Sequence alignment for CL0389

PF02176

TRAF6_MOUSE/151-202----HQV-H.CEFALVNCPQ---..CQRPFQKCQVNTH----------------IIEDCPRR-----------QVSCVN.
TRAF6_MOUSE/204-261----HDQ-S.CPLANIICEY---..CGTILIREQMPNH----------------YDLDCPTA-----------PIPCTFS
DG17_DICDI/197-255----HYK-T.CPMVPIDCSQ---GCSVK.IERKSIIDH----------------IENDCCNT-----------QIPCKYF
TRAF5_HUMAN/183-241----HEE-NLCPEYPVFCPN---NCA.KIILKTEVDEH----------------LA.VCPEA-----------EQDCPFK
TRAF2_MOUSE/178-235----HYE-V.CPKFPLTC.D---GCGKKKIPRETFQDH----------------VR.ACSKC-----------RVLCRFH
TRAF5_MOUSE/128-183----HLQ-H.CSFQAVPCPN---ESCREAMLRKDVKEH----------------LSAYCRFR-----------EEKCLY.
TRAF2_HUMAN/178-235----HHE-V.CPKFPLTC.D---GCGKKKIPREKFQDH----------------VK.TCGKC-----------RVPCRFH
TRAF3_HUMAN/136-192----HLK-NDCHFEELPCVR---PDCKEKVLRKDLRDH----------------VEKACKYR-----------EATCSH.
TRAF4_HUMAN/102-156----HLN-T.CSFNVIPCPN---RCPMK.LSRRDLPAH----------------LQHDCPKR-----------RLKCEF.
TRAF4_HUMAN/210-269----HQY-Q.CPRLPVACPN---QCGVGTVAREDLPGH----------------LKDSCNTA-----------LVLCPFK

PF03145

Q7QF99_ANOGA/180-384LRNYTLE.AIVSKVQFPCRNAVKGCSVR.LPLQLLRWH----------------KE-RCGYK-----------LIECFMG
Q178N6_AEDAE/160-363MRNYTLE.AIAAKVHFPCTHAARGCTVR.LPLELLWWH----------------KD-RCGYK-----------QIECFMG
SINA_SCHMA/167-362IRNLAME.KLASSVLFPCKYSTSGCPET.FHYTSKSEH----------------EA-ACEYR-----------PYDCPCP
Q9LID2_ARATH/31-262INDLQVESRVHELLDFPVHTNQISSAIYEILLQCPNDH----------------IE-NPKKK-----------PYNCPHS
SINAL_DROME/147-342IRSLAME.KVASKLIFPCKHSHFGCRAR.LSYAEKTKH----------------EE-DCECR-----------PYFCPYP
Q29HR3_DROPS/254-449SRSLTVE.ALCAKAHFGCSHAAGGCQVR.MPVALLPWH----------------EQ-QCIYK-----------PMKCFMG
Q6Z6Z3_ORYSJ/102-301IRCLALE.KVAESLQLPCKYQSLGCAEI.HPYQNKLKH----------------EE-LCRFR-----------PYSCPYA
Q5JST9_HUMAN/77-273IRNLAME.KVAKFVLFPCRYACLGCEIT.LPHTEKADH----------------EE-VCEFR-----------LYSCPCP
A2WK44_ORYSI/189-377ARSRAIG.HLLRCIRFACKNRRYGCPSF.LPRQDMDEH----------------EL-SCDHE-----------PCFCPI.
SIA1B_MOUSE/82-278IRNLAVE.KVANSVLFPCKYSASGCEIT.LPHTKKAEH----------------EE-LCEFR-----------PYSCPCP

PF00917

O76641_CAEEL/14-126----VKNISRFV.......NGENYYT.NLEDRFNIPWR................INIKKMSG.......NFEFYLRCEKE
TRAF1_MOUSE/266-407----ITNVTKRCHESVCGRTVSLFSPAFYTAKYGYKLC................LRLYLNGDGS.GKKTHLSLFIVIMRG
MEP1A_RAT/439-598----IRNISQVLEN..TVKGDRLVSPRFYNS.EGYGFG................VTLYPNGRIT.SNSGYLGLAFHLYSG
MEP1B_MOUSE/435-588----IQNFTQILG....GQDTSVYSPPFYSS.KGYAFQ................IYMDLRSS......TNVGIYFHLISG
MEP1B_HUMAN/434-587----IRNFTQFIG....SPNGTLYSPPFYSS.KGYAFQ..................IYLNLAH....VTNAGIYFHLISG
O76610_CAEEL/166-276----KYTFEKFD.........EDCVG.GYNVQLGFLWS................LNIHRKND.......HLRISLCCDKP
TRAF6_MOUSE/365-509----IGNFGMHLKSQEEERPVVIHSPGFYTGRPGYKLC................MRLHLQLPTAQRCANYISLFVHTMQG
DG17_DICDI/327-450----ISNYSSVAK....SKLNCQALSSPMLSILSHLFQ................VCVYPKGDE...NKEYISLYLRVNNI
MEP1A_HUMAN/438-595----VRNFSQVLEN..TSKGDKLQSPRFYNS.EGYGFG................VTLYPNSRE...SSGYLRLAFHVCSG
O16551_CAEEL/14-125----VKNISRFV.......DDESYFT.DTEERFNIPWR................IEIKKKDG.......NFELFLKCQKE
O17192_CAEEL/12-125----FKDISKLG.......EGESYFS.DKEERYNIPWR................LQIFRKGG.......FLGLNLKCEKK
O76611_CAEEL/30-142----IKNISTLN........IGNTYTSDVEDHFGFLWH................LSYIYDGR.......FLRTTLNIDVN
TRAF5_HUMAN/410-551----VTDYKMKKREAVDGHTVSIFSQSFYTSRCGYRLC................ARAYLNGDGS.GRGSHLSLYFVVMRG
O16553_CAEEL/149-261----VKNISSIE.......EGDDYYT.EIATRHNVPWR................MQIKRNNG.......FFELYLRCEKE
O16554_CAEEL/23-135----VKHISSIK.......EGDDYYT.KIEKRYNIPWK................LGIHRSNG.......FFGLFIYCDKK
O16555_CAEEL/11-123----VRNISRFE.......DQEQYST.DTETHFNIPWA................LQIRKNNG.......YLQFYLLCEKE
O16557_CAEEL/96-208----VENVSSIE.......EGGHYYT.KTEKRFNIPWR................LLIQRCDG.......FFGLYLCCQKE
O16558_CAEEL/149-261----VKNVSSIK.......EGGNYFT.NTEKRFNIPWR................LQIQRFNE.......FFGLYLRCEKE
O16559_CAEEL/157-269----VKNVSSIK.......EGGNYFT.KTEKRFNIPWK................LNIERKNG.......FFGLYLHCTKE
O16560_CAEEL/140-252----VKNVSRII.......DGSDYFT.KIENRFNIPWQ................LKIQRRNG.......FFGIFLHCNKE
O16562_CAEEL/108-218----VKNMSSIK.......EGEEYFS.DIQTRFNIPWY................LQVKRRDG.......FNGLFLHCSKH
O16567_CAEEL/26-139----SSGLTPVA.......APQPAYTGRSTENFNIPWF................IEILRKTN.......RLAVYFHCDKL
O16736_CAEEL/14-129----VKNVSSIA.......DGGEHVT.PSEIHYGTEWY................MRIKRDNG.......FMSFGLYCPMT
O17190_CAEEL/289-402----VRNMSSIK.......EGGDYLT.DIQTRFNIPWK................LKIQRLNG.......FIELFLRCAEN
O17191_CAEEL/289-401----VKNMSRIE.......EGEEYYT.GIQTRFNIPWK................LKIKKQSG.......FFGLFLHCFKQ
O17193_CAEEL/11-126----VKNIAAMK.......EGDSQST.TSEQHFGLPWY................FKVFCKDK.......HLQLCVYYGAQ
O17288_CAEEL/229-340----IKNMSSIR.......EGEDYDT.DTQYRFNIPWS................LKILNRNE.......FSGLFIRCEKQ
O17297_CAEEL/14-127----FKNVSKMK.......DSDFLYS.PEENLFNVPWF................MLIARKDD.......HFGVFLHCQKI
O17301_CAEEL/575-687----VRNISQFL.......NGEQYFT.DVEERFNIPWR................IRIWRHNG.......YLVLYLQCDKE
O17303_CAEEL/12-125----FKDVSKLD.......EGGSYYS.DIEIRHNIPWRL..............S..ISKKDG.......FLGVNLHCENK
O44805_CAEEL/17-135----FNDVSNMN.......DNDMRFG.TVEEYFNVPWI................FQIQRNNG.......NLGIYLRCTNL
O44815_CAEEL/14-128----YKNVSKLE.......DEGTLLS.PSEEHFNVQWY................MAVSHKKE.......DMAVYLHCNIL
O44817_CAEEL/14-126----FKNVTKWK.......TGEIFYS.PDEEHFNVPWQ................MCIHRENG.......NMCVILCCLKV
O45623_CAEEL/38-168----IDCFSKFM......SRSDNRIMSKPIIVRGIPWRILAICRNQQGSRHSMNSRVNRSNF.......NFGFFLQCNND
O76557_CAEEL/290-402----VRNISSIN.......GGNVYFT.DIETRFNVPWK................LSFVRQSG.......FIELYLRCEKK
O76558_CAEEL/284-397----VKNMSSIE.......EGRIIFS.DTQTRFNILWK................LKIRKQDG.......FFELFLLCDKQ
O76568_CAEEL/14-130----FTDVSKME.......KDISVFS.PGEEHFNVSWN................MSISCEGD.......HLGVFLHCHKS
O76642_CAEEL/14-126----VKNISRFV.......DGESYYN.NLEDRFNIPWR................MTLERKNY.......QCGFYLRCEKE
O80808_ARATH/122-240----IRDFSVLK.........QNDCISKTFAMGGKNWT................LTVYPKGDSE..ADNEFCKYLHLADG
O81494_ARATH/85-212----ITSFSVIK.......GRGEPYESSVFEAAGYKWR................LVLYVNGN.....KNDGGNDHISLYA
O81496_ARATH/65-169----ITSFSIIR.......TRPEPYESSVFEAL.....................IMMQIN........KSG..DWF....
O81499_ARATH/78-210----RTDKGIERR....ATIESEAFESSTFEAAGYKWR................FMLFVNGNQ...NDPDGGHENMALYV
BAT39_CAEEL/57-173----IYNFEHLD..........GSYTSDLKEHNGIYWC................VRIQSNKAAK.SQKRRVSIYLVCNPN
P91300_CAEEL/283-399----FYDVSRIE.......EGESRFS.AFEKRFNIPWR................IELKRVSG.......FLEIHLHCGEN
P93826_ARATH/74-198----IPKFSEIT.........KREHRSNVFEAGGYKWY................ILIYPQGCD...VCNHLSLFLCVANY
TRAF3_HUMAN/422-562----IRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMC................ARVYLNGDGM.GKGTHLSLFFVIMRG
TRAF4_HUMAN/314-464----IGSYGRRLQEAKAKPNLECFSPAFYTHKYGYKLQ................VSAFLNGNGS.GEGTHLSLYIRVLPG
BAT38_CAEEL/86-206----IPNFSNLR..........SKVSTPFQYIGNLPWR................LAAKTEKTKRTSDVKFFSVYIDCNPE
MEL26_CAEEL/48-164----VKNFSHCYQ.....EYLEN.FVYLQRGDEQLTWS................IKIYPKGN.....GE.NNKDFVFLCL
TRAF2_MOUSE/358-498----ISDFTRKRQEAVAGRTPAIFSPAFYTSRYGYKMC................LRVYLNGDGT.GRGTHLSLFFVVMKG
UBP15_YEAST/46-181----IPDWNELT.........NPKYNSPRFRIGDFEWD................ILLFPQGNH....NKGVAVYLEPHPE
BAT15_CAEEL/14-125----FKDVSQLE.......DGDFFKS.PEEIHYNAEWF................ILVIRTKD.......QLEAYLHCDNE

PF02176

TRAF6_MOUSE/151-202.--..C-----------AVSMAYE..EKE---------------------------------------------------
TRAF6_MOUSE/204-261V--FGC-----------HEKMQRNHLARH---------------------------------------------------
DG17_DICDI/197-255E--QGC-----------KVEMKRSELQNH---------------------------------------------------
TRAF5_HUMAN/183-241H--YGC-----------AVTDKRRNLQQH---------------------------------------------------
TRAF2_MOUSE/178-235T--VGC-----------SEMVETENLQDH---------------------------------------------------
TRAF5_MOUSE/128-183.--..C-----------KRDIVVTNLQDH---------------------------------------------------
TRAF2_HUMAN/178-235A--IGC-----------LETVEGEKQQEH---------------------------------------------------
TRAF3_HUMAN/136-192.--..C-----------KSQVPMIALQKH---------------------------------------------------
TRAF4_HUMAN/102-156.--..C-----------GCDFSGEAYESH---------------------------------------------------
TRAF4_HUMAN/210-269D--SGC-----------KHRCPKLAMARH---------------------------------------------------

PF03145

Q7QF99_ANOGA/180-384KVWGGC-----------GWHGCERDWLAHCLAEHADHVHEDRCVELQWAYGAEAAQRAPELQLVVAY.............
Q178N6_AEDAE/160-363KVWEDC-----------SWHGCEKDWIGHCVTEHQDKVYNLPDIVLTWNYAADS.QRCIALQSVIAY.............
SINA_SCHMA/167-362G..ASC-----------KWLGELEQVMPHLVHHHKSITTLQGE.DIVFLATDISLPGAVDWVMMQ...............
Q9LID2_ARATH/31-262G..AKC-----------DVTGDIQRLLLHLRNDHNVEMSDGRSFSHRYVHHDPKHLHHATWMLTVSYITDYLALFLQLCE
SINAL_DROME/147-342D..DKC-----------SWQGPLRDVYQHLMSSHENVITMEGN.DIIFLATNVNLEGALDWTMVQ...............
Q29HR3_DROPS/254-449RVWGEC-----------KWQGREVQWKEHLEEQHAEKLFRSSTSDLVWNMAARRKP.......LTGY.............
Q6Z6Z3_ORYSJ/102-301G..SEC-----------LIAGDVPMLVSHLINDHKVDLHEGCTFNHRYVKSNPYEVENATWMLTV...............
Q5JST9_HUMAN/77-273G..TVC-----------KWQGTMDAIMPHLTKMHEYITTIEGE.DIIFLATSINLVGAYDWVMIQ...............
A2WK44_ORYSI/189-377...RRC-----------GFAGAADSLARHLTARHGW.....GRLRVAYGEAAVVPVQSPTILRAD...............
SIA1B_MOUSE/82-278G..ASC-----------KWQGSLDAVMPHLMHQHKSITTLQGE.DIVFLATDINLPGAVDWVMMQ...............

PF00917

O76641_CAEEL/14-126E--CEN..........RKWSIETEYTLKLVSHNGKS.........LKKNSK.....DTFEKF..................
TRAF1_MOUSE/266-407E--YDA.........LLPWPFRNKVTFMLLDQNNREH......AIDAFRPDL..SSASFQRP..................
MEP1A_RAT/439-598D--NDV.........ILEWPVENRQAIMTILDQEPD.........ARNRMS...LSLMFTTSKYQTSSAINGSVIWDR.P
MEP1B_MOUSE/435-588A--NDD.........QLQWPCPWQQATMTLLDQNPD.........IRQRMF...NQRSITTDPTMTSDNGSYFWDRPSKV
MEP1B_HUMAN/434-587A--NDD.........QLQWPCPWQQATMTLLDQNPD.........IRQRMS...NQRSITTDPFMTTDNGNYFWDRPSKV
O76610_CAEEL/166-276E--PTP...........YWEVRADFQLVLPGQDEAP.........VTKGYF.....RNIDEE..................
TRAF6_MOUSE/365-509E--YDS.........HLPWPFQGTIRLTILDQSEAL.........IRQNHE.....EVMDAKPELLAFQ...........
DG17_DICDI/327-450E--EPN...........SLKVEYSFTLVNVLDKSKS.........ITKKED....KKVFISS..................
MEP1A_HUMAN/438-595E--NDA.........ILEWPVENRQVIITILDQEPD.........VRNRMS...SSMVFTTSKSHTSPAINDTVIWDR.P
O16551_CAEEL/14-125.--.EC........ENRKWSIETEYTLKLVSQNGKC.........LMKNNK.....YTFENQ..................
O17192_CAEEL/12-125.--.ECF.......GERKWSFQTKFTMKLVAVSGKF.........FQRAVQ.....HEFQQP..................
O76611_CAEEL/30-142G--RSA...........LWSVGMKVRHMFVTKNGA..........DHFHNS...TDHVFSQE..................
TRAF5_HUMAN/410-551E--FDS.........LLQWPFR.QRVTLMLLDQSG.KK....NIMETFKPDP..NSSSFKRP..................
O16553_CAEEL/149-261.--.EQ........PEWGWKIELDYDLRLVSLNGQS.........LSLTDS.....GSFSKP..................
O16554_CAEEL/23-135.--.LS........ETRPWGIKVEDTLKLVSVNGQS.........LSFNGT.....PTFKEP..................
O16555_CAEEL/11-123.--.EC........ETRKWSIEVEFKLKLVSYNGKR.........LMTDCR.....RTFEKP..................
O16557_CAEEL/96-208.--.QC........NRRNWTIEVDYTLKLVSVNGQS.........LSSKVK.....YTFNEP..................
O16558_CAEEL/149-261.--.LS........NRRNWTIEVEYDLRLVSLNGQS.........LSIKGT.....STFEKP..................
O16559_CAEEL/157-269.--.LS........NKNNWTIEVEFDLRLVSLNGQS.........LSIKLT.....STYKEH..................
O16560_CAEEL/140-252.--.MS........NRSNWTIAVDFTLKLVSTNGQC.........LTSNMT.....SVFNEP..................
O16562_CAEEL/108-218.--.LD........EFRNWSIKTEYQFKLVSTNGRN.........VAFYGE.....KVFEKP..................
O16567_CAEEL/26-139K--EDE..........IDWSIDVEYEITLKSSDGKR........ITKKTD......HQFTK...................
O16736_CAEEL/14-129G--KTT...........NWSIVADIRVELMPLTGMWK.......SVECECK.....IAKSPS..................
O17190_CAEEL/289-402.--.MC........ESRKWSIETEYQLKLVSTNGRS........LSLKNIK.....YVFDKP..................
O17191_CAEEL/289-401.--.LD........EFRKWSIETEYQLKVVSSNGRS.........VSFSFS.....YLFDKP..................
O17193_CAEEL/11-126L--IAE...........EQSIEVECDFKMITPTGKI........FVEKTGV....R.KYGGET.................
O17288_CAEEL/229-340.--.LC........KSRKWSIETEYQLKIVSPNGRS.........ELFGGT.....YVFDNP..................
O17297_CAEEL/14-127N--EAG..........PTWSVDTQNTIRVKTLSASK.........VSSEIF....KHKFEKN..................
O17301_CAEEL/575-687.--.QC........ETRKLTVETEFTLKLVSPYGTS.........LARNQV.....HTFVEL..................
O17303_CAEEL/12-125.--.ECS.......ETKKWSFQTKFTMKLVAVSGKF.........FQRTVQ.....HEFQKP..................
O44805_CAEEL/17-135K--DQE...........MWSIFSELELKLVSVYSDT........RDQKCKI....DMCFGHD..................
O44815_CAEEL/14-128G--KAE..........ATWCIDAEFEFTLKNSCGKR........STKKT......AVKFTNS..................
O44817_CAEEL/14-126E--EDR..........VPWKINFEYQLKIVNISGMS........IVKAG.......NKICTE..................
O45623_CAEEL/38-168E--LLQ........KRGMWRCYGTAVLEVLNADGPS.........IQKKIH.....HSFHN...................
O76557_CAEEL/290-402.--.QC........LSRTWSIEAEFTLKLVSPHGRS.........LSLRKI.....YSFEKS..................
O76558_CAEEL/284-397.--.LC........KSRKWSIETVFQLKIVSSNGRS........LVLLKTT.....RVFNKA..................
O76568_CAEEL/14-130R--GKE..........TMWTIDTEHQFTLKTSSGKA........YREDDNF....NFQFSNA..................
O76642_CAEEL/14-126.--.EC........EARKWSIETEYTLKLVSQNGKS.........LMKNSK.....YTFEKP..................
O80808_ARATH/122-240E--VLS..........PGEMISVRAQLRALDPRGSK........HKTVWLQ....QWIMAAT..................
O81494_ARATH/85-212R--IEETN.....SLPLGWEVNVDLKLFVH...............NGKLHKYLTVTDGLVKR..................
O81496_ARATH/65-169.--.............LGWEVNVDLKLFVY...............NGKLNKYLIVTDGTVKR..................
O81499_ARATH/78-210G--IKETE.....SFPRGWEVNVDLKLFVH...............NEKLHKYLTVSDGTVKR..................
BAT39_CAEEL/57-173N--SSP...........DWSVTTSFGFRIINSWGKS........RNKISTL...FNHTFTSN..................
P91300_CAEEL/283-399.--...A.......TFLYHQIETDCWFNLVSTNGKH.........LMRQMS.....AVFCRD..................
P93826_ARATH/74-198D--KLLPGS..FAILEAGWSQFAQFTISVLSQDLKK.........SKFSDT....LHRFWKK..................
TRAF3_HUMAN/422-562E--YDA.........LLPWPFK.QKVTLMLMDQGS.SRR...HLGDAFKPDP..NSSSFKKP..................
TRAF4_HUMAN/314-464A--FDN.........LLEWPFA.RRVTFSLLDQSDPGLAKPQHVTETFHPDP..NWKNFQKPGTW...............
BAT38_CAEEL/86-206S--EST...........LWSCDAVVEFRLVSRNRTIP.......PFSRQFT.....NKFNYN..................
MEL26_CAEEL/48-164N--RVI.........NNNVKAG.KIGFKSQFKLRT.........AENKDIE....MRIHPNP..................
TRAF2_MOUSE/358-498P--NDA.........LLQWPFN.QKVTLMLLDHNN.RE....HVIDAFRPDV..TSSSFQRP..................
UBP15_YEAST/46-181E--KLDETTGEMVPVDPDWYCCAQFAIGISRPGNGD........TINLINK...SHHRFNAL..................
BAT15_CAEEL/14-125K--DDN..........VAWTVDAEFSLKIASSSGSY.........AMKFQK.....GCFDG...................

PF02176

TRAF6_MOUSE/151-202--------------------------------------------------------------------------------
TRAF6_MOUSE/204-261--------------------------------------------------------------------------------
DG17_DICDI/197-255--------------------------------------------------------------------------------
TRAF5_HUMAN/183-241--------------------------------------------------------------------------------
TRAF2_MOUSE/178-235--------------------------------------------------------------------------------
TRAF5_MOUSE/128-183--------------------------------------------------------------------------------
TRAF2_HUMAN/178-235--------------------------------------------------------------------------------
TRAF3_HUMAN/136-192--------------------------------------------------------------------------------
TRAF4_HUMAN/102-156--------------------------------------------------------------------------------
TRAF4_HUMAN/210-269--------------------------------------------------------------------------------

PF03145

Q7QF99_ANOGA/180-384..........HVVRAYGEAFNLY.QVYDQD..SRTVLWTVICATKESQVSGRYAFELELYSPVNTWQLLVQRFPCHSELD
Q178N6_AEDAE/160-363..........YVIRAYGEYFNVY.QIYDQN..SRRTIWTVICASKEAKTSHRFAFELELYSPIDSSKLLVQRFPCHSEND
SINA_SCHMA/167-362.............SCFGHSFMLVLEKQERV..PDQIFFALVQLIGTRKQADQFVYRLELNG..HRRRLTWEACPRSIHDG
Q9LID2_ARATH/31-262FLSFNPLETMQLLDCCGRKFCLYFEAFHLR..KTPMYMAFMQFMGDEEEAMSFSYSLQVGG..NGRKLTWQGVPRSIRDS
SINAL_DROME/147-342.............SCHGRHFLLSLEKINLG.EDCQQYFTACRMIGSMKDAAEFVYNISLEA..YNRTLRWQSKPRSIREN
Q29HR3_DROPS/254-449..........YVFQAHDEMFNFY.EIYD....KQRILFTMTCTSNRRESKYNYAYEVTLLQPDNEALSMTQKFPVHSEYD
Q6Z6Z3_ORYSJ/102-301............FKCFGQHFCLHFEAFLLG..MAPVYMAFLRFMGEDSEARNFCYSLEVGG..NGRKLTWQGIPRSIRDS
Q5JST9_HUMAN/77-273.............SCFGVRFMLVLQKQEDH.NGGQQFFAVVQLLGASKEAENFAYQLELKG..NRRRLTWEATPLPIHED
A2WK44_ORYSI/189-377...............DGRIFHLSCTRERGGGGGTAMSMVCIRPDHVAGAEEEFTYEVRTAC..QRLQMQAAVEGTSLRYG
SIA1B_MOUSE/82-278.............SCFGFHFMLVLEKQEKY.DGHQQFFAIVQLIGTRKQAENFAYRLELNG..HRRRLTWEATPRSIHEG

PF00917

O76641_CAEEL/14-126...............TGHGWSK.....CISWKDLESDY...LVDDSIVVEAHVKI-------------------------
TRAF1_MOUSE/266-407...............QSETNVASGCPLFFPLSKLQSPKHAYVKDDTMFLKCIVDT-------------------------
MEP1A_RAT/439-598TKVGVYDKDCDCFRSIDWGWGQ.....AISHQMLMRRN..FLKDDTLIIFVDFKD-------------------------
MEP1B_MOUSE/435-588GVTDVFPNGTQFSRGIGYGTTV.....FITRERLKSRE..FIKGDDIYILLTVED-------------------------
MEP1B_HUMAN/434-587GTVALFSNGTQFRRGGGYGTSA.....FITHERLKSRD..FIKGDDVYILLTVED-------------------------
O76610_CAEEL/166-276..............LKCEELGR.....EIEWEEIADKY...PVDGYLTIEARVNV-------------------------
TRAF6_MOUSE/365-509.......RPTIPRNPKGFGYVT.....FMHLEALRQGT..FIKDDTLLVRCEVST-------------------------
DG17_DICDI/327-450...............EGWGWGK.....FLLSDLINKENGWLSNDDKLIIEIYIKI-------------------------
MEP1A_HUMAN/438-595SRVGTYHTDCNCFRSIDLGWSG.....FISHQMLKRRS..FLKNDDLIIFVDFED-------------------------
O16551_CAEEL/14-125...............LGRGWE......FVSWKELESEY...VVDDSIVVEAHVKI-------------------------
O17192_CAEEL/12-125...............KGHGMDK.....FISWENMLRDY...VNNDSIIIEIHADM-------------------------
O76611_CAEEL/30-142...............HNYGLTA.....ITFFEDIKNKI...FDDDMVYVDVEVTI-------------------------
TRAF5_HUMAN/410-551...............DGEMNIASGCPRFVAHSVLENAKNAYIKDDTLFLKVAVDL-------------------------
O16553_CAEEL/149-261...............FCEGFEK.....FMRWNIMEENY...IVKDSIIIEARGKI-------------------------
O16554_CAEEL/23-135...............TGFGFSK.....FIRWDDMEEKY...VVNDSIIIEARVKI-------------------------
O16555_CAEEL/11-123...............SGLGSGD.....FLSWEKFEREY...VVDDSIVIEAHVKI-------------------------
O16557_CAEEL/96-208...............NAYGIGK.....FIRWDDMENKY...MVNDSIIIAALVKI-------------------------
O16558_CAEEL/149-261...............ISYGYCK.....FIRWDDMENKY...MVNDSVIIGALVKI-------------------------
O16559_CAEEL/157-269...............YGYGWDK.....FLRWDDMLEKY...TVNDSIIIAALVKI-------------------------
O16560_CAEEL/140-252...............DGYGLFK.....FIRWDDMEEKY...LVNDSIGVEARVKI-------------------------
O16562_CAEEL/108-218...............VGSGWGK.....LMRWENWSSR.....CNDNFVFEANVRI-------------------------
O16567_CAEEL/26-139................NEGYGFP...KLMNWDTLIKDY...LIDDSITIEVTVKI-------------------------
O16736_CAEEL/14-129...............LISEVLRS...TIMPWGRMMTNY...VVDDALMIEVFVTI-------------------------
O17190_CAEEL/289-402...............FGYGWLT.....LLRWDSLEEKY...IVNDTLIIEAHVKI-------------------------
O17191_CAEEL/289-401...............FGYGWLK.....LLRWDNLEEKY...IVNDTLVIEAHVKI-------------------------
O17193_CAEEL/11-126.............QYIGIGFPK.....FMLWEKMMKEF...VVEDTVTVEVCLKI-------------------------
O17288_CAEEL/229-340...............NIYGWH......IIRWSSLEDRY...IVNDTLTVEAQVTI-------------------------
O17297_CAEEL/14-127...............E..GWGYF...KFISWDTLTNDY...LIDDCIIVEITVKI-------------------------
O17301_CAEEL/575-687...............KGRGWHK.....FISWEELESDY...VIDDSTIIEAHVKI-------------------------
O17303_CAEEL/12-125...............EGHGMDK.....LISWENMLRDY...VDEDSIIIEIHADI-------------------------
O44805_CAEEL/17-135...............SGKFYSSYGWSEFISWNELETSF...MEAGSITVEARVLI-------------------------
O44815_CAEEL/14-128...............ENIGYGWK...KFISWEMLAKDY...IIDDIIIAEATVKV-------------------------
O44817_CAEEL/14-126...............KRR.FVRR...QFISRNTLKSGY...LVDDIITVEATVKI-------------------------
O45623_CAEEL/38-168...............TEVDWG......FSNYDQYDTLC...NPKDGYVVNDTIKL-------------------------
O76557_CAEEL/290-402...............IGNGYSK.....VMRWDEMKDKY...VVDNSIIIEAHVKI-------------------------
O76558_CAEEL/284-397...............TGYGWLK.....LIRWDSLEEKY...IVDDTLTIEAHVKI-------------------------
O76568_CAEEL/14-130...............HSYGNGTT...EFISWNKLIKDY...LIDDVITVEAAVKI-------------------------
O76642_CAEEL/14-126...............KSYGWIN.....FLSWKELESDY...VVDDSIVVEAHVKI-------------------------
O80808_ARATH/122-240...............KARGIPQ.....SLSLADLQEAY...LDEDTLNVEIECEV-------------------------
O81494_ARATH/85-212...............YNNAKKEWGFGQLIPRSTFYNANEGYLDQDTGSFGAEIFI-------------------------
O81496_ARATH/65-169...............YNNATKELGYGQLIPQSTFYDGNDGYREQDTGTFGAEIYI-------------------------
O81499_ARATH/78-210...............YEAAKTYWGFGNLIPRTTLLDPNEGYILHDTLSFGAEISI-------------------------
BAT39_CAEEL/57-173..............ETSKGTSG.....YCTWDELTA......ANSGFLVEGRFQI-------------------------
P91300_CAEEL/283-399...............VDMESLKKSLKKVIRWDDMMTDY...VINDSFIIEAHIEI-------------------------
P93826_ARATH/74-198..............EHDWGWKK.....FMELPKLKDG....FIDESGCLTIEAKV-------------------------
TRAF3_HUMAN/422-562...............TGEMNIASGCPVFVAQTVLENG.T.YIKDDTIFIKVIVDT-------------------------
TRAF4_HUMAN/314-464............RGSLDESSLGFGYPKFISHQDIRK..RNYVRDDAVFIRAAVEL-------------------------
BAT38_CAEEL/86-206..............SNNWGFPS.....FMAWEDVNNSN..YVRNEMVTVTARVVV-------------------------
MEL26_CAEEL/48-164...............SHSDY..V...SYIKRDVLFPQ...IMPRDMIIVNVEIDV-------------------------
TRAF2_MOUSE/358-498...............VSDMNIASGCPLFCPVSKMEA.KNSYVRDDAIFIKAIVDL-------------------------
UBP15_YEAST/46-181..............DTDWGFANLIDLNNLKHPSKGRPLS.FLNEGTLNITAYVRI-------------------------
BAT15_CAEEL/14-125...............FGLGWND.....FVSWDSLTEDF...LYDNSFTIEACVKI-------------------------

PF02176

TRAF6_MOUSE/151-202------------------------------------------
TRAF6_MOUSE/204-261------------------------------------------
DG17_DICDI/197-255------------------------------------------
TRAF5_HUMAN/183-241------------------------------------------
TRAF2_MOUSE/178-235------------------------------------------
TRAF5_MOUSE/128-183------------------------------------------
TRAF2_HUMAN/178-235------------------------------------------
TRAF3_HUMAN/136-192------------------------------------------
TRAF4_HUMAN/102-156------------------------------------------
TRAF4_HUMAN/210-269------------------------------------------

PF03145

Q7QF99_ANOGA/180-384PDFLKDGH.....CAKLALADALRFMADDKV.....LHYRVR
Q178N6_AEDAE/160-363ADFLKDGN.....CAKIPLEEAIRFMTKDKI.....LYYRIR
SINA_SCHMA/167-362VQSAIAVS.....DCLVFDSNTAHSFAENGN.....LGINVT
Q9LID2_ARATH/31-262HKTVRDSQ.....DGLIITRKLALFFSTDNNTTDKELKLKVS
SINAL_DROME/147-342FS.SFTNA.....DFLVLNKHTVELFSEDGN.....LALNVV
Q29HR3_DROPS/254-449RDILMDGT.....CVSIPLNELSRFVDPEKV.....LHYRVS
Q6Z6Z3_ORYSJ/102-301HKKVRDSF.....DGLIIHRNMALFFSGGNRQ...ELKLRVT
Q5JST9_HUMAN/77-273IAKAIKNR.....DCLIFDANTALLFAENDD.....LSINVV
A2WK44_ORYSI/189-377MKDAVQARVTVPDDMLLRQGDAVQVFVR...........KAT
SIA1B_MOUSE/82-278IATAIMNS.....DCLVFDTSIAQLFAENGN.....LGINVT

PF00917

O76641_CAEEL/14-126------------------------------------------
TRAF1_MOUSE/266-407------------------------------------------
MEP1A_RAT/439-598------------------------------------------
MEP1B_MOUSE/435-588------------------------------------------
MEP1B_HUMAN/434-587------------------------------------------
O76610_CAEEL/166-276------------------------------------------
TRAF6_MOUSE/365-509------------------------------------------
DG17_DICDI/327-450------------------------------------------
MEP1A_HUMAN/438-595------------------------------------------
O16551_CAEEL/14-125------------------------------------------
O17192_CAEEL/12-125------------------------------------------
O76611_CAEEL/30-142------------------------------------------
TRAF5_HUMAN/410-551------------------------------------------
O16553_CAEEL/149-261------------------------------------------
O16554_CAEEL/23-135------------------------------------------
O16555_CAEEL/11-123------------------------------------------
O16557_CAEEL/96-208------------------------------------------
O16558_CAEEL/149-261------------------------------------------
O16559_CAEEL/157-269------------------------------------------
O16560_CAEEL/140-252------------------------------------------
O16562_CAEEL/108-218------------------------------------------
O16567_CAEEL/26-139------------------------------------------
O16736_CAEEL/14-129------------------------------------------
O17190_CAEEL/289-402------------------------------------------
O17191_CAEEL/289-401------------------------------------------
O17193_CAEEL/11-126------------------------------------------
O17288_CAEEL/229-340------------------------------------------
O17297_CAEEL/14-127------------------------------------------
O17301_CAEEL/575-687------------------------------------------
O17303_CAEEL/12-125------------------------------------------
O44805_CAEEL/17-135------------------------------------------
O44815_CAEEL/14-128------------------------------------------
O44817_CAEEL/14-126------------------------------------------
O45623_CAEEL/38-168------------------------------------------
O76557_CAEEL/290-402------------------------------------------
O76558_CAEEL/284-397------------------------------------------
O76568_CAEEL/14-130------------------------------------------
O76642_CAEEL/14-126------------------------------------------
O80808_ARATH/122-240------------------------------------------
O81494_ARATH/85-212------------------------------------------
O81496_ARATH/65-169------------------------------------------
O81499_ARATH/78-210------------------------------------------
BAT39_CAEEL/57-173------------------------------------------
P91300_CAEEL/283-399------------------------------------------
P93826_ARATH/74-198------------------------------------------
TRAF3_HUMAN/422-562------------------------------------------
TRAF4_HUMAN/314-464------------------------------------------
BAT38_CAEEL/86-206------------------------------------------
MEL26_CAEEL/48-164------------------------------------------
TRAF2_MOUSE/358-498------------------------------------------
UBP15_YEAST/46-181------------------------------------------
BAT15_CAEEL/14-125------------------------------------------

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window