Sequence alignment for CL0393

PF11762

ARAA_GEOSE/359-473---------------------------------------------TRPRIEVHPLSIGGKE----DPARLVFDGGEGAAV
ARAA_ACIC1/362-476---------------------------------------------ATPRCEIHPLLMGGRE----DPVRLVFTADPAPAV
ARAA_GRAFK/361-475---------------------------------------------SKPTCEVHPLGIGGKE----DPVRLVFNSPKGKAL
ARAA_BIFAA/364-478---------------------------------------------AKPKLAIYPLGIGGKS----DPVRLVFSGKPADAV
ARAA_NOCSJ/362-476---------------------------------------------GRPSLEIHPLSIGGRE----DPVRLVFDAAPGPAV
A3XLT0_LEEBM/362-476---------------------------------------------AKPKCEVHPLGIGGKE----DPARLVFNSPEGPAI
A4BF95_9GAMM/379-493---------------------------------------------QKPVLDIQRHTIGCKA----DIARLIFSAKAGPSR
A4CJM8_ROBBH/360-474---------------------------------------------GKPLCEIHPLGIGGRE----DPVRLVFNSPAGPAI
A4L2Q5_LACRE/358-472---------------------------------------------DKPRVEVHPLDIGGKD----DPARLVFTGREGKAV
ARAA_AERS4/361-475---------------------------------------------DKPVLDAQHLGIGKKA----DPARLLFAAPAGKAV
ARAA_FLAJ1/361-475---------------------------------------------GKPSCEVHPLGIGGKE----DPARLVFNSPAGDAI
A6BF67_9FIRM/363-477---------------------------------------------GKISIKEQPLSMGNRE----DPARLVFTSKTGPAI
ARAA_CLOB8/353-467---------------------------------------------TKPVIEVHPLGIGGKE----DPARLVFKGASGPAV
A6NZR2_9FIRM/354-468---------------------------------------------KRPRIEVHPLGIGDRE----APARLVFEGHEGEAI
D1N4Y4_9BACT/360-474---------------------------------------------GKPSLEVHPLGIGGKA----DPARLVFTTAPGDAI
C0A479_9BACT/366-480---------------------------------------------AKPALEVHPLGIGGKD----DPVRLVFNAAAGDAL
A7V1C3_BACUN/362-475---------------------------------------------QKPKLEVHRLSIGIDS----ETARLVFTSKQGEGV
ARAA_YERPE/362-476---------------------------------------------EKPLLDVQHLGIGGKA----DPARLIFSTPAGPAL
ARAA_BACSU/358-472---------------------------------------------DQPKIEVHSLSIGGKE----DPARLVFNGISGSAI
ARAA_LEUMM/359-473---------------------------------------------DKPRVEVHPLGIGGKE----DPARLVFSGRTGDAV
Q08PR5_STIAD/362-476---------------------------------------------GKPSLEIHPLDIGGKA----DPCRLVFEAAAGPAV
ARAA_SHESR/360-474---------------------------------------------AKPRLEVHRHTIGVRC----DVPRLLFTGKAGPAI
ARAA_HERA2/361-475---------------------------------------------TKPRLEVHPLGIGGKA----DPVRMVFDAKTGPAV
ARAA_KORVE/360-474---------------------------------------------GKPSCEIHPLSIGGKG----DPVRLVFDSQTGPAV
ARAA_ECOUT/362-476---------------------------------------------EKPILDVQHLGIGGKD----DPARLIFNTQTGPAI
ARAA_SACD2/360-474---------------------------------------------EKPKVVVERHTIGIKK----DIARLIFTGTPGPAI
ARAA_LACSS/359-473---------------------------------------------DKPRVEVHPLDIGDKD----DPARLVFTGMQGDAV
Q3Y1E5_ENTFC/359-473---------------------------------------------TKPRIVVSPLSMGDRE----DPARLVFDGKAGEGV
ARAA_BACSK/352-466---------------------------------------------QKPEIVVAPLSMGNRE----DPARLVFKGKAGRAL
ARAA1_BACLD/354-468---------------------------------------------HKPRIEVHPLSMGAKD----DPARLVFDGIAGPAV
ARAA2_BACLD/359-473---------------------------------------------NKPKIIVSPLGIGDRE----DPARLVFDGKAGDGV
ARAA_MANSM/360-474---------------------------------------------NKPILDIKPLGIGGKE----DPARLIFTSKSGKAT
A6B489_VIBPA/361-475---------------------------------------------AKPRLEVHRHTIGCRC----DIPRLIFSGQSGEAL
ARAA_LACPL/359-473---------------------------------------------DKPRVEVHPLDIGGKD----DPARLVFTGSEGEAI
Q8RMB9_THENE/357-471---------------------------------------------EKPRIEVHPLSIGGKA----DPARLVFDGQEGPAV
ARAA1_CLOAB/359-473---------------------------------------------SKPRVVVKPLGIGDKE----APARLIFDGVVGDGV
ARAA_BACHD/359-473---------------------------------------------NQPEIQVHPLGIGGKE----DPARLVFDGADGPAL
ARAA_MYCSM/361-475---------------------------------------------QTPSLEVHPLGIGNRE----DPVRLRFTAAPGSGV

PF02952

Q9YAQ6_AERPE/306-428SRDSLLLAHCTAPF...............................SMGLRIQFRRHFITGG....SVTSSVWFPKGSKVT
A7V9H3_BACUN/291-409RTNEIILAHCTIGI...............................AQTEQFIIRNHFETES....GIGIQ.GILPTGDVT
FUCI_CLOPE/388-557KNGIIHLINSGASALDGTAAAKDKDGNKTMKEFWNMTNEDVQSCLKATDWCRANYEYFRGG....GFSSHFKTEAELPVT
A7AZV9_RUMGN/344-478QKDTFMGFHCGNTA........................SSKLSFCEMKYQMIMARALPEEV....TQGTLEGDIIPGDIT
Q8ZSU4_PYRAE/260-369GDDVLLLTHDGAPP................................SFGRYSIVPRMATRA....PAALRVEVPPGLPVT
A3MXQ0_PYRCJ/265-386RGELLLLTHDGLPP...............................SMAKAYSIVPRLATKA....PAAIRAEVEPGRPVT
B8FVE5_DESHD/316-443EQNQLIFWHCGNGP............................LSLAAPGTNPVAGVHPNRK....TPLAMYFPLKGGPVT
FUCI_ECOHS/384-554EHGIIHLINSGSAALDGSCKQRDSEGNPTMKPHWEISQQEADACLAATEWCPAIHEYFRGG....GYSSRFLTEGGVPFT
Q9WYE3_THEMA/329-473EYDVLDLCNSGNHATYFAARS.................FDPDENMKKVEFYPQTFYFPAGG......AAVKHIAAPGKVT
A8F6V5_THELT/331-465LENEVMLFHCGNFP......P.................SLYESV.EIRYADVIGTTVGNQN....AYGACAGKIKSGPFT
A5MG49_STRPN/382-551AAGFLHLINSGSCTLDGTGQA.TRDGKPVMKPFWELDESEVQAMLENTDFPPANREYFRGG....GFSTRFLTKGDMPVT
A1JJZ6_YERE8/337-471ERDKCVLFHCGNFA......S.................ESLESS.TMGTADIIGTTVGCEN....TCGAVHGRMKSGPLT
O59131_PYRHO/332-472DDDIVIIANCGASSLYYAKLS.................EDPYENLRSVTIQGQCQGKSGGA........FTYRTPPGEFT
A8F356_THELT/327-468QDDFFDLCNSGEHATFFAAKS.................YDPAVNLAKVELYPESFYFPAGG......ASVRHIAAPGEVT
A9BGR2_PETMO/327-471EENLLDLANSGQHATYFAGKS.................NKPEENLKNVIIHPEDFYFPAGG......GAVKHFAAPGRVT
FUCI_BACTN/385-555ANGIIHLINSGATTLDGSGQSLDAEGNPVMKEPWNLTDADVENCLKATTWYPADRDYFRGG....GFSSNFLSKGGMPVT
B8CWP4_HALOH/397-566QNGIIHLINSGSATLDGTGQQ.TKNGRPVMKPFWEISSEEVEACLEATSWRPAMLDYFRGG....GFSSNYLTKGGMPLT
D1N639_9BACT/395-564VPGMIHLINSGATTMDATGRQ.SADGKPAMKPFWEISADEAKACLDATSWVPANLGYFRGG....GFSSRFLTRGGMPVT
A7BC22_9ACTO/381-550AAGLLDLRNSGSTTLDGAGKA.VRDGENVIKPWYEVTEEDREATLAATTFHPASTGYFRGG....GFSTHFRTSGEMPVT
Q2NWL9_SODGM/385-555APGVIHLINSGSAALDGACRQRDAQGRPTIKPHWEITQQEAATCLAATEWCPAIHEYFRGG....GFSSRFLTLGGVPFT
Q1A689_9FIRM/391-563ADGVIHLINSGACCLDANAEARDAEGNQTMKPWYEVTKEDQDAIMAATTWCAADNGYFRGG....GFSSRFETTATMPAT
A4NCA7_HAEIF/383-553ESGFIHLINSGSAALDGTGEHQDAQGNPTLKPAWDVTEEEAKRCLENTRWCPAVHEYFRGG....GLSSQFLTKGGIPFT
Q9HH31_9EURY/348-488DDELVLIANCGASSLYYAKLS.................ENPEENLKETTIQGQCQGKSGGA........LTYRTPPTKLT
Q029Q0_SOLUE/336-470DPNKAVCFHCSNLP......K.................HFFKSV.KMDFQQIIAGTVGREN....TYGTCEGLVKASPMS
A4XJ56_CALS8/397-566QNGVIHLINSGSAALDGTGQQ.EIDGKPAIKPFWEITEEEVRKCLETTRFCYANLGYFRGG....GFSTKFVTRGGMPVT
A7VRA7_9CLOT/382-552AGGFIHLINSGAAALDATGASTDENGNHVMKKWYDMTDADIDGCLKATDWCHADLGYFRGG....GFSSHFKTQAEMPVT
A6KXB1_BACV8/338-473DRDKCVCTHCGNFP......K.................SFVMNDLKLGTLGVLGRTLGKVH....TFGAVYGKVKQGDFT
Q1AXS8_RUBXD/325-469DRDIWDLVNSGQHATWFAERS.................DDPAENLRRVHLYPEGFYFPAGG......ASVHHLAAPGEFT
Q6AA51_PROAC/149-317AGGFVDFRNSGASTLNATECEAEADGTPVIKHWWDLTEDDIQADLAATTFHSATQEYFPGG....GFSTHFTTVGDTTVT
A7VPY7_9CLOT/340-472EENCWLAWHCGNAA......P.................SQCACGCQQKLRLNERLSVWSDN....CDGSIEFNLAEGPVT
A6D1C2_9VIBR/377-547ESGFIHLVNSGSAALDGSGEAKDEQGKPVIKPHWDMTVEDAQQCLDATQWPPAISEYFRGG....GFSSNFLTHGDMPFT
Q9X048_THEMA/332-466DENETILFHCGNFP......A.................SIYEEKPEIKYADVIGTTVGKER....AYGACAGKIKTSPFT
A6NTH8_9FIRM/338-476LTDTFMAFHCGNTP......S.................CKMCADRAVKYQLIQNRLLENGGEPDFTRGTLEGDIAPGEIT
A7VW22_9CLOT/329-469DYDVMVFCNCGSQSTYYAAAS.................DDPRENLKKVTLYPCLDIYAGGG......CHVNLMTKPGKAT
A2BML0_HYPBU/301-421KGDKLMIAHCTAPI...............................AMGRRYTLHSHFESGL....GVGISIQLEPGTRVT
A9KRB9_CLOPH/341-477PTDTFMGFHCGNTP........................SKKLSSCSMKNQKIMARSLEPNQEPNITRGTLEGDIAPGEIT
A4F8A7_SACEN/325-469DRDIWDLCNSGQHATWFAARS.................DDPAENLAKVNFYPEVFFFPAGG......ASVQHIAAPGQMT
A8F6D0_THELT/336-469EEDKAIMFHCSNFP......V.................SFFESC.QMSYQDIIAGTVGKEN....TYGTCVGRVSPGPAT
A6T621_KLEP7/328-462DRDKCVLFHCGNFA......S.................ASLESP.HMGTADIIGTTVGKEN....TCGAVHGRMKSGALT
A6L705_BACV8/291-410DQNEIVMAHCTIAT...............................KMVDQFIIRNHFETET....GIAIQ.GILHPGGIT
Q0TS96_CLOP1/391-561SDGFIHLINSGAACLDACGQAKDENGNGTMKAWYDVTEEDQEAILAATTWNAADNGYFRGG....GYSSRFLTEAEMPVT
A3MU52_PYRCJ/250-367KGRQAAFAHCTISL...............................DMVKSWRTMPHFESGY....PHGLS.GELAEDIYT
A6VKQ1_ACTSZ/337-471DRDKCVMFHCGNYA......T.................DELINP.FMATADIIGTTVGCEN....TCGAINGRMKAGPLT
A5ZM40_9FIRM/332-467AEDKLILFHCGSCA......Q.................SLMTKKGTVTSHKMFDKG.DPGS....GWGTNEGRIRPFKTT
A7UXU1_BACUN/390-559ANGFIHLINSGSCTLDGTGCQ.TRDNKPVMKPFWEITEEEVEACLSVTKWHPASREYMRGG....GYSSQFLTRGEMPVT

PF11762

ARAA_GEOSE/359-473NASLIDLGHRFRLIVNEVDAVKPEHDMPKLPVARILWKPRPSLRDSAE----------------AWILAGGAHHTCFSFA
ARAA_ACIC1/362-476IVGLCDMGDRLRLVANTADLVAPPEPLPRLPVARAVWQPHPELKTAAT----------------AWIAAGGPHHTALSTA
ARAA_GRAFK/361-475NASLVDMGTRFRLIVNEVEAVEPEADLPNLPVARVLWDPKPDMDTAVT----------------AWILAGGAHHTVYTQA
ARAA_BIFAA/364-478VVSMADERERFRLLMDEVTIVEPQGSLKNLPCARAVWKPKPDLKTAVQ----------------CWITAGGSHHTCMTTS
ARAA_NOCSJ/362-476LLGLADLGERFRFVGNEVEVVAPTEPLPNLPVARAVWRPAPDLRTSTE----------------AWLMAGGPHHTVLSTA
A3XLT0_LEEBM/362-476NASLVDMGNRFRLIVNEVEAVKPEADLPHLPVARVLWDCKPNLDIAAT----------------SWIHAGGAHHTVYSQA
A4BF95_9GAMM/379-493NLTKIDMGDRFRFVLNELDTVDPTDTLPHLPVAHALWEPQPDLRTSAT----------------AWILAGGAHHSAYTQS
A4CJM8_ROBBH/360-474NTCLIDMGNRFRLVVNEVEAVAPLADLPKLPVARVLWDPKPDLETAAT----------------AWILAGGAHHTVYSQA
A4L2Q5_LACRE/358-472DVTLSYFNDGYRVIGYSVDCHKPEAETPHLPVAKQLWTPTVGLKEGAE----------------RWMHAGGGHHTILSFS
ARAA_AERS4/361-475NASLIDMGNRFRLVVNQLEVVDLPEAMPKLPVASALWKPLPSLQTSAE----------------AWILAGAAHHSVFTQS
ARAA_FLAJ1/361-475NVSLVDMGTRFRLIVNEVEAVKPMAELPKLPVARVLWDCKPNLEVAAT----------------AWILAGGAHHTVYSQS
A6BF67_9FIRM/363-477ATSLIDLGDRFRLIINDVDCKKTEKPMPKLPVATAFWTPQPNLKVGTE----------------AWILAGGAHHTAFSYD
ARAA_CLOB8/353-467AASLIDMGNRFRLIVNSVDCVEVTEDMPNLPVASVLWKPQPSLKEGAK----------------AWIMAGGAHHTSFSFY
A6NZR2_9FIRM/354-468VVSLVDMGGRFRLICQDIRCVKPIFPMPNLPVARVMWQPLPDLTTGVE----------------CWITAGGAHHTVLSYD
D1N4Y4_9BACT/360-474NATMVEFGADFRLVVNELEIVAPDAPLPKLPVASTVWIPKPDLAEGAR----------------RWIEAGGAHHSVNAPA
C0A479_9BACT/366-480NASLIDLGNHFRLIVNEVTAIKPPKPLPKLPVARAVWKCLPDFKTACA----------------AWIHAGGAHHTGFSYS
A7V1C3_BACUN/362-475AATIVDLGNRFRLIVNKVECIK.SKPLPKLPVASALWIPMPNLEVGAA----------------AWILAGGTHHTSFSYD
ARAA_YERPE/362-476NASLIDMGNRFRLLVNVVDTVEQPHPLPKLPVARAIWQAQPSLATAAE----------------AWIIAGGAHHTVFSQA
ARAA_BACSU/358-472QASIVDIGGRFRLVLNEVNGQEIEKDMPNLPVARVLWKPEPSLKTAAE----------------AWILAGGAHHTCLSYE
ARAA_LEUMM/359-473DVTISDFGDEFKLISYDVTGNKPEAETPYLPVAKQLWTPKAGLKAGAE----------------GWLTVGGGHHTTLSFS
Q08PR5_STIAD/362-476NATLVDMGGRMRMIVNELDVVQPGQTMPHLPVARAIWTPRPSFKESCE----------------AWILAGGAHHAGFSRA
ARAA_SHESR/360-474NVSTIDLGNRFRIILNELDTVTPPQDLPNLPVASALWEPRPNLAVAAA----------------AWIHAGGAHHSAYSQA
ARAA_HERA2/361-475NASIVEMGNRLRLINSVVDAVETDQPLPKLPVARALWLPQPDLKTAAA----------------AWIYAGGAHHTGFSFD
ARAA_KORVE/360-474VATIVDVGERFRMVINKVNVIPPEVPLPKLPVARAVWIPEPNLAVAAA----------------CWIYAGGAHHTGFSLC
ARAA_ECOUT/362-476VASLIDLGDRYRLLVNCIDTVKTPHSLPKLPVANALWKAQPDLPTASE----------------AWILAGGAHHTVFSHA
ARAA_SACD2/360-474NISTIDMGTRFRIIANEVDTVKPPQDLPNLPVAKALWEPRPSLEVAAA----------------AWIHAGGAHHSVYTQG
ARAA_LACSS/359-473DVTMADYGDEFKLMSYDVRGNKPEADTPHLPVAKQLWTPKQGLREGAV----------------GWLTVGGGHHTVLSFA
Q3Y1E5_ENTFC/359-473VVSMADFGTHYKLLINEVEAFEPTTEAPNLPVARVLWKTKPNFHEGVH----------------SWIQAGGGHHTVVSLN
ARAA_BACSK/352-466NAALIDMGSRFRLVANEVEAVENPHDMPKLPVASVLWKPLPSFSEATE----------------AWIYAGGAHHTVFSYE
ARAA1_BACLD/354-468NVSLIDLGGRFRLVINKVEAVKVPHDMPNLPVARVLWKPQPSLRTSAE----------------AWILAGGAHHTCLSYQ
ARAA2_BACLD/359-473VVSMADFGTHYKLLINEVSAFEPTVPAPNLPVARVLWEVKPNFQDGVK----------------AWLENGGGHHTVVSLF
ARAA_MANSM/360-474ASTIVDLGNRFRMITADMQAVDKPQDMPNLPVGHAFWKLEPNFDIGTQ----------------AWILSGGAHHNVFSLD
A6B489_VIBPA/361-475NVSIIDLGDRFRMIVNVIDTVTPPQSLPHLPVAHALWEPQPNLNIAAA----------------AWIHAGGAHHAVYSQA
ARAA_LACPL/359-473DVTVADFRDGFKMISYAVDANKPEAETPNLPVAKQLWTPKMGLKKGAL----------------EWMQAGGGHHTMLSFS
Q8RMB9_THENE/357-471NASIVDMGNRFRLVVNRVLSVPIERKMPKLPTARVLWKPLPDFKRATT----------------AWILAGGSHHTAFSTA
ARAA1_CLOAB/359-473VVSMLDLGTHYRLLINEVKAVKPTEDAPNLPVAKLVWQPQPNFKDAVK----------------AWIYAGGGHHTVATLE
ARAA_BACHD/359-473NASLIDLGHRFRLVVNEVEAIKPERDMPKLPVAKVLWKCKPSLSEATE----------------AWIHAGGAHHTVFSFE
ARAA_MYCSM/361-475VLGICDMGSRFRLVANHVTVVEPSAPLPNLPVACAVWEPEPSWSTSTE----------------AWLMAGGPHHTVLTTA

PF02952

Q9YAQ6_AERPE/306-428VSRL......DPGLEVLRVGVGIIEKGR..PEAEMQCES.....QMLVRMPGAA..........RILEESIGNHYVATLG
A7V9H3_BACUN/291-409IVKC...GSESLDEYYLSTGTLVEN.....TNYINMCRT.....QVRIKMNSPAD.........YFLKTPLGNHHIMLYG
FUCI_CLOPE/388-557LIRVNLIKGIGPT.LQIAEGYTCVIDED..IHQILDERTDKTWPTTWFAPNL.GE..CGFETVYDVMNHWGANHGAFVHG
A7AZV9_RUMGN/344-478FFRLQS.TADCKLRAYIAQGEVLPVPTR..SFGSIGIFAIPEMGRFYRH...............VLIEGNYPHHGAVAFG
Q8ZSU4_PYRAE/260-369LLRVS..SDLKKALLLKGVTIEAQRVEA..CSTQVAVRLLTGRGR...................DVLRAGLGNHLAYVLD
A3MXQ0_PYRCJ/265-386LLRVS..RDLRRALLLGGITAEAERVEA..CATQIAVRVTKGSPA...................AVYKAGLGNHLAFVFD
B8FVE5_DESHD/316-443VSRLSS.DHNGNLRLFLGSGTGIETDLL..YSGNSLPIQISGSVEETLD...............TILCEGIEHHYIVTYG
FUCI_ECOHS/384-554MTRVNIIKGLGPV.LQIAEGWSVELPKD..VHDILNKRTNSTWPTTWFAPRLTGK..GPFTDVYSVMANWGANHGVLTIG
Q9WYE3_THEMA/329-473LGRLT..REDGRYRFTVVPGEFVDFGEE..KNYEIADSIQNNWPHAFLKMETPID.........EFLAKYSSNHIHGVYG
A8F6V5_THELT/331-465FLRLSTEDINGSVKGYVGEGEILSQNPK..TFGSRGIAKISNL.DGLMN...............YICLEGFEHHVAINLS
A5MG49_STRPN/382-551MVRLNLLKGVGPV.LQIAEGYTLELPED..VHHTLDNRTDPGWPTTWFAPRLTGK..GAFKSVYDVMNNWGANHGAITYG
A1JJZ6_YERE8/337-471YFRLSSDDFTGQVRAYVGEGRSVSDELD..TVGCRAVVEVPQL.ESLLT...............HICNNGFEHHVAMNHS
O59131_PYRHO/332-472VARLI..RRDGKYYLLYFFAEGVEISEE..IENKL..KWGKQWPHTAIRNPLDKQ.........EFINVMGANHLSLIPG
A8F356_THELT/327-468LARLT..RKNGEYVMTVIKGEFLDFGEQ..KNEEKARNTQIEWPHAFAKLKISAD.........DFLATYSSNHIHGVYG
A9BGR2_PETMO/327-471LARLA..RQDGNYVMTIVPAEFVELSEE..EKKRLSEQVQIEWPHAYAKLDTDME.........TFLEYYPCNHTHGVYG
FUCI_BACTN/385-555MMRLNLIKGLGPV.LQIAEGWTVEIDPE..IHQKLNMRTDPTWPTTWFVPRLCDK..SAFKDVYSVMNNWGANHGAISYG
B8CWP4_HALOH/397-566MIRINIIKGLGPV.LQIAEGYSVDLPED..VHRILDQRTDPTWPTTWFAPILTGK..GAFKDVYSVMNRWGANHAAVSYG
D1N639_9BACT/395-564MSRINLVKGLGPV.LQIAEGYTYEPPKE..IHDQLDKRTDPGWPTTWFVPNLTGE..GAFKDVYSVMANWGANHGAFNYG
A7BC22_9ACTO/381-550MCRINLVRGLGPV.MQIAEGYTVELPDE..VAFTIEERTNIEWPTTWFVPNLTGE..GAFKSVYDVMNAWGANHGAISYG
Q2NWL9_SODGM/385-555LSRINLIRGLGPV.MQIAEGWSVDLPPA..IHKHLDNRTNATWPTTWFVPRLTDR..GPFKNVWSVMAHWGANHGVLTAG
Q1A689_9FIRM/391-563MVRLNLVKGLGPV.MQIAEGWTVGLPAD..VSDTLWKRTDYTWPSTWFAPRCDGKEGSAFKTAYEVMNNWGANHGAISYG
A4NCA7_HAEIF/383-553MHRINLIKGLGPV.LQIAEGWSIDLPQD..VHNKLNQRTNETWPTTWFVPRLTGK..GAFTDVYSVMANWGANHCVATHG
Q9HH31_9EURY/348-488VARLI..RKGGEYYLLYFLAEGVEITEE..IESKL..KWGKQWPHTAIRNPLDKE.........KFLNIMGANHLSAVPG
Q029Q0_SOLUE/336-470YARFSTNDLEGTIDGYVGEGEFTDDPLT..TFGGAGVVKIPNL.QRLLR...............FICENGFEHHVAANMS
A4XJ56_CALS8/397-566ISRLNIVKGLGPV.LQIAEGWTVELPPN..VHEILDRRTDPTWPTTWFVPKLTGK..GAFKSAYSVMENWGANHCAITYG
A7VRA7_9CLOT/382-552MVRLNLVEGLGPV.LQFAEGYTVTLPDE..VHKTLDMRTDPTWPTTWFAPKLTGK..GPFTDVYSVMANWGANHGAFVYG
A6KXB1_BACV8/338-473FFRISTDDTKGCIKSYLGKGDLTDDPYG..MDGCIAVTKVDNL.QPLMK...............YICKNGFEHHVAMCRG
Q1AXS8_RUBXD/325-469FARLT..RKGGRYRMHVLKGSFERYDEA..TNEELMRQSTYEWPHAFARFEAAAD.........EVLSRYGSNHIHAVPG
Q6AA51_PROAC/149-317AVRMNMVAGVGPT.LQIVEGRT..LPDE..GTDTIVERADPTWPTTFFVSRIPSS..GAFSSVYDWMDKWGANHTSTGYS
A7VPY7_9CLOT/340-472CLRLV..EYDGEYTMFIGTGEIVDIDPY..IRGTYGWVKVKDI.EAWEQ...............KMIDAGVVHHGVLIRD
A6D1C2_9VIBR/377-547MHRINLIKGVGPV.LQIAEGHSITLPEN..VHNTLNERTNPTWPTTWFVPRLTGT..GAFRDVYSVMANWGANHCVITHG
Q9X048_THEMA/332-466FLRLTTDDNEGKVKAYVGEGQILDENPK..TFGSRGVARIEKL.QELMK...............YICENGFEHHVAINLS
A6NTH8_9FIRM/338-476FYRLQC.DSEGVLRSYIAQGEVLPVATG..SFGGIGVFAIPEMGRFYRH...............VLLEKRYPHHGAVAFG
A7VW22_9CLOT/329-469IARLN..RTEGKYRMTIIPTEFVELPEE..K....MAETTKEWPHVFAKLPFDHQ.........IFLDRFDANHCHAVYG
A2BML0_HYPBU/301-421IARF......DPEFRVLRVGRGVVEESG..LLSRLHCRT.....QLWIRLDGNAE.........RIVEESIGNHYVVALG
A9KRB9_CLOPH/341-477FFRLQS.TADTVLRAYVAEGEVLPVPTQ..SFGSIGVFAIPEMKRFYRH...............VLVEKNYPHHGAVAFG
A4F8A7_SACEN/325-469LGRLT..REDGQYRLQLMLGEFESYDEA..TNKVLMDQSTPEWPHAFARLDAPGE.........VFLSKFGANHIHAIPG
A8F6D0_THELT/336-469FLRLSTFDNEGIIAGVIAEGRFTEDNVK..TFGGYGVVEIPNL.QSLLK...............TITQNGFEHHVAVSKS
A6T621_KLEP7/328-462YFRLSTDDLTGEIKAYVGEGQSVDDPLD..TVGCRAVIQVPHL.ENLLS...............WICRNGFEHHVAMNHS
A6L705_BACV8/291-410MIKC...AGECLDEYFVSTGQLIEN.....TNYINACRT.....QARIKLDKPVD.........YFMRNPLGNHHIILMG
Q0TS96_CLOP1/391-561MIRLNLVKGLGPV.VQLVEGYSVKLPDE..VSDKLWKRTDYTWPCTWFAPRLTGK..GAFKSAYDVMNNWGANHGAISHG
A3MU52_PYRCJ/250-367AVSLS......PRMDKIVIGVAKVLKSG..NFIERACRT.....QALVEIG.............DVAAKAPANHHVFIPG
A6VKQ1_ACTSZ/337-471YCRISTDEFTGKVKAYVGEGKFVDDDLD..TVGCRAVIQVKGL.EDLLA...............YICNNGFEHHVAMNHS
A5ZM40_9FIRM/332-467ISNCLTVD..GKIKIYASEAEFTDDPIEDAYFGCAGVCQIPNM.EDKMI...............RLARGGFKHHTCVGVG
A7UXU1_BACUN/390-559MCRLNLVKGQGPV.LQIAEGWTVNLDKD..VFKAINERTDRTWPSTFFAPRLTGK..GYFRDVYTVMNNWGANHGAISYG

PF11762

ARAA_GEOSE/359-473VTTEQLQDFA-EMAGIECVVI-
ARAA_ACIC1/362-476VSAREIRDFA-RMAGLELVLI-
ARAA_GRAFK/361-475LSTEFLEDFA-DIAGIELLVI-
ARAA_BIFAA/364-478VGREAWEDFA-RIAGVELAVI-
ARAA_NOCSJ/362-476LGAEHLDDLA-EMTGTELVLV-
A3XLT0_LEEBM/362-476VTTEFMEDFA-DIAGIELLVI-
A4BF95_9GAMM/379-493VTTEVLDIYA-DLVDVEMVTI-
A4CJM8_ROBBH/360-474LTTDFMEDFA-EIFGIELLVI-
A4L2Q5_LACRE/358-472LKPQQIKDLF-GMLDVKVDFI-
ARAA_AERS4/361-475VDIEQLRTFA-DIMGIEFVVI-
ARAA_FLAJ1/361-475ITTEYMEDFA-DIAGIELLVI-
A6BF67_9FIRM/363-477LTAEQMGDWA-ACMGIEAVYI-
ARAA_CLOB8/353-467VDEEQLLDWA-DMVGVECVVI-
A6NZR2_9FIRM/354-468VTAEQMRDWA-RMMDIEFVHI-
D1N4Y4_9BACT/360-474LTTEFMEDYA-RIAGVELVVI-
C0A479_9BACT/366-480VKTEHLEDLA-DLAGIELVVI-
A7V1C3_BACUN/362-475LTVEYWEDFA-EMAGIEMVVI-
ARAA_YERPE/362-476VGVDELRLYA-EMHGIEFLLI-
ARAA_BACSU/358-472LTAEQMLDWA-EMAGIESVLI-
ARAA_LEUMM/359-473VDSEQLTDLA-NLFGVTYVDI-
Q08PR5_STIAD/362-476VPPQVLEDFA-AMVGIEFIHI-
ARAA_SHESR/360-474ITTDQIVDFA-EMAGAELVII-
ARAA_HERA2/361-475LTSEHLADFA-EIAGMEYLQI-
ARAA_KORVE/360-474LTAQHLQDYA-EMAGIECVLI-
ARAA_ECOUT/362-476LNLNDMRQFA-EMHDIEITVI-
ARAA_SACD2/360-474INLDQLNDFA-EMAGVEMVVI-
ARAA_LACSS/359-473VDSEQLQDLS-HLFDLTYVNI-
Q3Y1E5_ENTFC/359-473LTTDQIETWA-KLVELETVVI-
ARAA_BACSK/352-466ISKEQLADWA-SLMGIECIVI-
ARAA1_BACLD/354-468LTAEQMLDWA-EMSGIEAVLI-
ARAA2_BACLD/359-473LTTDQMITYA-KLVDLEYVVI-
ARAA_MANSM/360-474IDADMLRTFA-EYFDIEFIHI-
A6B489_VIBPA/361-475VTLPMLADYA-EILGIEMVVI-
ARAA_LACPL/359-473LTEEQMEDYA-TMVGMTKAFL-
Q8RMB9_THENE/357-471VDVEYLIDWA-EALEIEYLVI-
ARAA1_CLOAB/359-473LTVEQVYDWS-RMVGLETIVI-
ARAA_BACHD/359-473VTPEQLYDWA-TLADIEVVFI-
ARAA_MYCSM/361-475VSPTTLDDFA-TITGTELLQI-

PF02952

Q9YAQ6_AERPE/306-428DSSEALRVAA.DILGLRLEVIS
A7V9H3_BACUN/291-409NYEDILE....EFLQANAC.KR
FUCI_CLOPE/388-557HIGSDLITLA.SMLRIPVT.LH
A7AZV9_RUMGN/344-478KWGKALFEVF.KYIGVDVSEIG
Q8ZSU4_PYRAE/260-369DVYEEAR.............LY
A3MXQ0_PYRCJ/265-386DVYEEVEAYL.RYLGASVV.TA
B8FVE5_DESHD/316-443DLTGEFREIA.ELLGLR...MI
FUCI_ECOHS/384-554HVGADFITLA.SMLRIPVC.MH
Q9WYE3_THEMA/329-473DYVEEIKTFC.EIASIDFVLMK
A8F6V5_THELT/331-465RIAKSIKEALERYMDIK.IYLH
A5MG49_STRPN/382-551HIGADLITLA.SMLRIPVN.MH
A1JJZ6_YERE8/337-471ATAKVLQEAFSKYLGVD.CYWH
O59131_PYRHO/332-472DYTQELEFVA.KIWGIEGVNLN
A8F356_THELT/327-468DYVEELVHFT.KLLGFN...MR
A9BGR2_PETMO/327-471NYIDELVHFC.KIKNIGYQILD
FUCI_BACTN/385-555HIGQDLITLA.SMLRIPVC.MH
B8CWP4_HALOH/397-566HIGGDLITLA.AMLRIPVA.MH
D1N639_9BACT/395-564HIGADLITMA.AMLRIPVC.MH
A7BC22_9ACTO/381-550HIGGQLITLA.SMLRIPVN.MH
Q2NWL9_SODGM/385-555HVGADLMTLA.AMLRIPVC.MH
Q1A689_9FIRM/391-563HIGADLITLC.SILRIPVA.MH
A4NCA7_HAEIF/383-553HMGADLITLA.SMLRIPVC.MH
Q9HH31_9EURY/348-488DFTEEIEFVA.RMWGIKAVNLR
Q029Q0_SOLUE/336-470NVASAVQEATDHYLGWN.VAIH
A4XJ56_CALS8/397-566HVGDLFITLA.TMLRIPVC.MH
A7VRA7_9CLOT/382-552HIGKDLITLA.SMLRIPVS.MH
A6KXB1_BACV8/338-473NVKDILAEAIETYLNWN.IYIH
Q1AXS8_RUBXD/325-469DRVQELRAVC.ELLDIDYDGFG
Q6AA51_PROAC/149-317HIGADVLTLA.AMLRIPVS.MH
A7VPY7_9CLOT/340-472PKAADALELFCKYAGIR..VVR
A6D1C2_9VIBR/377-547HIGADLITLA.SMLRIPVS.MH
Q9X048_THEMA/332-466RVADAVKEALEKYLGI..VVHK
A6NTH8_9FIRM/338-476HHGKALFETF.RLLGIG.DIAY
A7VW22_9CLOT/329-469DHVESLKMIC.QMLDIDVEILG
A2BML0_HYPBU/301-421DHVDALRAAA.SILGSS...LD
A9KRB9_CLOPH/341-477HFGKAIFEVF.KYFDVA..DIE
A4F8A7_SACEN/325-469DHRAALRAVT.EQLGIRLDEWT
A8F6D0_THELT/336-469NVGYIVQEALEKYLGWE..IIS
A6T621_KLEP7/328-462ASAAILHEAFTRYLGVS.TYLH
A6L705_BACV8/291-410DHEKVIH....EFMQLNSCKLV
Q0TS96_CLOP1/391-561HIGADIITLC.SILRIPVS.MH
A3MU52_PYRCJ/250-367DVTEEVKAVA.KLLKLEIV.EY
A6VKQ1_ACTSZ/337-471STAKVLNEAFNKYLGVE.SYYH
A5ZM40_9FIRM/332-467HMKDILKEAFTTYLGYEWVDID
A7UXU1_BACUN/390-559HIGADLITLA.SMLRIPVC.MH

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window