIYE-----------Q.--------------......
Q3UZ68_MOUSE/210-353-----------Q..RNMAQH--------------FRKVLGDTLLTKP-----------VD--------------I.....
Q5CLA7_CRYHO/367-509-----------R..EKVAEI--------------ILNVLGDSLYIPP-----------ND--------------......
E9AEI1_LEIMA/296-447-----------T..NRMAEI--------------IRSVFKERLFLSR-----------LD--------------A.....
Q91423_9TELE/46-190-----------Q..KLMAHH--------------MTSILGSALLTRP-----------LG--------------K.....
Q9XWB7_CAEEL/306-468-----------Q..EKMVQI--------------FRQVFGELLLTGP-----------LP--------------DYPLY.
Q8IA75_CAEEL/367-517-----------Q..KVAAML--------------IVTHLGTRLYLPK-----------ND--------------PTN...
PLC1_YEAST/382-521-----------Q..KLASLI--------------MREVLAEQLYFVG-----------T.--------------......
Q4SCY8_TETNG/29-191-----------Q..AKMAEY--------------CRSIFGDALLTEP-----------LE--------------KYLDAD
PLCE1_HUMAN/1394-1541-----------Q..RKMAEI--------------FKTVFGEKLVTKF-----------LF--------------ETD...
Q6QAF2_LYTPI/318-467-----------Q..LKLARY--------------CEEVLGEFLLTEK-----------LD--------------DHP...
A7RXP6_NEMVE/244-393-----------Q..LKMASY--------------CVNIFGDMLLSKP-----------LD--------------DYP...
Q2QNK1_ORYSJ/114-257-----------Q..AKVAEM--------------LVKTFGNLLYIPS-----------.S--------------D.....
Q7QHE3_ANOGA/319-462-----------Q..RRMAQA--------------MLEVFGEMLLTQP-----------ID--------------K.....
A0BLC4_PARTE/285-429-----------Q..DVMTDI--------------LKTYLNVNLLLLP-----------DD--------------Y.....
Q6FY00_CANGA/381-519-----------Q..RIAASI--------------FKDTFGDLLYTCE-----------..--------------......
A0BLM0_PARTE/262-404-----------Q..KRIADL--------------LQSILGEMLFVVK-----------DF--------------......
Q59LC4_CANAL/566-727-----------Q..IKVVNI--------------LKDILGENMIIAP-----------ID--------------I.....
Q4T850_TETNG/115-259-----------Q..KKIAQY--------------LREIFGDKLDVGD-----------VL--------------S.....
Q9FSW1_9POAL/148-291-----------Q..AKVAQM--------------VLEVFGDMLYYPE-----------.S--------------K.....
Q2UPV6_ASPOR/98-321-----------Q..QAMVEI--------------MEEAWKGMLVEVT-----------PE--------------K.....
O97035_HYDVU/328-477-----------Q..MKMANY--------------CLQIFGDLLLNKE-----------LD--------------EYP...
Q4PDE8_USTMA/122-279-----------Q..KRLVEI--------------MHEVWGDLLISGP-----------VD--------------KN....
Q9XEK4_BRANA/105-249-----------Q..SKVAEM--------------VTEIFGEILFTPP-----------VG--------------E.....
A7T501_NEMVE/158-302-----------Q..KFMANF--------------MRDTFKDILCILF-----------FM--------------L.....
Q4RWH6_TETNG/299-443-----------Q..AVMAKT--------------LRSILGSKLLTKP-----------LP--------------S.....
A5A2F9_TOBAC/110-253-----------Q..AKVAQM--------------LTETFGEMLFVPE-----------.S--------------D.....
A7ASE0_BABBO/522-670-----------K..MKTAET--------------CRKILGDALYIPD-----------PA--------------NP....
Q7ZU40_DANRE/294-438-----------Q..KIMAQH--------------LTSILGSALVTKP-----------LG--------------D.....
Q45QJ6_RAT/314-464-----------Q..AKMAEY--------------CRTMFGETLLTEP-----------LE--------------NFP...
Q0B816_BURCM/28-162-----------.PAHACTRG--------------FEATFDAHCARHP-----------RL--------------.R....
Q4PA81_USTMA/724-872-----------Q..EVMARI--------------LIDTLGEMLLSQP-----------ID--------------SQT...
A7TR21_VANPO/381-520-----------Q..LKAVSI--------------FKDIFGDSLCTNI-----------L.--------------......
Q75C92_ASHGO/397-535-----------Q..IIVKQL--------------FDDILGPLIYVAD-----------..--------------......
A7RPQ0_NEMVE/307-450-----------Q..QIMAKY--------------LKEILKDKLYTEA-----------PG--------------E.....
Q5MG88_TOXGO/407-550-----------R..IRIAEI--------------LEEILQDQIYRCH-----------..--------------......
A7SXK4_NEMVE/94-237-----------Q..IKMAEH--------------LKGILGSLLYTTP-----------VD--------------F.....
PHLC_TRYBB/54-199-----------S..HTMKRF--------------VEELQALEEFYIP-----------TT--------------V.....
Q4S9B8_TETNG/321-464-----------Q..RVMFQH--------------LRKILGDKIQLDP-----------PR--------------A.....
O07690_LISSE/61-200-----------NSFDYRIQP--------------LIHKLKSFFYTES-----------AK--------------......
A4S165_OSTLU/1-153-----------R..AVMAKI--------------MRHTFGDKLWTPP-----------SK--------------GEGEG.
Q7PW25_ANOGA/289-436-----------Q..AKIANY--------------CREIFGDMLLDRP-----------LD--------------SHP...
Q4SDX6_TETNG/287-431-----------Q..TVMARH--------------LRSILGEKLLARP-----------LG--------------D.....
A7RKT2_NEMVE/272-413-----------Q..AQMAEI--------------FLKDFGDMLVTQD-----------FC--------------......
Q4RKI8_TETNG/349-492-----------Q..QVMCQH--------------LTRIFGDKLYTDP-----------PN--------------Q.....
Q766D4_9BRYO/108-251-----------Q..ALAAET--------------LTNILGEDLYYPP-----------SS--------------D.....
Q2PEW5_TRIPR/126-269-----------Q..AKVAQM--------------VTQTFGDILFCPS-----------.T--------------E.....
A6RM87_BOTFB/546-665-----------Q..AAMAQI--------------IKEACGDLLVTEP-----------LD--------------P.....
Q4RX70_TETNG/314-458-----------Q..KKMAEY--------------LKEVLQDKLDLSV-----------VI--------------S.....
A3LSB2_PICST/461-615-----------Q..RKIVDI--------------LKNTLGDTLIATP-----------IL--------------......
A4EAJ4_9ACTN/13-159-----------D..ESVTTA--------------FANVMGN......-----------..--------------.NSD..
A3LNB7_PICST/20-167-----------D..NPNDEF--------------PNLIWEKYVEPNK-----------DK--------------.W....
Q6R6E0_LISIV/61-201-----------DRFDYRIQP--------------LINQYKAFFYTTP-----------KS--------------......
Q24284_DROME/320-463-----------Q..RNMAQA--------------LIEVFGDMLLTQP-----------CD--------------R.....
PLCH2_HUMAN/328-472-----------Q..KKMAQY--------------LTDILGDKLDLSS-----------VS--------------S.....
Q0UVV5_PHANO/116-337-----------Q..EIMVEL--------------MNEYWKGLLVDLP-----------ID--------------PSQ...
Q4QBH9_LEIMA/195-340-----------Q..DKMAEI--------------LEEGLGSLLFWPP-----------WG--------------SN....
PLCD4_HUMAN/292-436-----------Q..QTMARH--------------LTEILGEQLLSTT-----------LD--------------G.....
Q0UE70_PHANO/101-258-----------Q..ARLAQI--------------MREVFGDRLLSRG-----------VR--------------EKGT..
A5AGR6_VITVI/112-255-----------Q..AKVAEM--------------ATQIFGDLLFSPE-----------.S--------------E.....
B9DGG5_ARATH/8-150-----------Q..FKVAKM--------------ITQTFGDMLYYHD-----------.S--------------Q.....
Q4RLM8_TETNG/312-491-----------Q..EKMANY--------------CKTIFGEALLTEP-----------LD--------------KYP...
PLCL2_MOUSE/429-572-----------Q..KVMVQH--------------MKKILGDKLYTTS-----------PN--------------M.....
PLCZ1_CHICK/159-303-----------Q..ERIAQY--------------LLNILGDKLLTSP-----------IG--------------D.....
A2IB48_CHAVR/321-464-----------Q..RNMASA--------------FREVFGDMLLIEP-----------ID--------------V.....
PLCD4_XENLA/292-436-----------Q..DAMAQH--------------LKSILGNKLVMST-----------LD--------------G.....
Q3F156_BACTI/43-187-----------R.....SLS--------------FEQIFKNYKDRNA-----------SY--------------.FWNP.
Q2GUM5_CHAGB/104-264-----------Q..LRLVEI--------------MKEVWGDRLLSAP-----------IR--------------QKGH..
Q7SE08_NEUCR/136-356-----------Q..EMMVEI--------------MKEEWAGLLLEEP-----------FE--------------NC....
Q21754_CAEEL/318-461-----------Q..AVMADL--------------FKEILGDSLYIPP-----------KD--------------S.....
Q9GV33_WATSC/324-471-----------Q..KLLAKY--------------CHEAFGEMLLSEP-----------ID--------------GHP...
A7SDH9_NEMVE/209-352-----------Q..RKIAEH--------------LENILGDKLFKDP-----------VD--------------T.....
Q6EZG7_CAEEL/342-492-----------Q..LKMAKY--------------CMDIFGDMLLSKP-----------FE--------------DAP...
Q6RY08_ASTMI/305-448-----------Q..RNMASS--------------FQEVFGDSLLTQP-----------VD--------------R.....
A4HCK9_LEIBR/248-393-----------Q..DRMAEI--------------LEKELGSLLFQPS-----------WG--------------AG....
Q236T7_TETTS/368-513-----------Q..NLIAQF--------------LVNVFQDMLYRLP-----------ED--------------F.....
Q9P866_CANAX/68-213-----------D..NSQDEF--------------GKLIWDRYVNPNK-----------DR--------------.W....
O97036_HYDVU/314-460-----------Q..KILAEM--------------CIKIFGPLLLDKP-----------LE--------------SNP...
O97033_9METZ/324-472-----------LLIQKIAST--------------FALVFGDKLQKSP-----------LD--------------DYP...
PLC1_SCHPO/443-585-----------Q..RQMVSY--------------MKQAFGDTLVMKP-----------VT--------------A.....
A6AS90_VIBHA/22-157-----------D........--------------IQTNFNQYLKQEK-----------YK--------------.QL...
Q013R6_OSTTA/119-269-----------R..AEMSRI--------------LRSTLGDKLWAPK-----------SA--------------VA....
Q75IL8_ORYSJ/119-262-----------Q..SKVAKM--------------IKETFGDMLYVSE-----------.T--------------E.....
O96101_TRYCR/248-393-----------A..DRMAEI--------------MCDTFGDMLFQSP-----------WA--------------PA....
A6EGD5_9SPHI/56-190-----------N.....TRT--------------FEQTFDSYVAQNS-----------SK--------------.W....
PLCD8_ARATH/107-248-----------Q..SKATQM--------------IQQTFNHMVYHHD-----------PH--------------......
Q4S959_TETNG/321-464-----------Q..RVMAQH--------------MKKIFGDKLYVDP-----------PN--------------K.....
Q762E2_9BRYO/150-294-----------Q..KEAARV--------------LNKILGNIMFVPP-----------PN--------------E.....
Q4RSB2_TETNG/98-242-----------Q..EIMAHY--------------LVSILGEKLLRAP-----------ID--------------H.....
Q6CD33_YARLI/505-648-----------Q..LKVVDI--------------LKGTFGENLVTQP-----------LV--------------P.....
A7UXE0_NEUCR/117-274-----------Q..EALVRI--------------MKEVWGRHLLDKP-----------VE--------------TES...
A1D7Q8_NEOFI/96-331-----------Q..ATMVEI--------------MEEAFKGMLIEVT-----------PE--------------L.....

PF00387

PLCD1_MOUSE/491-609-----------EMWNGGCQI..............VALNFQTPGP.EM-----------DV--------------------
Q29N33_DROPS/566-683-----------LFWNAGCQL..............VALNFQTLDL.AM-----------QL--------------------
PLCG2_HUMAN/929-1044-----------RLWLCGSQM..............VALNFQTADK.YM-----------QM--------------------
PIPA_DROME/549-666-----------VFWNAGCQM..............VSLNFQSSDL.PM-----------QL--------------------
Q6BZ51_DEBHA/661-779-----------KYWSHGVQM..............VATNWQTYDL.GQ-----------QI--------------------
PLCH1_HUMAN/600-714-----------PYWNAGCQL..............VALNYQSEGR.MM-----------QL--------------------
A5DAA1_PICGU/647-765-----------TQWNYGVQM..............VASNWQTYDV.GQ-----------QI--------------------
A7RXP6_NEMVE/449-566-----------IFWNAGCQL..............VALNFQTLDL.AM-----------ML--------------------
A7RPQ0_NEMVE/491-608-----------DMWNCGCQL..............VALNYQTPGI.MM-----------HV--------------------
Q7ZU40_DANRE/483-600-----------PMWNAGCQI..............VALNFQTPCL.EM-----------DL--------------------
PLCB2_MOUSE/546-663-----------MFWNAGCQM..............VALNFQTMDL.PM-----------QQ--------------------
PLCL1_RAT/585-702-----------DFWNCGCQI..............VAMNFQTPGP.MM-----------DL--------------------
Q4T850_TETNG/440-554-----------FYWNVGCQL..............VALNYQTEGR.MM-----------QL--------------------
Q55WA1_CRYNB/353-467-----------DSWSAGCQI..............VALNWQTLDE.SI-----------LL--------------------
O96101_TRYCR/462-581-----------LFWNCGCQI..............VALNWQSTHTYAW-----------RL--------------------
P78585_BOTFU/650-769-----------KYWRRSVQM..............VALNWQTHDL.GM-----------QM--------------------
Q75C92_ASHGO/591-714-----------KCWRLGVQM..............VATNWQTYDL.GQ-----------QL--------------------
PLCZ1_MACFA/381-498-----------EFWNIGCQM..............VALNFQTPGL.PM-----------DL--------------------
Q4RX70_TETNG/609-725-----------PYWNTGCHM..............VALNYQTEGR.ML-----------EL--------------------
Q08JX0_ORYLA/549-666-----------PFWNVGCQM..............VALNYQTMDF.PM-----------QL--------------------
O97033_9METZ/764-881-----------IFWNVGCQL..............VALNFQSTDL.PI-----------QL--------------------
Q25285_LOLFO/513-630-----------IYWNAGCQL..............VALNFQCFDV.AM-----------CV--------------------
A3LSB2_PICST/669-787-----------KYWEHGVQM..............VATNWQTYDL.GQ-----------QI--------------------
A1D7Q8_NEOFI/374-488-----------FFWRCGAQI..............VALNWQNLDK.GM-----------ML--------------------
Q17CT3_AEDAE/941-1054-----------PLWNTGSQM..............IALNYQTPDK.NM-----------QL--------------------
Q4SKC0_TETNG/940-1053-----------PLWAVGCQM..............VALNFQTADK.YT-----------QL--------------------
Q8CI86_MOUSE/590-707-----------LFWNVGCQL..............VALNFQTLDL.PM-----------QL--------------------
Q0UE70_PHANO/300-418-----------PFWGIGAQI..............CALNWQTFGA.AS-----------QL--------------------
PLC1_YEAST/586-710-----------PFWKAGVQM..............VATNWQTNDI.GQ-----------QL--------------------
Q6NTX2_XENLA/945-1063-----------TMWICGSQL..............VALNFQTPDK.PM-----------QM--------------------
Q2UCJ8_ASPOR/565-684-----------KFWRRGVQM..............AALNWQTYDI.GM-----------QM--------------------
Q4QBH9_LEIMA/390-509-----------LYWVSGCQM..............VAINWQSSDTFGW-----------RL--------------------
PLC_DICDI/538-653-----------PGWSIGCQL..............AALNQQTSSE.PM-----------WI--------------------
Q0UVV5_PHANO/395-509-----------VFWRAGVQI..............VALNWQRWDG.GM-----------MQ--------------------
Q4PA81_USTMA/992-1114-----------DMWAAGCQL..............VALNWQTTDL.GF-----------EL--------------------
Q4SDX6_TETNG/473-589-----------DMWNGGCQI..............VALNFQTPGE.QM-----------DL--------------------
A4S165_OSTLU/200-316-----------DAWSIGASL..............VALNFQAQDR.YM-----------WV--------------------
Q86RA6_DROVI/974-1087-----------PFWNIGSQM..............IALNYQTGDK.AM-----------QL--------------------
Q4RSB2_TETNG/292-409-----------EFWNVGCQL..............VALNFQSLAA.PM-----------DL--------------------
Q6RY08_ASTMI/926-1041-----------PIWNIGTQM..............VSLNYQTPDR.YM-----------QI--------------------
Q45UR4_NEUCS/413-527-----------VFWRKGIQI..............VALNWQNWDE.GM-----------ML--------------------
A7SMY6_NEMVE/399-515-----------MMWNCGVQL..............CAMNFQTPDR.SM-----------QL--------------------
Q2HB23_CHAGB/789-908-----------IYWKRGVQM..............AALNWQTFDT.GM-----------QL--------------------
PLCL2_HUMAN/617-734-----------DFWKCGCQI..............VAMNFQTPGL.MM-----------DL--------------------
Q59LC4_CANAL/795-913-----------PYWSHGVQM..............VATNWQTYDL.GQ-----------QL--------------------
Q0UC00_PHANO/609-729-----------KCWRRGVQM..............VALNWQTYDL.GQ-----------QL--------------------
Q4S959_TETNG/510-627-----------DFWKCGCQI..............VAMNYQTPGL.MM-----------DL--------------------
Q1LWH7_DANRE/476-593-----------DLWNAGCQI..............VALNFQTAGV.EM-----------DL--------------------
PLCD4_RAT/502-619-----------EHWNVGCQM..............VAMNMQTAGS.AM-----------DI--------------------
Q4RKI8_TETNG/560-677-----------DLWKCGCQI..............VSMNFQTAGL.MM-----------DL--------------------
PLCD4_HUMAN/492-609-----------ELWNAGCQM..............VAMNMQTAGL.EM-----------DI--------------------
O97037_HYDVU/475-592-----------KGWVYGCQI..............VALNFQTPGE.MM-----------DI--------------------
O97035_HYDVU/534-651-----------LFWNAGCQM..............VALNFQTLDV.PM-----------QL--------------------
Q5QIB9_STRPU/494-610-----------PMWDVGAQI..............VALNFQTPCE.EM-----------DL--------------------
A2QEJ2_ASPNC/322-436-----------FFWRRGAQM..............VALNWQNFDK.AM-----------ML--------------------
Q5IRA3_CRYPA/437-551-----------PFWRKGIQI..............AALNWQHWDE.GM-----------ML--------------------
PLCD3_HUMAN/527-644-----------EMWNSGCQL..............VALNFQTPGY.EM-----------DL--------------------
Q2VYF9_9TRYP/452-571-----------TFWNCGCQL..............VALNWQNYKSYQL-----------RL--------------------
A7TR21_VANPO/594-717-----------KCWEIGTQM..............VATNWQTNDL.GH-----------QL--------------------
Q6CSI9_KLULA/616-739-----------RFWKEGVQM..............VATNWQTYDL.GQ-----------QL--------------------
Q91423_9TELE/236-353-----------TMWNAGCQI..............VALNFQTYGK.EM-----------DV--------------------
Q013R6_OSTTA/351-466-----------EAWDVGASF..............VALNFQALDR.YV-----------WA--------------------
Q4SCY8_TETNG/264-356-----------LFWNAGCQL..............VALNFQTIDL.SM-----------QL--------------------
A7RPT6_NEMVE/606-723-----------TFWNCGCQL..............VALNYQTEGR.ML-----------QI--------------------
Q5B933_EMENI/339-453-----------FFWRRGAQI..............VALNWQNSDK.GM-----------ML--------------------
PLCD4_XENLA/485-602-----------DMWNVGCQM..............TALNFQTAGV.EM-----------DL--------------------
Q5JYS9_HUMAN/412-529-----------IFWNAGCQM..............VSLNYQTPDL.AM-----------QL--------------------
Q9XWB7_CAEEL/527-651-----------IHWLTGSQM..............VSLNIQTNCS.NM-----------QL--------------------
A7SDH9_NEMVE/402-519-----------VAWNVGCQI..............VALNYQTDGE.YM-----------HL--------------------
PLCZ1_CHICK/376-493-----------EFWNVGCQM..............VALNFQTSGT.PM-----------EL--------------------
PLCH2_HUMAN/625-740-----------PFWNAGCQM..............VALNYQSEGR.ML-----------QL--------------------
Q7QHE3_ANOGA/969-1085-----------ALWNCGSQM..............IALNFQTPDK.PM-----------QL--------------------
A7MD68_DANRE/509-626-----------PLWNAGCQI..............VALNFLTPCK.EM-----------DL--------------------
A7EE08_SCLS1/440-554-----------VCWRKGIQM..............VALNWQTLDE.GM-----------ML--------------------
A5E691_LODEL/252-371-----------NYWKIGVQM..............VATNWQTYDL.GQ-----------QL--------------------
Q6CD33_YARLI/706-822-----------YFWQNGAQM..............VALNWQTYDL.PA-----------QL--------------------
Q2H4G2_CHAGB/404-521-----------FHWRRGVQM..............VAMNWQKSDE.GM-----------LI--------------------
PLC1_SCHPO/637-753-----------VYWRLGVQM..............VALNWQTYDT.GL-----------QI--------------------
PLD3A_DANRE/505-621-----------DMWNAGCQM..............VALNFQTPGE.QM-----------DL--------------------
O97034_9METZ/947-1065-----------PMWNGGCQM..............VSLNYQTGDK.SM-----------QL--------------------
A7SXK4_NEMVE/279-396-----------KPWTVGCQI..............VALNHQTNSE.EM-----------QL--------------------
A6RBI2_AJECN/377-491-----------FYWRRGIQI..............VALNWQNCDK.GM-----------MM--------------------
Q1LWW2_DANRE/14-131-----------PAWKLGCQM..............VALNFQTDDN.FM-----------QL--------------------
A2IB48_CHAVR/945-1060-----------PFWNCGCHM..............LALNYQTPDR.SM-----------QL--------------------
Q6FY00_CANGA/575-699-----------RFWRLGVQM..............VATNWQTNDV.GH-----------QL--------------------
Q4SNU6_TETNG/496-627-----------PLWNAGCQMGTGCSPKPQGLRSKVALNFQTACS.DM-----------DV--------------------

PF03009

PGC1_SCHPO/37-267.............S---------SI---------YLAL-I-------RGCDGLLSDDPVM
GPC1B_CAEEL/349-649...........KEV---------QK---------HFRD-E-------MNVDGLIFDRIGE
YQIK_BACSU/7-235.............E---------DM---------KRLI-E-------AGADGMFTDFPEK
Q9RZL4_DEIRA/249-566P.....TYKNDPEA---------EM---------RQAL-R-------AGVDGLFTDFPAT
Q9X1V6_THEMA/6-217..............---------EI---------YRKI-R-------REIDGVITDEVEL
Y2277_MYCTU/36-295.............D---------DY---------RLAH-K-------IGLDAVLVDSPLA
Q9RWX3_DEIRA/7-220.............A---------DV---------QRLA-A-------LGVDGLIGDVPAH
O07244_MYCTU/14-242.............D---------VM---------HTLL-D-------MDVDGIITDRADL
Q9SD81_ARATH/49-357LE....FNQDPYLE---------YD---------YWLN-K-------IGVDGLFTDFTGS
GPC1A_CAEEL/406-706...........KEN---------IN---------YFKK-E-------LGVDGVIYDRIGE
O02322_CAEEL/73-322.............Y---------EQ---------VWLR-D-------YLKVPFLTDNVGT
YHDW_BACSU/6-233.............K---------TA---------AKLQ-A-------MGVDGIVTDYPDF
GDE1_SCHPO/752-1061............VD---------NV---------RRQV-R-------FGVDAVIVDNVLA
Q45201_BORHE/38-330.......VKDADEL---------LD---------LLFN-K-------AKVDGIFTDFTDT
Q9W2L6_DROME/349-632............RE---------SI---------DWFL-Q-------QGPTGVIYDRLDL
O86738_STRCO/16-227.............R---------TM---------RRLR-A-------AGVDSITTNRIDV
GDE1_YEAST/877-1212...........PEN---------AS---------.IQI-E-------AGVDAVIVDSVLA
Q9VQU3_DROME/375-661............KD---------TI---------KLLK-E-------LGLHAIIYDKMDV
Q9V208_PYRAB/12-236...........YVN---------RN---------LERL-K-------GLFEVVIANDVEK
Q9Z3F4_XANEU/274-516............LD---------SW---------TKMR-P-------VIVEAVATDDSDA
GLPQ1_MYCTU/17-259.............E---------DI---------DFCR-E-------VGVAWIGTHHPGR
PGC1_YEAST/7-246.............I---------DF---------KYLC-E-------LPIHGAITDDPIK
Q9RKX8_STRCO/20-243.............D---------RM---------HRLL-D-------LGVDGIMTDHIDT
Q9ZTU6_WHEAT/118-414YDFFSDATSQINAL---------VH---------KGGE-G-------GGVDGLITDFPGT
GLPQ_BACSU/43-285.............A---------DM---------HRLL-D-------WGVTGVFTNYPDL
GLPQ_ECOLI/36-350.......TPDVNQL---------YD---------ALYN-K-------AGVNGLFTDFPDK
GLPQ_HAEIN/40-355.......FTDVNQM---------YD---------ALLN-K-------SGATGVFTDFPDT
Q89384_PBCV1/5-217.............S---------EI---------VKLF-S-------YGVKCVITDNPNI
UGPQ_ECOLI/12-239.............Q---------RA---------AELL-R-------WGVDCICTDAIDV
Q9SGA2_ARATH/39-318............AE---------AV---------YMQH-L-------MGIEGVIVDHVEE
Q9YFI4_AERPE/15-220.............D---------QA---------KTVE-K-------LGVDAIVSDRPDK
Q44028_CUPNE/17-245.............A---------RA---------AQLL-A-------WGLDGLITDAVDQ
Q9RSP0_DEIRA/37-277.............A---------EM---------RRLV-Q-------MGVDGVITNRPDL
Q9UAW8_CAEEL/68-331.............A---------EM---------HWML-K-------TLNIPILTDYPEL

PF13653

A8I2Q7_CHLRE/208-237-------------E.........VL.........RAVL.D-------VGVDALVTNYPL-
C6JG09_9FIRM/261-290-------------K.........EA.........QYYM.Q-------EGAAGVCSDYLQ-
Q97AF5_THEVO/125-154-------------E.........LA.........NKLK.K-------LGCKGIITNVGD-
C1EA09_MICSR/311-340-------------A.........TL.........GAQL.A-------LGVSGVITNEPG-
D3R0L3_CLOB3/197-226-------------Q.........AI.........SEFW.Q-------MGVFNLTTNKVT-
Q53JJ0_ORYSJ/166-195-------------D.........SM.........KRML.Y-------EHVDAIVTSNPS-
C2HMV5_LACAI/99-128-------------K.........LA.........RRYF.K-------LGVAGIFTNNFE-
B5DF39_RAT/181-210-------------W.........LF.........SLLW.C-------AGVPSVTSDNSH-
B3RWH1_TRIAD/177-217-------------T.........LI.........NQMI.G-------WGLQRLITDDTD-
B6A4H5_RHILW/237-277-------------R.........SF.........QALM.A-------LKPDQVTTDEAP-
C5XX04_SORBI/147-190-------------E.........VA.........TYAY.S-------VVADGIVTDYPA-
C3KNM3_RHISN/284-318-------------R.........DIDD....SILRTLV.G-------ARVRQITTDVPS-
A1SJR5_NOCSJ/183-212-------------E.........WL.........DRVV.G-------LGANGVITNEPE-
C5Y879_SORBI/258-287-------------S.........SM.........KKML.F-------EHVDAIVTSNPS-
C4H5M9_YERPE/194-223-------------E.........DY.........QLAK.D-------LGADYVMTDSPA-
D2QM66_SPILD/215-245-------------N.........GW.........KQLK.K-------LGVDIINTDNVA-
Q1M8H9_RHIL3/237-277-------------EAGFSEAEWRNF.........SALM.A-------LKPDQITTDEAP-
D3PWH3_STANL/239-274-------------A.........VW.........RELV.E-------AEVDYLNTDDLA-
A4F9Z1_SACEN/227-262-------------A.........VW.........RELV.D-------AGVDHINTDDLD-
A3XKX4_LEEBM/206-236-------------I.........AW.........TRFA.N-------LGVDFINSDKPA-
A8M0I4_SALAI/230-265-------------A.........VW.........RELR.A-------AGVDHINTDDLA-
A21_LOXAR/214-243-------------Q.........SM.........RDAL.D-------AGVDGIMTNYPD-
C2FUE7_9SPHI/240-270-------------N.........TW.........QELH.K-------LGVYWINTDQPE-
A4AS02_MARSH/212-242-------------L.........AW.........KTFM.A-------LGMDYLHTDDPY-
B2KBC_SICCD/215-244-------------S.........IM.........RRSL.R-------LGVDGVMSNNPD-
A6CED4_9PLAN/229-259-------------E.........LW.........KELV.D-------ARVDHINTDQLE-
C7PNH8_CHIPD/228-258-------------V.........VW.........NALL.D-------CGVDLINTDRLT-
A1H1_LOXRE/220-249-------------A.........TT.........REAL.D-------AGVDGVMTNYPD-
B1H1_LOXIN/248-277-------------S.........SI.........RNAL.R-------LGVDAVMTNYPA-
C5C387_BEUC1/626-661-------------A.........VW.........AELR.D-------AGVDHINTDDLA-
B2L2_SICCD/215-244-------------S.........TM.........RRLF.R-------LGVDGVMSNFPD-
A3HWH1_9BACT/215-245-------------S.........AW.........KAFF.E-------MGEDYINTDHPI-
Q6MRA8_BDEBA/253-282-------------A.........QL.........ADAT.R-------YKAEGLITTNLP-
A6WFY1_KINRD/264-299-------------A.........VW.........SELV.A-------AQVDQINTDDLD-
A51_LOXIN/249-278-------------A.........SV.........RDAI.N-------AGADGIMTNYPN-
A7T397_NEMVE/56-86-------------D.........EF.........TLAFEK-------LGAAGVMTDYPT-
C6W5T4_DYAFD/220-250-------------N.........SW.........KTMM.A-------LGVDYINTDKVQ-
A5ZJ68_9BACE/227-257-------------T.........AW.........NTFM.K-------LGLDYLNTDHPA-
B312_LOXSN/215-244-------------S.........SI.........RYYL.R-------LGVDGVMTNFPN-
A71_LOXAR/216-245-------------A.........TI.........RDTL.D-------AEVDGIMTNYPN-
C0Y618_BURPE/135-164-------------D.........DY.........ATAA.S-------LGAAAVLVDSPA-
A612_LOXHI/216-245-------------T.........SI.........TDAI.N-------AGADGIMTNHPD-
B7Q3W8_IXOSC/213-242-------------S.........AI.........RSSI.R-------MGVDGIITNYPE-
D2QQ87_SPILD/603-633-------------L.........VW.........AKLR.E-------AGVDFISTDQQV-
C7NM04_KYTSD/250-284-------------N.........VW.........AELL.A-------AGVDAINTDHLA-
Q010C1_OSTTA/112-141-------------E.........SA.........RKAL.S-------VGAKAVISNVPL-
Q7UF88_RHOBA/253-283-------------A.........AW.........KVLN.D-------AGVDLINTDDLE-
B1Q_LOXIN/246-275-------------T.........TM.........RKAL.R-------AGADGMITNFPK-
A3ZUF0_9PLAN/222-252-------------P.........MW.........RVLQ.D-------SGVDMINTDDLP-
A21_LOXVA/216-245-------------P.........SI.........KAAL.D-------AGVDGVMTNHPD-
A6EG44_9SPHI/221-251-------------T.........CW.........QAFI.K-------LGVDYLNTDSPA-
A41_LOXRU/216-245-------------V.........SV.........RDAL.N-------AEVDGIMTNYPN-
B1R_LOXAS/214-243-------------G.........SI.........ANAL.R-------LGVDGVMTNYPE-
A1LA_LOXAR/261-290-------------Q.........ST.........KNAL.D-------AGVDGIMPNYPD-
C7P9S2_CHIPD/217-247-------------N.........TW.........KTQM.N-------MGADFLGTDLVE-
B7QFM3_IXOSC/67-96-------------T.........TI.........RKVL.R-------LGVDGIITNHPE-
A412_LOXHI/219-248-------------G.........SV.........RDAL.D-------AGVDGVMTNDPD-
B9XKB9_9BACT/233-263-------------A.........FW.........KEML.A-------DGVDLINTDDLK-
E8W4Q9_STRFA/244-279-------------A.........VW.........NELL.A-------ADVDHLNTDDLG-
SMD_IXOSC/243-272-------------A.........TI.........RKTI.R-------RGVDAIITNRPK-
A312_LOXS4/219-248-------------S.........TV.........EKAL.K-------VGVDGIMTNHPD-
B1S_LOXAS/217-246-------------S.........SV.........TLAL.S-------LGVDGVMTNYAD-
A6EG56_9SPHI/219-249-------------N.........SW.........KELE.H-------MGADWIGTDHPQ-
A21_LOXSP/213-242-------------S.........TT.........RDAL.D-------AGVDGIMTNYPY-
A1OB2_LOXVA/213-242-------------Q.........AT.........RDTL.D-------ANVDGIMTNYPD-
A5FEV6_FLAJ1/213-243-------------N.........TW.........MTLM.N-------LKVDFIGTDNVA-
D7VYF5_9FLAO/219-249-------------N.........AW.........VNLM.D-------LGVDYINTDHIP-
Q4Z7T4_PLABA/27-60-------------DE......YSDM.........LYYI.N-------MKVDSICPNRID-
A424_LOXLA/217-246-------------S.........SV.........RDAL.N-------AEVDGIMTNEPD-
B9GJW3_POPTR/78-121-------------...........FFSDSTVEINSYVM.G-------ANISGVITEFPL-
B7PW58_IXOSC/226-255-------------S.........TM.........REVL.R-------LGVDGILTNKPE-
B1LB_SICPE/216-245-------------N.........SI.........KHAL.W-------LGVDGVMTNHPE-
C6W721_DYAFD/221-251-------------N.........AW.........KVLM.N-------LGADYINTDHVA-

PF00388

Q60450_CRIGR/286-429...........VTM---------SL---------PSPE-Q-------LKGKILLKGKK--
A4I5X4_LEIIN/300-441............PN---------MM---------YTPE-S-------LKGKVLVKWKL--
Q8IJR0_PLAF7/626-770...........DEI---------NN---------ITPN-N-------CKNKFLVKYKH--
PLC_STAAE/34-177........FYTGSN---------AN---------PTLK-E-------TKGKIVLFNRM--
Q6BZ51_DEBHA/455-607...........DKF---------TL---------PTPL-Q-------LKHKILLKVKK--
PLCG2_MOUSE/314-457...........SAD---------QL---------PSPS-Q-------LREKIIIKHKK--
PLCL1_HUMAN/400-543...........SES---------YL---------PSPE-K-------LKRMIIVKGKK--
PLCD9_ARATH/109-254...........SLE---------EF---------PSPA-E-------LQNKILISRRP--
PLCD1_ARATH/107-250...........TTE---------CF---------PSPE-S-------LKNKILISTKP--
PLCD6_ARATH/139-282...........SLL---------EF---------PSPA-S-------LLHRIIISTKP--
A5DAA1_PICGU/440-595...........NDC---------VL---------PSPR-K-------LRSKILLKVKR--
Q636S2_BACCZ/57-195..........LKTE---------GN---------IKLG-D-------ARGKIVLLKRY--
A7MD68_DANRE/316-460..........KMPT---------TF---------PGPE-D-------LKGRFLIKGKR--
PLCD4_RAT/292-436..........QLID---------IM---------PSPE-Q-------LRGKILVKGKK--
Q0PGC0_LISMN/61-200..........DTSN---------KI---------PTLK-D-------VRGKILLLSEN--
PLCZ1_BOVIN/157-300...........FSD---------RL---------PSPE-A-------LKFKILVRNKK--
Q55WA1_CRYNB/160-302...........EFS---------EL---------PSPE-D-------LKGKILFKAKP--
Q2YGU1_LILDA/57-200...........YLK---------EF---------PSPE-A-------LEKRIIISTRP--
PLCD3_ARATH/108-251...........SFK---------HF---------PSPE-E-------LKGKILISTKP--
Q5JYS9_HUMAN/151-300.........LEPGR---------AL---------PSPN-D-------LKRKILIKNKR--
O97034_9METZ/308-451...........NAT---------RL---------PSPN-A-------LKRKIIIKHKK--
A5E691_LODEL/21-192...........EYS---------IL---------PSPE-D-------LKYRFLVKVKK--
Q16W08_AEDAE/315-464.........LEPGA---------PL---------PPPS-A-------MKRKILIKNKR--
PLCD5_ARATH/114-257...........GLK---------EF---------PSPE-D-------LKYKIVISTKP--
Q5QIB9_STRPU/301-444...........NEA---------AF---------PSPE-E-------LKGKILIKGKS--
Q6CSI9_KLULA/402-540...........PNT---------SL---------LSPE-Q-------LKNRIILKSKK--
A0FLF3_TOBAC/111-253...........CLK---------NF---------PSPE-S-------LKRRVLISTKP--
O97037_HYDVU/300-443...........NQT---------KL---------PSPE-T-------LKGKIFIKAKK--
PLCD3_HUMAN/339-483..........PNPE---------EL---------PSPE-Q-------LKGRVLVKGKK--
Q385H1_TRYB2/248-393..........EQTS---------FT---------FSPE-A-------LKGKILLKSKR--
Q3TWI4_MOUSE/319-469.........LSAGI---------PL---------PSPQ-D-------LMGRILVKNKK--
P93620_VIGUN/106-249...........SLT---------EF---------PSPE-S-------LKGRILISTKP--
A2TF43_9LAMI/114-257...........DEL---------KF---------PSPE-S-------FKGKIIISTKH--
Q16ZC0_AEDAE/42-189.........YTDEP---------YL---------PSPL-S-------LKHKILIKNKK--
Q4S9T4_TETNG/359-525........LGGRAT---------TL---------PTPE-Q-------LRGRVLLVGKK--
O49950_SOLTU/113-256...........CLS---------EF---------PSPE-S-------LKGRIIISTKP--
Q4S530_TETNG/241-384..........SLPS---------EF---------PSPE-D-------LKGRFLIKGKR--
PLCH1_HUMAN/301-445..........GECK---------QL---------PSPQ-S-------LKGKILVKGKK--
Q45UQ8_NEUCS/110-360...........DAK---------YL---------PTPE-E-------LRGKILVKVKY--
Q4SKC0_TETNG/309-451...........VAE---------QL---------PSPT-Q-------LKGKIILKHKK--
A2QEJ2_ASPNC/86-262..........AGTV---------PP---------PPLA-D-------LKRKILIKVKH--
Q4N7P5_THEPA/468-615..........VDLV---------AR---------CELG-N-------LLNKFLIKAKY--
A7S279_NEMVE/319-466.........LEEGR---------PL---------PSPN-Q-------LRGKILIKNKK--
PLC_DICDI/324-466...........GTK---------EL---------PTLD-S-------LKYKILLKGHT--
Q5BFL6_EMENI/534-676...........NSF---------VL---------PSPE-E-------LKRRILIKVKT--
Q2HB23_CHAGB/553-696...........SSD---------RL---------PSPS-E-------LMDRILIKVKK--
A6RBI2_AJECN/84-320.......LERGEVE---------HL---------PGPG-E-------LRRKILIKVKW--
Q1LWH7_DANRE/284-423..........KIPL---------GL---------PSPE-.-------....ILLKGKK--
A0CKY8_PARTE/271-413...........NLS---------VL---------PSLD-K-------LKRKFLIKSSG--
Q3UZ68_MOUSE/210-353...........AAD---------GL---------PSPN-Q-------LRRKILIKHKK--
Q5CLA7_CRYHO/367-509...........GSD---------RL---------PTPN-E-------LKYKFLVKAKV--
E9AEI1_LEIMA/296-447..........S...---------.S---------YTPA-K-------LKGKILVKWKM--
Q91423_9TELE/46-190..........EIPS---------SL---------PSPE-E-------LKGRILIKGKR--
Q9XWB7_CAEEL/306-468......AKEGAGDV---------VY---------PPPE-L-------LKHKILIKAKK--
Q8IA75_CAEEL/367-517.........WDDEK---------NC---------PTPW-D-------FQNRILIVGKK--
PLC1_YEAST/382-521...........RTD---------KL---------PSPR-E-------LKHKILLKSKK--
Q4SCY8_TETNG/29-191FKLLGQRFNWSPEC---------LF---------LAPM-E-------LMGKILVKNKK--
PLCE1_HUMAN/1394-1541.........FSDDP---------ML---------PSPD-Q-------LRKKVLLKNKK--
Q6QAF2_LYTPI/318-467.........LDASV---------PL---------PSPN-K-------LKRKILIKNKR--
A7RXP6_NEMVE/244-393.........LEEGR---------PL---------PPLK-V-------LMRKIVIKNKK--
Q2QNK1_ORYSJ/114-257...........PIN---------EF---------PSPE-S-------LMKKIIISTKP--
Q7QHE3_ANOGA/319-462...........AEA---------QL---------PSPQ-Q-------LKRKIILKHKK--
A0BLC4_PARTE/285-429..........QSSE---------YY---------PKLN-K-------LYYKVIIKHRG--
Q6FY00_CANGA/381-519...........DRS---------EL---------PSPL-E-------LRHRILLKIKK--
A0BLM0_PARTE/262-404...........KQE---------KF---------STLQ-Q-------LQRRVLVKYKG--
Q59LC4_CANAL/566-727...........DSV---------IL---------PSPA-E-------LKHKFIIKVKK--
Q4T850_TETNG/115-259..........GDSK---------TL---------PSPN-K-------LKGKILIKGKR--
Q9FSW1_9POAL/148-291...........HLQ---------EF---------PSPE-A-------LKGRVMLSTKP--
Q2UPV6_ASPOR/98-321..........EATD---------PL---------PAPE-D-------LKRKILIKVKY--
O97035_HYDVU/328-477.........LLPGT---------LL---------PSPK-V-------LKRKILIKNKK--
Q4PDE8_USTMA/122-279..........EPAS---------EH---------TALD-H-------LGAKIAVMVEF--
Q9XEK4_BRANA/105-249...........SLK---------EF---------PSPN-S-------LKRRIIISTKP--
A7T501_NEMVE/158-302..........FDGK---------DL---------PSPQ-E-------LMGKILIKTKK--
Q4RWH6_TETNG/299-443..........EPPK---------DL---------PSPE-A-------LRGRILIKGKK--
A5A2F9_TOBAC/110-253...........SLK---------EC---------PTPE-E-------LKHRIIISTKP--
A7ASE0_BABBO/522-670..........ADFV---------AS---------IPLG-S-------LLSKFIIKGKM--
Q7ZU40_DANRE/294-438..........QMPT---------CL---------PAPE-E-------LKGRFIVKGKR--
Q45QJ6_RAT/314-464.........LKPGM---------PL---------PSPE-D-------LRGKILIKNKK--
Q0B816_BURCM/28-162.........WHAGG---------AL---------PALG-D-------VRGAVVLLRRF--
Q4PA81_USTMA/724-872........LPGSTD---------EL---------PSPE-K-------LKFKVLVKAKN--
A7TR21_VANPO/381-520...........DGD---------AL---------ASPE-S-------LKLKVILKIKK--
Q75C92_ASHGO/397-535...........HSV---------GW---------PSLR-D-------LKHKIIIKSKK--
A7RPQ0_NEMVE/307-450...........DET---------FL---------PSPE-A-------LKGRILIKNKK--
Q5MG88_TOXGO/407-550...........PTS---------PQ---------PSPE-Q-------LLCKFILKGKV--
A7SXK4_NEMVE/94-237...........TLD---------AL---------PSPK-F-------FLNKILVRGKT--
PHLC_TRYBB/54-199..........SLTT---------PL---------CNLW-Q-------STRRIFLVVRP--
Q4S9B8_TETNG/321-464...........DDF---------YL---------PSPS-Q-------LKGKILVKGKK--
O07690_LISSE/61-200..........NTSS---------KT---------PTLR-K-------LRGKILLLSDN--
A4S165_OSTLU/1-153......EEESYVLD---------RW---------PSPA-E-------LKGKVIIRDKS--
Q7PW25_ANOGA/289-436.........LESNV---------EL---------PPPA-L-------LKRKIIIKNKK--
Q4SDX6_TETNG/287-431..........WNPQ---------TL---------PSPE-E-------LKYKILVKGQK--
A7RKT2_NEMVE/272-413...........RGN---------VL---------PSPN-A-------LKRRIILKGKI--
Q4RKI8_TETNG/349-492...........EDS---------YL---------PSPH-A-------LRHRIILKGKK--
Q766D4_9BRYO/108-251...........GFK---------EL---------PSPE-S-------LKGKILISTKP--
Q2PEW5_TRIPR/126-269...........GLT---------EF---------PSPD-S-------LKRRIIISTKP--
A6RM87_BOTFB/546-665...........SSQ---------VL---------PSPS-Q-------LMDRILIKVKK--
Q4RX70_TETNG/314-458..........NDCK---------RL---------PSPE-I-------LKGKVLIKVRP--
A3LSB2_PICST/461-615...........DNA---------TL---------PSPN-E-------LKHRILLKVKK--
A4EAJ4_9ACTN/13-159........LFYTSS---------HV---------PTLN-E-------VRGKIVLLRRF--
A3LNB7_PICST/20-167..........YLNT---------DI---------PKVG-D-------ARGKAVLFRRF--
Q6R6E0_LISIV/61-201..........DSSD---------KF---------PTLK-E-------LRGKILLLLEN--
Q24284_DROME/320-463...........NEQ---------HL---------PSPY-Q-------LRRKIILKHKK--
PLCH2_HUMAN/328-472..........EDAT---------TL---------PSPQ-M-------LKGKILVKGKK--
Q0UVV5_PHANO/116-337.........PSESV---------NL---------PVLK-D-------LERKIVVKVKR--
Q4QBH9_LEIMA/195-340..........EKPT---------MA---------FSPN-N-------LKNKILVKAKR--
PLCD4_HUMAN/292-436..........VLPT---------QL---------PSPE-E-------LRRKILVKGKK--
Q0UE70_PHANO/101-258.......REQEGSG---------EH---------VTLA-D-------LGNKIVVIVEY--
A5AGR6_VITVI/112-255...........CLA---------EF---------PSPE-S-------LKXQIIISTKP--
B9DGG5_ARATH/8-150...........GCQ---------EF---------PSPE-E-------LKEKILISTKP--
Q4RLM8_TETNG/312-491.........LKPGC---------QI---------PSPS-E-------LMGKILIKNKK--
PLCL2_MOUSE/429-572...........EES---------YL---------PSPD-V-------LKGKILIKAKK--
PLCZ1_CHICK/159-303..........IEVT---------QL---------PSPE-A-------LKFKILVKNKK--
A2IB48_CHAVR/321-464...........NET---------VL---------PSPN-Q-------LKRRIILKHKK--
PLCD4_XENLA/292-436..........RIPV---------RL---------PSPD-E-------LRGKILLKGKK--
Q3F156_BACTI/43-187......NSVSSSER---------NN---------PKLG-D-------VRGKIVLLQNF--
Q2GUM5_CHAGB/104-264........EEQEGG---------DP---------VRLE-D-------LGSKIAVIVEY--
Q7SE08_NEUCR/136-356..........DRLT---------QQ---------PRLE-Q-------LLDKILIKVKR--
Q21754_CAEEL/318-461...........HRH---------PL---------SSPN-K-------LKRKFLLRGKK--
Q9GV33_WATSC/324-471.........LKPGV---------TL---------PTPY-D-------LKKKILIKNKK--
A7SDH9_NEMVE/209-352...........ALT---------SL---------PSPE-S-------LKGKVLIKGKK--
Q6EZG7_CAEEL/342-492.........LDPGV---------SL---------PSPN-R-------LRKKILIKNKR--
Q6RY08_ASTMI/305-448...........DAT---------IL---------PTVN-Q-------LRKKIILKHKK--
A4HCK9_LEIBR/248-393..........VRPT---------IL---------FSPN-N-------LKYKILIKTKR--
Q236T7_TETTS/368-513..........ISLD---------YL---------PSPN-Q-------LKKKIIIRAKG--
Q9P866_CANAX/68-213..........YLNT---------DI---------PKLG-D-------ARGKAILFRRF--
O97036_HYDVU/314-460.........LEPGI---------EL---------PSPE-Q-------LKYKILIKNKK--
O97033_9METZ/324-472.........LEPGL---------PL---------PSPE-R-------LKGKILIKDKV--
PLC1_SCHPO/443-585...........NES---------VL---------PSPE-D-------LLNKILLKVKC--
A6AS90_VIBHA/22-157.........FYLGS---------KI---------PALH-E-------AQSKIVLLRRF--
Q013R6_OSTTA/119-269.........GNQLK---------RW---------PSPL-E-------LKGRVIVRDKI--
Q75IL8_ORYSJ/119-262...........NMA---------EF---------PSPD-E-------LKGKIIVSTKP--
O96101_TRYCR/248-393..........EPTT---------FL---------FSPE-N-------LKRKILVKSKR--
A6EGD5_9SPHI/56-190..........DLGN---------GI---------PNLG-D-------VRGKIKLLRRF--
PLCD8_ARATH/107-248...........SLE---------VF---------PSPQ-Q-------LRNKILISRRP--
Q4S959_TETNG/321-464...........EEN---------YL---------LSPE-K-------LKGKILLKGKK--
Q762E2_9BRYO/150-294..........LPPQ---------SF---------RSPE-Q-------LKHRIIISDKP--
Q4RSB2_TETNG/98-242..........PATG---------EL---------PSPN-D-------LKHKILIKNKK--
Q6CD33_YARLI/505-648...........GAL---------NL---------PSPH-E-------LKHRVLIKVKA--
A7UXE0_NEUCR/117-274.........HIEQD---------QH---------VRLR-D-------LGSKIVVIVEH--
A1D7Q8_NEOFI/96-331..........EATQ---------AP---------PPLE-S-------LKRKILIKVKW--

PF00387

PLCD1_MOUSE/491-609-----------------------YL---------GCFQDN.......GGCGYVLKPAFLR
Q29N33_DROPS/566-683-----------------------NL---------GIFEYN.......ARSGYLLKPEFMR
PLCG2_HUMAN/929-1044-----------------------NH---------ALFSLN.......GRTGYVLQPESMR
PIPA_DROME/549-666-----------------------NQ---------GKFEYN.......GGCGYLLKPDFMR
Q6BZ51_DEBHA/661-779-----------------------NE---------SLFEST.......NRRGYVLKPEDLR
PLCH1_HUMAN/600-714-----------------------NR---------AKFKAN.......GNCGYVLKPQQMC
A5DAA1_PICGU/647-765-----------------------NE---------ALFQSC.......GGTGYALKPKSLR
A7RXP6_NEMVE/449-566-----------------------NL---------GIFEYN.......GRCGYILKPSFMR
A7RPQ0_NEMVE/491-608-----------------------NS---------GKFLEN.......GECGYVLKPSVMR
Q7ZU40_DANRE/483-600-----------------------NQ---------GLFYQN.......GRSGYILKPSYLR
PLCB2_MOUSE/546-663-----------------------NM---------ALFEFN.......GQSGYLLKHEFMR
PLCL1_RAT/585-702-----------------------HT---------GWFLQN.......GGCGYVLRPSIMR
Q4T850_TETNG/440-554-----------------------NR---------AKFMVN.......GGIGYVLKPPPMC
Q55WA1_CRYNB/353-467-----------------------NH---------AMFH.........DSNGYILKPLSLR
O96101_TRYCR/462-581-----------------------NK---------GFFSDN.......GNCGYVLKPESVR
P78585_BOTFU/650-769-----------------------ND---------AMFAGG......TDQSGYVLKPSELR
Q75C92_ASHGO/591-714-----------------------NQ---------AMFRVTARD.DWPWPSGYVRKPEYLL
PLCZ1_MACFA/381-498-----------------------QN---------GKFLDN.......GGSGYILKPHFLR
Q4RX70_TETNG/609-725-----------------------NR---------AKFSAN.......GNCGYILKPKCMR
Q08JX0_ORYLA/549-666-----------------------NM---------ALFEFN.......GRTGYLLKHDVLR
O97033_9METZ/764-881-----------------------NN---------AKYEFN.......GVTGYLLKPAAYL
Q25285_LOLFO/513-630-----------------------NL---------GVFEYN.......GCSGYLLKPEFMR
A3LSB2_PICST/669-787-----------------------SE---------AMFDSV.......GRKGYVLKDTSLR
A1D7Q8_NEOFI/374-488-----------------------NR---------GMFT.........GEPGWVLKPQGYR
Q17CT3_AEDAE/941-1054-----------------------NQ---------AKFRDN.......GACGYILKPDFMF
Q4SKC0_TETNG/940-1053-----------------------NS---------ALFSLN.......GGTGYVLQPEVMR
Q8CI86_MOUSE/590-707-----------------------NA---------GVFEYN.......GRSGYLLKPEFMR
Q0UE70_PHANO/300-418-----------------------NE---------ALFA.........GSGGYVLKPAALR
PLC1_YEAST/586-710-----------------------NL---------AMFQILDHQPDGSFKSGYVLKPKKLL
Q6NTX2_XENLA/945-1063-----------------------NQ---------ALFQSG.......GRCGYVFQPNCMR
Q2UCJ8_ASPOR/565-684-----------------------NQ---------AMFAAG......SDRTGYVLKPESLR
Q4QBH9_LEIMA/390-509-----------------------NG---------CIFLDS.......GCCGYLLKPDYLR
PLC_DICDI/538-653-----------------------ND---------GMFSDN.......GGCGYVLKPPCLL
Q0UVV5_PHANO/395-509-----------------------NE---------AMFA.........GTPGWVLKPEGYR
Q4PA81_USTMA/992-1114-----------------------NQ---------AMFSRN.......GRCGYVLKPAALR
Q4SDX6_TETNG/473-589-----------------------NQ---------GRFLPN.......GQCGYILKPPFMC
A4S165_OSTLU/200-316-----------------------NQ---------AKFAVN.......GGCGYVKKPDYLI
Q86RA6_DROVI/974-1087-----------------------NQ---------AKFRNN.......GQCGYILKPAFMM
Q4RSB2_TETNG/292-409-----------------------ND---------GRFQDN.......GGCGYVLKPVVLM
Q6RY08_ASTMI/926-1041-----------------------NE---------GFFALN.......DRCGYVLTPPCMR
Q45UR4_NEUCS/413-527-----------------------NE---------GMFA.........GTGGYVLKPVGYR
A7SMY6_NEMVE/399-515-----------------------NH---------GRFLDN.......GRCGYVLMPESIR
Q2HB23_CHAGB/789-908-----------------------NQ---------AMFDGG......TAQSGYVLKPIEGR
PLCL2_HUMAN/617-734-----------------------NI---------GWFRQN.......GNCGYVLRPAIMR
Q59LC4_CANAL/795-913-----------------------NE---------ALFENK.......IFQGYVLKPSVLR
Q0UC00_PHANO/609-729-----------------------NQ---------AMFAGG......DDRTGYVLKPTTLR
Q4S959_TETNG/510-627-----------------------NL---------GWFRQN.......GNCGYVLRPAIMR
Q1LWH7_DANRE/476-593-----------------------ND---------GLFNQN.......GRCGYVLKPAFMR
PLCD4_RAT/502-619-----------------------CD---------GLFRQN.......GGSGYVLKPEFLR
Q4RKI8_TETNG/560-677-----------------------NT---------AWFRQN.......GNCGYVLRPAIMR
PLCD4_HUMAN/492-609-----------------------CD---------GHFRQN.......GGCGYVLKPDFLR
O97037_HYDVU/475-592-----------------------ND---------GMFALN.......GKCGYVLKPECLR
O97035_HYDVU/534-651-----------------------NL---------GKFEIN.......GRCGYLLKPEHMR
Q5QIB9_STRPU/494-610-----------------------NQ---------GKFLQN.......GKSGFILKPVFCR
A2QEJ2_ASPNC/322-436-----------------------NA---------GMFA.........GEQGWVLKPPGYR
Q5IRA3_CRYPA/437-551-----------------------NE---------GMFA.........GSGGYVLKPPGYR
PLCD3_HUMAN/527-644-----------------------NA---------GRFLVN.......GQCGYVLKPACLR
Q2VYF9_9TRYP/452-571-----------------------NR---------GFFSDN.......GNCGYLLKPTAVD
A7TR21_VANPO/594-717-----------------------NL---------ALFKLTDQK.QELLHTGYALKPPKLL
Q6CSI9_KLULA/616-739-----------------------NH---------AMFQVSLDR.NSIWHSGYVLKPAHLR
Q91423_9TELE/236-353-----------------------NQ---------GRFLPN.......GKCGYILKPEFMR
Q013R6_OSTTA/351-466-----------------------NR---------AKFRVN.......GNCGYVKKPAYLL
Q4SCY8_TETNG/264-356-----------------------NL---------GMYEYN.......GKCGYRLKPEFMR
A7RPT6_NEMVE/606-723-----------------------NR---------GKFRAN.......GNCGYVLKPDILC
Q5B933_EMENI/339-453-----------------------NQ---------GMFA.........GEQGWILKPQGYR
PLCD4_XENLA/485-602-----------------------ND---------GLFRQN.......ARCGYVLKPSFMR
Q5JYS9_HUMAN/412-529-----------------------NQ---------GKFEYN.......GSCGYLLKPDFMR
Q9XWB7_CAEEL/527-651-----------------------NY---------AMFERN.......GGCGYVRKPDWLR
A7SDH9_NEMVE/402-519-----------------------NQ---------GRFREN.......KRAGYVLKPAYMR
PLCZ1_CHICK/376-493-----------------------QN---------GKFLDN.......GGCGYILKPEFLR
PLCH2_HUMAN/625-740-----------------------NR---------AKFSAN.......GGCGYVLKPGCMC
Q7QHE3_ANOGA/969-1085-----------------------NQ---------AKFRDN.......GGCGYLLKPEFMF
A7MD68_DANRE/509-626-----------------------NQ---------ARFLPN.......GKSGYILKPEFLR
A7EE08_SCLS1/440-554-----------------------NE---------GMFA.........GSQGWILKPPGYR
A5E691_LODEL/252-371-----------------------NE---------AMFEDP......HNKSGYVLKPSYLR
Q6CD33_YARLI/706-822-----------------------ND---------AMFA.........ARGGYVLKPPYLR
Q2H4G2_CHAGB/404-521-----------------------ND---------AMFA.........GTNGWILKPPALL
PLC1_SCHPO/637-753-----------------------ND---------ALFIAD.......PPTGYLLKPPCQR
PLD3A_DANRE/505-621-----------------------NQ---------GRFLPN.......GRCGYVLKPEFLC
O97034_9METZ/947-1065-----------------------NE---------GKFLQN.......GKCGYVLMSDCMF
A7SXK4_NEMVE/279-396-----------------------HY---------GKFRQN.......GNTGYVLKPKFLR
A6RBI2_AJECN/377-491-----------------------NE---------GMFV.........GYRGWVLKPETYR
Q1LWW2_DANRE/14-131-----------------------NS---------ALFSLN.......GGAGYVLKPEWMR
A2IB48_CHAVR/945-1060-----------------------NE---------GKFKLN.......GRCGYILQPECMH
Q6FY00_CANGA/575-699-----------------------NV---------AMFQLNTRN.QQQMPSGYVLKPGWLA
Q4SNU6_TETNG/496-627-----------------------NQ---------GRFQVN.......GKSGYILKPAFMR

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window