Sequence alignment for CL0409

PF00620

RHG05_MOUSE/1274-1425PLFVEKCV---EFI------------------------ED.TG..LCTEGL--------YRVSGNKTDQDNIQKQFDQDH
SYDE_DROME/968-1123PIVLRRCV---EEV------------------------ER.RG..LDIIGL--------YRLCGSATKKRLLREAFERNS
LRG1_YEAST/755-912PIIIDELI---SSL------------------------RQ.MD..MSVEGI--------FRKNGNIRRLRELTANIDSNP
P85B_MOUSE/125-265PPILVKLV---EAI------------------------EQ.AE..LDSECY--------SKPELPATRTDWSLS......
I5P2_MOUSE/830-972PKELWMMV---DYL------------------------YR.NA..VQQEDL--------FQQPGLRPEFDHIRDCLDTGM
RHG07_HUMAN/1092-1238PQSIQQAM---RYL------------------------RN.HC..LDQVGL--------FRKSGVKSRIQALRQ..MNEG
RHG28_HUMAN/399-552PLVLQKFF---EKV------------------------EE.SG..LESEGI--------FRLSGCTAKVKQYREELDAKF
ARAP2_HUMAN/1129-1281PIIVNSCI---AFV------------------------TQ.YG..LGCKYI--------YQKNGDPLHISELLESFKKDA
MYO9A_HUMAN/2076-2225PLVVEKLI---NYI------------------------EM.HG..LYTEGI--------YRKSGSTNKIKELRQGLDTDA
Q20442_CAEEL/896-1053PRPILEVM---KFL------------------------RN.IA..PETVGI--------FRKNGVKSRIAELRSIIESYS
RHG18_HUMAN/343-492PLIFQKLI---SRI------------------------EE.RG..LETEGL--------LRIPGAAIRIKNLCQELEAKF
ARAP1_HUMAN/971-1120PVIVYRCV---DYI------------------------TQ.CG..LTSEGI--------YRKCGQTSKTQRLLESLRQDA
PAC1_CAEEL/963-1123PMIVQACV---CVI------------------------ET.YG..MDTVGI--------YRIPGNTAAVNALKESLSNRG
Q9V4C2_DROME/875-1034PIFVNNCI---DYL------------------------ED.NG..LQQVGL--------FRVSTSKKRVKQLREEFDKDI
HMHA1_HUMAN/775-947PFIVKKCV---CEI------------------------ER.RA..LRTKGI--------YRVNGVKTRVEKLCQAFENGK
GMIP_HUMAN/565-728PFVVTKCT---AEI------------------------EH.RA..LDVQGI--------YRVSGSRVRVERLCQAFENGR
RHG32_HUMAN/386-538PQVLQSCT---AFI------------------------ER.YG...IVDGI--------YRLSGVASNIQRLRHEFDSEH
RG190_DROME/1364-1529PIFLNKCV---EFI------------------------EK.EG..LDSEGI--------YRVPGSRAHVDMLFQRFEEDT
RG92B_DROME/265-418SYIVELCC---CCL------------------------LE.HG..LEEEGL--------LRVGCASTKLRRMKHALEAQH
RGAP1_ARATH/155-296PLILVKCA---DYL------------------------IL.TG..LNSPNL--------FKAEGDRKLIQQLVSAYNQDP
BCR_HUMAN/1068-1221PYIVRQCV---EEI------------------------ER.RG..MEEVGI--------YRVSGVATDIQALKAAFDVNN
RHG21_HUMAN/1161-1314PLIVDICC---KLV------------------------EE.RG..LEYTGI--------YRVPGNNAAISSMQEELNKGM
RHG24_MOUSE/151-304PMLVEQCV---DFI------------------------RQ.RG..LKEEGL--------FRLPGQANLVKELQDAFDCGE
RHG17_RAT/266-415ALPIEACV---MLL------------------------LE.TG..MKEEGL--------FRIGAGASKLKKLKAALDCST
RHG20_HUMAN/377-527PKPVLDML---FFL------------------------NQ.KG..PLTKGI--------FRQSANVKSCRELKEKLNSGV
RBP1_RAT/210-356PAVFRECV---DYM------------------------EK.HG..MKCEGI--------YRVSGIKSKVDELKAAYDREE
CHIN_MOUSE/282-436PMVVDMCI---REI------------------------ES.RG..LNSEGL--------YRVSGFSDLIEDVKMAFDRDG
RHG09_HUMAN/556-726PSFLRLCI---AAV------------------------DK.RG..LDVDGI--------YRVSGNLAVVQKLRFLVDRER
FNBP2_HUMAN/505-657PLVVESCI---RFI------------------------SR.HG..LQHEGI--------FRVSGSQVEVNDIKNAFERGE
Q9VDE9_DROME/1154-1302PWIQTTLS---EHV------------------------LLLNG..KQTEGI--------FRVSADVDEVGCMKNRLDRWD
RRC1_CAEEL/294-443PVIVEKCC---ASI------------------------ED.QG...IVTGI--------YRQCGIQSNIQRLRAKFDSGA
RHG35_RAT/1262-1413PIFIERCI---EYI------------------------EA.TG..LSTEGI--------YRVSGNKSEMESLQRQFDQDH
RHG39_HUMAN/909-1055PWVQTRLS---EEV------------------------LALNG..DQTEGI--------FRVPGDIDEVNALKLQVDQWK
Q9W4A9_DROME/319-473PFVVRRCV---EEV------------------------EA.RG..MLQEGI--------YRVSGFADEIEALKLALDREG
Q8MSA6_DROME/346-502PFIIGACI---REV------------------------ER.RG..MLEVGC--------YRVSGSASDLAKLKKAFESDA
RGA3_SCHPO/794-942PQVIAMCV---SCV------------------------DA.HG..LEVEGI--------YRISGSASQVRVLVDEFENGS
RGA4_SCHPO/761-910PTLIVSCI---NFI------------------------ES.YG..MDFEGL--------YRKSGATSQMKKIVALLRNED
MYO9B_RAT/1673-1822PIVLEKLL---EHV------------------------EM.HG..LYTEGL--------YRKSGAANRTRELRQALQTDP
RGA1_YEAST/805-985PMILSVCI---DFI------------------------ES.DEENMRSEGI--------YRKSGSQLVIEEIEKQFSAWK
Q9P8F2_ZYGRO/832-1008PMIVTVCV---SHI------------------------ES.NENYMKAEGI--------YRKSGSQLLIEDIEKAFADCY
RGA2_YEAST/802-985PIIIRCCI---DRI------------------------EK.DDIGLNMEGL--------YRKSGSQTLVEEIENEFAQNN
Q8R1F4_MOUSE/140-291PKFVKLCI---EHV------------------------EE.HG..LDVDGI--------YRVSGNLAVIQKLRFAVNHDE
TG325_CAEEL/624-775PKFIRVIT---EVI------------------------ES.KG..LETDGI--------YRVSGNLSAVQKIRCQADQDN
Q9VWL9_DROME/292-441PRFVVDVC---AYI------------------------EQPEC..IEQDGL--------YRASGNKVLVDELRKKLTHVY
CDGAP_DROME/438-593PMVLRSCA---EFI------------------------EN.YG...VIDGI--------YRLSGITSNIQRLRRAFDEER
O13384_COCHE/545-692PIIVYQCI---QAV------------------------DL.YG..LEVEGI--------YRIPGTSSHIQQMKALFDS..
RGA7_SCHPO/520-671PNIVMQCT---SQV------------------------EN.FG..LNLQGI--------YRVPSSSARVNMLRSQFENNP
Q95TR0_DROME/586-741PHLVEVCT---NIV------------------------ET.KG..LGVVGI--------YRIPGNKAAISELSELVNTKD
RGD1_YEAST/486-644PAIVRQCI---YVI------------------------DK.FG..LDQEGI--------YRKSANVLDVSKLKEEIDKDP
BEM2_YEAST/1981-2141PTIVVKLL---EEI------------------------EL.RG..LDEVGL--------YRIPGSIGSINALKNAFDEEG
ARAP3_HUMAN/920-1071PIIVDACI---SFV------------------------TQ.HG..LRLEGV--------YRKGGARARSLRLLAEFRRDA
Q8T3K2_DROME/784-935PVIVDKCI---NFV------------------------YI.HG..SMSEGI--------YRKSGSENSMHKLMSAFRADA
O60432_HUMAN/255-431PLIIQKCV---GQI------------------------ER.RG..LRVVGL--------YRLCGSAAVKKELRDAFERDS
Q9N9Z9_DROME/395-545PALIVHCV---NEI------------------------EA.RG..LTEVGL--------YRLSSSEREYKALKEQFLRGK
Q9BZ74_HUMAN/363-512PRIVVHCV---NEI------------------------EQ.RG..LTETGL--------YRILGCDSTVK.LKEKFLRVK
Q95VR1_9HYME/3-152PPLIIHCI---NAV------------------------EL.RG..MTELGL--------YRLSGNKDRYEFLIQQFLKND
Q9XUS9_CAEEL/437-588PAAVIHCV---VAL------------------------EA.RG..LTQEGI--------YRVPGQVRTVNVLLDELRSKT
O00886_DICDI/28-181PKIVAQVI---EWL------------------------DKFNA..VNEEGI--------FRIPGNGVTIQEIKKSFDEGK
RHG01_HUMAN/260-408PIVLRETV---AYL------------------------QA.HA..LTTEGI--------FRRSANTQVVREVQQKYNMGL
RHG08_MOUSE/210-360PPVLRWTV---TYL------------------------RE.KG..LRTEGL--------FRRSASAQTVRQVQRLYDQGK
RG68F_DROME/292-439PPIVRKCV---DSL------------------------SITGV..IDTEGI--------FRRSGNHSEIMALKERVNRGE
Q23130_CAEEL/263-421PPIVDQLI---EYL------------------------EA.HA..LTMEGV--------FRKSANIGSIKRLQDRINKGE
FA13B_MOUSE/39-190PFIVRHVV---DYI------------------------EE.HG.GLEQQGL--------FQVNGNAETVEWLRQRYDSGE
Q8VHL8_MOUSE/532-684PLVVESCI---RFI------------------------NL.NG..LQHEGI--------FRVSGAQARISEIRDAFERGE
Q19370_CAEEL/541-693PLLVQSAI---AYL------------------------SR.YS..LRNQGL--------FRVSGSQSEINRFREAYERGE
O82458_LOTJA/159-296PTILLLMQ---RHL------------------------YA.RG.GLQAEGI--------FRINAENSQEELVREQLNRGV
O01443_CAEEL/529-695PKIVENCT---QYL------------------------MT.YG..LTQVGL--------FRVAGNTKRCRQLRNALEKVG
RHG06_HUMAN/411-572PRLVDSCC---QHL------------------------EK.HG..LQTVGI--------FRVGSSKKRVRQLREEFDRGI
Q8SY28_DROME/579-731PLAVRAAF---RWL------------------------QL.NA..LDQVGI--------FRKSGGKSRIMKLREQIEVTD
Q8T0G4_DROME/380-537PLFLEKLI---GEL------------------------LR.RG..SREEGL--------LRIGGHKQKTELLYNELESTF
RGA1_SCHPO/862-1019PAFIGNTL---AAM------------------------KR.KD..MSVVGV--------FRKNGNIRRLKELSDMLDVSP
TAGAP_HUMAN/101-250PRPIQDIL---TIL------------------------CL.KG..PSTEGI--------FRRAANEKARKELKEELNSGD
Q9DAP3_MOUSE/308-455PAPVLDML---SII------------------------DA.KG..PDTERI--------FRTLANKPYLT.LREKLDSAE
Q9XW53_CAEEL/264-412PQPIMTIV---DHL------------------------RM.DG..FDAEGI--------FRKSPKQSTFKELKCELDKGV
BEM3_YEAST/927-1096PSVVYRCL---EYL------------------------YKNRG..IQEEGI--------FRLSGSSTVIKTLQERFDKEY
RGA2_SCHPO/1083-1234PIVVYRCI---EYL------------------------ESCRA..EKEEGI--------YRLSGSASTIKHLKEQFNEGV
Q8RWQ4_ARATH/176-325PSFLEKAL---QFI------------------------EK.YG..TKIEGI--------LRQSADVEEVERRVQEYEQGK
YIL2_SCHPO/178-325PPDALVEG---MQV------------------------VS.KS..LQTEGL--------FRKSCSRKHLDIVIELYDNGC
RGA6_SCHPO/332-510PHIFAQCV---HFL------------------------SL.NA..LHVPGI--------FRISGSGPVIKAITEYFYSPP
RGA5_SCHPO/68-226PAVVAKCG---FFL------------------------KQ.NA..TQVKGI--------FRVNGSSKRIQILQKAFSTGP
BAG7_YEAST/76-235PVVIAKSG---KYL------------------------KE.NA..LDTTGI--------FRIAGSNKRVRELQAVFSKPP
P85AA_XENLA/128-280PPVLIKLI---EAI------------------------EK.KG..LESATL--------YR.SQSSSSLTELRQILECDA
OCRL_HUMAN/735-875PKEIWLLV---DHL------------------------FK.YA..CHQEDL--------FQTPGMQEELQQIIDCLDTSI
Q8STW6_ENCCU/162-313SPVVFSVV---KSL------------------------KK.RA..IRTKFI--------FRYEPDKLAAAKIANKIHENT
Q8SRX9_ENCCU/91-256PRNFYILT---ETV------------------------LS.LD..CRVGGI--------FRVRNSITTIKECVKAINSCV
O96601_PLAFA/109-259PSILIDFL---THL------------------------KK.PE.IINTKDL--------FNLQADAATLYGIVGDIEYGE
Q9VUR5_DROME/55-207PGPLLVLI---LKL------------------------NK.ES..PNRRDV--------FRAPGHQGAMKKLIHFLQAGR

PF08101

Q0TZ65_PHANO/41-476KEVAPEDI---QEL------------------------IHGCTQEMKSRGMHM...........................
A5DN67_PICGU/33-435DEFSRRNL---KTI------------------------LHLITGELKSRGTKTPHVFLPFRSRIDDHQLELFLQASFPGG
Q7SG59_NEUCR/43-514TSVDPEEV---VEL------------------------IILSTEELKSRALDIPFFLLPFRPTSDPSAVRTFVRHFFDKQ
Q0CXG4_ASPTN/42-520TEVAPEEV---HEL------------------------LRGCTQELKARALHTPFLLLPFRPSSDASAARTFVRNYFSQS
Q2HFE8_CHAGB/40-505KTIDPEEV---QQL------------------------LRFCTEELKARALDLPFLLLPFRPTSDPSAVRTFVRHFFDGK
Q6FSL9_CANGA/50-452HKFSRGNV---RGV------------------------IHLITAELKERGTDVEYLMIPLRPEQTNEKLLSFLNQIFPLG
A6ZP33_YEAS7/67-473HQFSREKV---KGV------------------------IHVITAELKEKGPDVEFLMIPFRPEQTNDKLLTLLNQLFPLG
A7ELT0_SCLS1/44-518TTVEPEEI---QEL------------------------VRGCTVELKSRALDMPFLLLPFRPTSDPSAARTFIRNFFDKR
A7TPE0_VANPO/50-442EKFEFEEV---HDV------------------------IHFLSSELKSREFDRTLLLEPLNSD.NTDNLNDFLTGIFKLN
A7TL24_VANPO/23-432HEFSREKV---KII------------------------VHIITDELKTNGVNVEYLFLPFRPEQTNEKLLKLLNKLFPLG
Q59KA9_CANAL/47-455AQFTRKNL---KSA------------------------LHIITQELKKRGTKTPHIFLPFRSKVNDEKLESFLSSIAPSG
A3LX57_PICST/32-439EQFSKRKL---KSI------------------------LHLITAELKARGTNVPHILLPFRSKINDSKLEQFLEQLFPNG
A6R3W6_AJECN/42-521TEVTPDEV---QEL------------------------LHGCTVELKSRGLEIPFLLLPFRPSSDPSSARTFIRHYFIPP
Q75ED0_ASHGO/35-426QAFAAESV---KGV------------------------VHMITLQLKAEGVADSYVLLPFRPEHANRKLLAFLNAVFPLG
A5DVE6_LODEL/31-437DYYSRKDL---KTA------------------------LHIITQELKKRGTKTPHIFLPFRSRVDDRKLNHFLTKLAPKG
Q6CUF4_KLULA/45-447HEFQREKV---RSL------------------------IHLITNELKLNGFETEYLFLPFRPEQTNEKLLSFLNSIFPLG
MUG8_SCHPO/44-440LEMNSKNV---LYR------------------------LTIGTN.................PDRNWEAI.AFIREFFDSA
Q6C001_YARLI/164-665AVVPRPLV---HDL------------------------VHVITGEIKARGILTPYLLLPFRPDSDPDAVPALVNHIFPKN
Q75EK6_ASHGO/152-598QLGTGSNS---TDM------------------------IRAAMEIFKPN........LSHYSFSETQQIRQLLASFFPRA

PF00616

RASL1_MOUSE/321-510-FLDYLTR...REV........................AR.TND..PNTLF--------.R..SNSLASK.SMEQFMKL.
Q75DK0_ASHGO/576-771-WFQALIE...KELAKFDKSI.........LTNNQNSAPS.THI..YNSLF--------.R..GNSILSK.SIEKYFNR.
Q757I8_ASHGO/1558-1726-IVIELII...DEI........................SR.ATR..YMDVL--------.R..RNSCATR.SLSMFSRL.
RGAA_DICDI/239-445-LYRLSIQ...KEM........................AN.IAT..VGDFL--------.K..ADTVVPK.MIITYNKR.
A5DN39_PICGU/903-1097-FITELMK...VEV........................GA.CRN..LSDLT--------KP..QCCLWID.FLHNFNNH.
GAPD1_MOUSE/152-353-VLRYLIE...FEL........................KE.SDN..PRRLL--------RR..GTCAFSI.LFKLFSEG.
GAP2_DROME/495-668-FLTDVVA...LDL........................LR.VGD..QRLTF--------.R..GNSLATK.SMEAFLKL.
Q0URT8_PHANO/796-948-FVRDMGN...NAK............................LE..ANLLF--------.R..GNTLLTK.SLDLHMKR.
A5DR10_PICGU/619-844-WFKALME...MELVNVDMATRK.....NYAKKSGSKSSS.NNV..FNTLF--------.R..GSSIFSK.SLENYNLR.
Q6BPM2_DEBHA/608-836-SVDKMTR...KNYASNRRSRDN......RAQTNNNSSSS.NNV..FNTLF--------.R..GLSIFSK.SLEMYNLR.
A3GHY3_PICST/1310-1472-LFKVLLY...DEV........................NT.VSR..STDIF--------.R..RNSVLTR.LLSNYARD.
Q0V6E4_PHANO/854-1062-VLARSMK...EEI........................EG.CGT..LQEFL--------.R..GNFFWAK.LFGNYVRS.
Q6CFR5_YARLI/832-1039-LISRSAA...AHI........................ST.LDA..SKNMV--------.R..DKHMWQR.LFAALNRG.
IQGA2_MOUSE/938-1150-LFKTALE...EEI........................KSKVDQ..VQDIV--------.T..GNPTVIK.MVVSFNRG.
A5E5Z0_LODEL/955-1161-FILTLMQ...NDI........................VQ.SQT..LSDIT--------KV..HFTYWIE.YLAHFNSR.
Q5AH02_CANAL/977-1177-LMIQLMQ...NDT........................AN.SNN..LGDIT--------KL..HLTNWID.FFTNFNNH.
A3LY27_PICST/921-1130-LISELMK...NDV........................ENNSRS..ISDLT--------KT..STTFWID.YFLLFNNH.
A6ZW14_YEAS7/881-1068-FVCEMLQ...NAI........................NE.APS..IESFL--------DN..RSQFWQT.ILQDFLRR.
A7TK28_VANPO/900-1076-FVAELLH...QNM........................VD.SHS..ITNFM--------NN..NTHFWQK.LIKLFIQR.
Q6FSF6_CANGA/864-1037-LVSELLQ...QDI........................QE.CTS..VGEFM--------AF..SSPSWKL.LLDEFIEK.
Q6CR01_KLULA/879-1073-VIGDLLV...EEI........................DE.SST..LNDFL--------VN..DDAVWIQ.VLQNYLTS.
A7RYQ9_NEMVE/151-314-LMKSLIE...LQI........................LK.SDK..PQEFF--------.RSPRNWSFTI.IFSVLIES.
Q1PQE2_DROMI/101-305-LLRELIE...IQL........................LG.SEQ..PRRLL--------RT..NSSSFAR.LYQRLVES.
RME6_CAEEL/161-355-VVCNLLK...LQL........................YRSGSE..MRTIL--------RK..ETSISTR.FYKHFVEL.
Q54F48_DICDI/1131-1337-TIKSITE...IEF........................RISSDK..RNFGI--------....HEPFSFT.LLSTYLNY.
Q869U6_DICDI/119-289-ILRYFIY...TDI........................KE.D....VNNIN--------.R..NYSFSSL.LISNYLEK.
A2G1P2_TRIVA/157-304-SLIQLLV...LQI........................KQ.SET..VNSVS--------FR...TSFIRE.IIRQFMHT.
Q9XVW6_CAEEL/11-201-LVPQLFATQDIDEEF....................THENVWKD..PNDPT--------SG..ESPPASKRLLSVRNQVQ
Q6BG44_PARTE/169-435-LLSELLK...LEL........................ID.LKN..PLELF--------QD..KNNLVCK.FLIGFSKG.
RASL2_HUMAN/323-512-FLDLLFQ...LEL........................SR.TSE..TNTLF--------.R..SNSLASK.SMESFLKV.
A2CE77_DANRE/319-508-FLDVLFK...LEL........................DK.TTE..PNTLF--------.R..SNSLASK.SMESFLKV.
Q66JF5_XENTR/327-516-FLDKLNQ...REV........................KR.TVD..PNTLF--------.R..SNSLASK.SMEQYMKI.
Q4T1V0_TETNG/259-481-FLDYLNT...REV........................QH.TTD..PNTLF--------.R..SNSLASK.AMEQFMKVS
RASA3_RAT/351-524-FISAIAS...AEV........................KR.TQD..PNTIF--------.R..GNSLTSK.CIDETMKL.
RASA2_HUMAN/377-550-FATAVAE...LDL........................KD.TQD..ANTIF--------.R..GNSLATR.CLDEMMKI.
A7RYE3_NEMVE/344-517-FIKAVVD...HEV........................NT.TAD..CNTLF--------.R..GNSLGTK.AIDEFMKH.
Q0C7B1_AEDAE/426-599-MIKALAD...HEI........................SK.LTD..PTTIF--------.R..GNTLVSK.MMDEAMRL.
NGAP_DICDI/596-769-LLKSLTD...HEI........................DS.TNN..PDIIF--------.R..GNSLATK.SVDLFMKL.
A7SJB4_NEMVE/409-582-LLKTMNA...REI........................EK.QDE..QATLF--------.R..GASLATS.LMDQYMKM.
Q4RUN4_TETNG/812-985-LLRTLND...REI........................NM.EDE..ATTLF--------.R..ATTLAST.LMEQYMKA.
Q17P86_AEDAE/660-835-LLRILCQ...AEV........................AR.ENE..TTTLF--------.R..GASLATT.LMDLYMRA.
Q4TC99_TETNG/266-437-FLTDLMM...SEV........................DR.CRD.NDQLIF--------.R..ENTLATK.SIEEYLKL.
Q4TB25_TETNG/371-543-FLTDLVM...SEV........................DR.CAD.HDVLIF--------.R..ENTLAAK.AIEEYLKL.
Q4SJ24_TETNG/320-491-FLSDMAM...CEV........................DR.FMD.REHLIF--------.R..ENTLATK.AVEEYLKL.
Q6KAS9_MOUSE/518-689-LVTDLGT...AEL........................AR.CGG.REALLF--------.R..ENTLATK.AIDEYMKL.
A6ZJ45_CAEEL/167-340-FLCDLIM...KEV........................EK.LDN..DHLMF--------.R..GNTLATK.AMESFMKL.
A8XP25_CAEBR/203-376-YLADLVM...AEI........................GK.LDN..DNLMF--------.R..GNTVATK.SMESFMKL.
A7SKG2_NEMVE/244-412-FLVDIVM...DEV........................NR.LGSADENLVF--------.R..GNSFATK.AMDTYMKM.
Q0CSQ0_ASPTN/793-964-L...VRD...MGR........................TA.TVE..ANLLF--------.R..GNSLLTK.ALDYHMRR.
Q2GTK6_CHAGB/605-776-V...VRD...LGK........................SL.QGE..ANLLF--------.R..GNSLLTQ.ALEFHMRR.
Q7RW81_NEUCR/919-1092-T...VQD...MSR........................TL.PGE..ASLLF--------.R..GNSLLTQ.AFEIYMRR.
Q6C802_YARLI/650-829-LADKVTA...NDR........................SK.QV...SNLLF--------.R..GNTLMTK.AIEKYMQL.
A3LZE1_PICST/612-848-WFKALME...AELVNVDILTRKLYKKKNSDHKEAQTSAS.NNA..FNTLF--------.R..GSSIFSK.SLERYNLR.
Q5A506_CANAL/642-872-AVSNSKT...QQQ........................SSHNNV..FNTLF--------.R..GSSIFSK.SLEKYNLR.
A5E274_LODEL/753-994-FFKTLME...MSLSSLGNK...........LATQSKSTSQNNV..FNTLF--------.R..GSSIFSK.ALERYNIR.
Q6FNM9_CANGA/542-738-WCTILIN...KELEDFSKQSG........SRPGIDGQYM.PSR..VNSLF--------.R..GNSILTK.TLELYFLR.
BUD2_YEAST/541-721-TVSRINQ...KNL........................DS.KHV..FNSLF--------.R..GNSILTK.SIEQYFFR.
Q6CW67_KLULA/546-743-WFQALID...REFQGLDKSI.........TMSNSNHQSS.NHI..YNTLF--------.R..GNSILTK.TMETYCYR.
Q4P4C4_USTMA/677-887-RISHFIE...LESA.....................SWGE.KME..PELLF--------.R..ANTLLSR.SIDHFQRL.
Q8SSU4_DICDI/586-757-LLKSFIK...KEV........................SQ.CHD..PGTLF--------.R..SNSVAMK.MVVAYGLK.
Q55CR5_DICDI/1772-1943-IIHSGIE...QEV........................LS.TAN..PSTLF--------.R..SNTTATK.LMTAFTKL.
Q54RT3_DICDI/342-510-IIKLGIT...KEV........................QS.TSS..AQTLF--------.R..GNSTATK.LMTAFTRM.
Q54Q13_DICDI/104-276-ILKWAID...KEI........................EN.TSN..SATLF--------.R..GLSTATR.LISAFYKR.
NF1_RAT/1258-1432-LLWNMFS...KEV........................EL.ADS..MQTLF--------.R..GNSLASK.IMTFCFKV.
Q8IMS2_DROME/1300-1475-LLWNMFY...REV........................EV.SDC..MQTLF--------.R..GNSLGSK.IMAFCFKI.
Q54T13_DICDI/179-351-IVRDLAS...IEI........................EQ.TND..AKVLF--------.R..TDSLSTK.VIVSIFKT.
NFAA_DICDI/68-259-LIKDLIY...NEFN.....................TKVL.AEG..EGSIL--------.R..GNSIVNK.IEGAYVRL.
Q6FJ13_CANGA/1767-1935-LVTQLIK...DEI........................DR.ASR..YADVL--------.R..RNSCATR.ALSLYARS.
IRA1_YEAST/1730-1898-LVTELLK...QEI........................KR.AAR..SDDIL--------.R..RNSCATR.ALSLYTRS.
A7TN87_VANPO/1674-1842-LITQLVK...DEI........................QD.SIR..HMDIL--------.R..RNSVATR.ALSLYSRS.
Q6CMT2_KLULA/1529-1697-IVTELVR...EEI........................GN.ATR..HMEIL--------.R..RNSCATR.ALSMLARL.
IRA2_YEAST/1722-1890-VVAQLIK...NEI........................EK.SSR..PTDIL--------.R..RNSCATR.SLSMLARS.
Q6FQA1_CANGA/1674-1842-AVSQLID...AEI........................EQ.STR..STDIL--------.R..RNSVATR.ALSMLARL.
A7TEG6_VANPO/1672-1840-MVNEMLR...DDI........................RK.TSR..PTNIL--------.R..RNNCVTS.ALSIYTRK.
A5E1X9_LODEL/1368-1531-LFKELLC...DEI........................SN.LTR..ASDLF--------.R..RNSTLTR.LLFNITQE.
Q5A3W3_CANAL/1300-1463-LFNVLLN...TEV........................AL.SSR..STDLF--------.R..RNSTLTK.FLSFYAQT.
Q8WZX6_NEUCS/1323-1495-LLEALIK...QEI........................EE.TEN..ESELL--------.R..RSCVATK.MLSIYAKW.
A6SKM1_BOTFB/602-772-TISLL.....NIF........................DS.REN..EAELL--------.R..RNCVATK.LLSVYAKW.
Q4PF31_USTMA/1621-1793-FLKAAVE...EEI........................QR.TAT..EEMVF--------.R..SNSFCTT.LLSTFART.
Q5KFG6_CRYNJ/1321-1493-LMRVLIE...REV........................TM.TNH..ESELF--------.R..ANSITMR.MITIFAKT.
A2E9Q3_TRIVA/1023-1197-LMDFMIK...MEL........................KS.AHEASKNAIF--------.R..GNGVASR.AVGHFPRL.
A2FFI6_TRIVA/1018-1191-FVDYMIT...LEL........................KG.IQDATKNSIF--------.R..GNGIPSR.LVSYFPKL.
A2GF60_TRIVA/1036-1210-YFARMVD...VEL........................QP.IDDSNKNTIF--------.R..GNQVPAR.AVGHWPRF.
A2DLG7_TRIVA/987-1164-FINFMTD...LEL........................EK.TSEVNKNTIL--------.R..GNAVPSR.SIISFSKI.
A2FB27_TRIVA/1019-1186-TIVYATE...EEL.............................N..RTTLF--------.R..GNGTPSK.VFSAYIQM.
Q4DY44_TRYCC/96-330-ILSVLLL...LELD.....................RATH.KRN..DVHTF--------MR..GNGVVPKVFEALLARVT
A2DU37_TRIVA/325-480-LVSFISF...DEI........................SQ.TSD..PNLIL--------.R..SNSICTH.FLKVYYKR.
A2EAY4_TRIVA/330-471-LLVTLAG...IEF........................SA.PEL..QHNTV--------LR..GNSHLTN.MFKIFFQK.
A2G2R5_TRIVA/334-477-FICTVVS...SEF........................SHPGDL..TETMV--------LR..GNSHLTC.LFKYFASK.
Q86JJ7_DICDI/392-554-LLIMMVQ...SDL........................PN.ISM..TGTFL--------.P..YDIVSCE.FIEEIANL.
A2R7H8_ASPNC/194-402-MFQSVLT...YQF........................DN.TPE..YSSLL--------.R..QNTPVSR.MMTTYTRR.
Q7S5G6_NEUCR/166-375-MFQSVLT...YQF........................DN.TPE..YSSLL--------.R..ANTPVSR.MMTTYTRR.
Q6DNA0_SCHCO/171-379-MFQSVLS...AQF........................ET.ATE..FGSLL--------.R..ANTPVSR.MMTTYTRR.
Q54I64_DICDI/185-392-MFQKVLQ...EEF........................KE.ATS..IGSLL--------.R..ANTALTR.MMTTYTRR.
A7S5U4_NEMVE/139-338-MFELALK...YEF........................AE.SEN..FNSLL--------.R..ANTAISR.MMTTYTRR.
GAP1_SCHPO/175-379-LFQMVLT...TEF........................EA.TSD..VLSLL--------.R..ANTPVSR.MLTTYTRR.
GAPA_DICDI/274-481-LFRLAIG...QEM........................SR.IKS..AGDLL--------.A..VESVVPK.MIITYTRR.
Q7SFX8_NEUCR/1171-1379-LISRSIR...EEV........................EA.CAA..LQDYL--------.R..GNYFWTK.LLQNYTRS.
A7F2A6_SCLS1/1177-1385-LIARSAR...EEI........................EH.FAS..LQDFL--------.R..GNFFWTK.LLANYTRS.
A2QP50_ASPNC/1125-1333-LLARSAR...EEI........................ES.FDS..LHEYL--------.R..CNSFWNK.LFASYIKS.
A6R4D6_AJECN/1034-1242-LLVRSAK...EEI........................NH.AFS..LQDYT--------.R..CNAFWNK.LFAAYTKS.
Q4P2J5_USTMA/1116-1323-LFQRCVE...EEL........................GF.VST..VQEFI--------.R..GNAQFIK.LVAQYNRG.
Q5KM85_CRYNJ/1428-1635-LLQLAVH...EEV........................LR.APS..LQDLV--------.H..SRFPIMP.VTAQYIK..
Q4RUQ1_TETNG/412-624-LFRTALE...EEI........................NSKVDQ..IQDIV--------.T..GNPTVIK.MVVSFNRG.
Q8BPA6_MOUSE/45-257-LFQTALQ...EEI........................KSKVDQ..IQEIV--------.T..GNPTVIK.MVVSFNRG.
A7SXE3_NEMVE/113-325-LFETALR...EEI........................YSKVDQ..LQEII--------.T..GNPTVIR.MVVHFNRG.
Q9XZE9_HYDVU/1010-1222-MFETALR...EEI........................GDKIDQ..IVEIV--------.T..GNPTVIK.MIVHFNRG.
A2RRC9_HUMAN/1009-1221-LFKTALQ...EEI........................KSKVEQ..PQDVV--------.T..GNPTVVR.LVVRFYRN.
Q4SWD5_TETNG/1049-1261-LFTEALR...LEI........................SLKVEK..PQDVI--------.T..GNPAVIK.MLVNFYRH.
RNG2_SCHPO/875-1077-FISQVIK...LEA........................AL.VNS..SQDLL--------....SDDCVWKLLFTGYRGD.
Q8SUA0_ENCCU/433-602-FFSLELF...REI................................EFPIH--------HTLTSGSICHK.LMVNYFRI.
Q552W4_DICDI/717-964-FLKALTVGIEYQI........................KY.SET..LQDFL--------.Q..SESVPMK.LLYQYFKK.
A0DYI4_PARTE/179-497-LISEIIT...TEV........................NR.QEF..PEFLW--------DR..EDTLTQF.IMKEFTKR.
A0BIL6_PARTE/179-498-LMSEIIT...TEV........................NR.QEF..PEFLW--------DR..EETLTQF.IMKEFAKR.
Q23D35_TETTS/318-639-FISNIIK...FEV........................EQ.AQD..PSEIK--------FK..SNQVLTK.ILNEFTKR.

PF00620

RHG05_MOUSE/1274-1425NINL.......................ASMEVTVNAVAGA----LKAF--FADLPDP----LIPYSLHPELL.E..----
SYDE_DROME/968-1123RAVEL.....................TPEHVPDINVITGV----LKDY--LRELPEP----LFTRCLFQMTV.D..----
LRG1_YEAST/755-912TEAP.......................DFSKENAIQLSAL----LKKF--IRELPQP----ILSTDLYELWI.K..----
P85B_MOUSE/125-265...........................DLEQWDRTALYDA----VKGF--LLALPAA----VVTPEAAAEAY....----
I5P2_MOUSE/830-972I..........................DQLCANNHSVAEA----LLLF--LESLPEP----VICYSAYHSCL.E..----
RHG07_HUMAN/1092-1238AIDC......................VNYEGQSAYDVADM----LKQY--FRDLPEP----LMTNKLSETFL.Q..----
RHG28_HUMAN/399-552NADK......................FKWDKMCHREAAVM----LKAF--FRELPTS----LFPVEYIPAFISL..----
ARAP2_HUMAN/1129-1281RSFK......................LRAGKHQLEDVTAV----LKSF--LSDIDDA----LLTKELYPYWI.S..----
MYO9A_HUMAN/2076-2225ESV........................NLDDYNIHVIASV----FKQW--LRDLPNP----LMTFELYEEFL.R..----
Q20442_CAEEL/896-1053GNTDVFV.................GENLLDSTQVHDVADL----LKQY--FRDLPEP----LMTVKMSEVFA.N..----
RHG18_HUMAN/343-492YEGT......................FNWESVKQHDAASL----LKLF--IRELPQP----LLSVEYLKAFQ.A..----
ARAP1_HUMAN/971-1120RSVH......................LKEGEQHVDDVSSA----LKRF--LRDLPDG----LFTRAQRLTWL.E..----
PAC1_CAEEL/963-1123FDSVDLSK...............VESLDPRWRDVNVVSSL----LKMF--LRKLPEP----LLTDKLYPFFI.D..----
Q9V4C2_DROME/875-1034YFG........................ISVDTCPHDVATL----LKEF--LRDLPEP----LLCNTLYLTFL.K..----
HMHA1_HUMAN/775-947ELV........................ELSQASPHDISNV----LKLY--LRQLPEP----LISFRLYHELVGL..----
GMIP_HUMAN/565-728ALV........................ELSGNSPHDVSSV----LKRF--LQELTEP----VIPFHLYDAFI.S..----
RHG32_HUMAN/386-538VPDLT.....................KEPYVQDIHSVGSL----CKLY--FRELPNP----LLTYQLYEKFS.D..----
RG190_DROME/1364-1529NTEI.......................DALDIPVNAVATA----LKDF--FSKRLPP----LFSKDIIKELE.E..----
RG92B_DROME/265-418VKTP......................LPLDYQDPHVIGSI----LKLY--LRELPEP----LLTYNLYKDFI.R..----
RGAP1_ARATH/155-296RAS........................IPEGVNPVDVAAL----LKYY--LASLPTP----LTTFELYNEIK....----
BCR_HUMAN/1068-1221KDVS......................VMMSEMDVNAIAGT----LKLY--FRELPEP----LFTDEFYPNFA.E..----
RHG21_HUMAN/1161-1314ADIDI.....................QDDKWRDLNVISSL----LKSF--FRKLPEP----LFTNDKYADFI.E..----
RHG24_MOUSE/151-304KPS........................FDSNTDVHTVASL----LKLY--LRELPEP----VVPYAKYEDFL.SCA----
RHG17_RAT/266-415SHL........................DEFYSDPHAVAGA----LKSY--LRELPEP----LMTFSLYEEWT.Q..----
RHG20_HUMAN/377-527EV.........................HLDCESIFVIASV----LKDF--LRNIPGS----IFSSDLYDHWV.S..----
RBP1_RAT/210-356SP.........................NLEEYEPNTVASL----LKQY--LRDLPEN----LLTKELMPRFE.E..----
CHIN_MOUSE/282-436EKADI.....................SVNMYEDINIITGA----LKLY--FRDLPIP----LITYDAYPKFI.E..----
RHG09_HUMAN/556-726AVTSDGRYVFPEQ....PGQEGRLDLDSTEWDDIHVVTGA----LKLF--LRELPQP----LVPPLLLPHFR....----
FNBP2_HUMAN/505-657DPLA......................GDQNDHDMDSIAGV----LKLY--FRGLEHP----LFPKDIFHDLM.A..----
Q9VDE9_DROME/1154-1302VPDY.......................KNTLVDAHTPASL----LKLW--YRELYDP----LIPDAYYEDCV.N..----
RRC1_CAEEL/294-443EPDL......................HEFGQRDIYSVSSL----LKQY--FRQLPNP----LFTYQAYPKLI.E..----
RHG35_RAT/1262-1413NLDL.......................AEKDFTVNTVAGA----MKSF--FSELPDP----LVPYSMQIDLV.E..----
RHG39_HUMAN/909-1055V..........................PTGLEDPHVPASL----LKLW--YRELEEP----LIPHEFYEQCI.A..----
Q9W4A9_DROME/319-473EKTDM.....................SETAYGNVNVIAGT----LKLY--LRLLPVP----LITFQAYPSFM.A..----
Q8MSA6_DROME/346-502YEAE......................QLLREVDIHSVTGI----LKTF--LRELPEA----LFTDQLYPRFFDTFS----
RGA3_SCHPO/794-942IRM........................EHLTSDLFACTSV----LKTY--LHRLPEP----VIPGTQYEELL.E..----
RGA4_SCHPO/761-910TV.........................LDPSEDISAVTSV----FKQY--LRNLPNP----IITYDQYFPFI.T..----
MYO9B_RAT/1673-1822ATV........................KLEDFPIHAITGV----LKQW--LRELPEP----LMTFAQYGDFL.R..----
RGA1_YEAST/805-985VQQNTE..................TPNILTEQDLNVVTGV----LKRY--LRKLPNP----IFTFQIYEPLM.R..----
Q9P8F2_ZYGRO/832-1008AKPSPE..................VLKLMSE.DIHAVASV----LKRY--LRKLPNP----VLTFQIYEPLI.K..----
RGA2_YEAST/802-985SLHSDTLS...............PKLNALLNQDIHAVASV----LKRY--LRKLPDP----VLSFSIYDALI.D..----
Q8R1F4_MOUSE/140-291KLDL......................NDSKWEDIHVITGA----LKMF--FRELPEP----LFTFNHFNDFV....----
TG325_CAEEL/624-775YKA........................LVSEEDIHVLTGA----LKLF--FRELTDP----LFPISLHKEYT.S..----
Q9VWL9_DROME/292-441DPR........................WLKTDDIHTLTSL----HKQF--FRELTSP----LITQEAYERLGRS..----
CDGAP_DROME/438-593VPDLG.....................NPEMKQDIHAVSSL----LKMY--FRELPNP----LCTYQLYDNFV.EAI----
O13384_COCHE/545-692...........................ESFQHDVNSVAGL----LKQF--FRELPDP----LLTREFYGKYI.E..----
RGA7_SCHPO/520-671LLQLH....................TPEDYENDVHAVADL----LKIF--FRELREP----LIPDNHQRDFI.D..----
Q95TR0_DROME/586-741FQFESC...................ASDDRWEDVNVVSSL----LKLF--IRSLPDA----LMPASYYINFI....----
RGD1_YEAST/486-644ANISMIL.................PSKPHSDSDIYLVGSL----LKTF--FASLPDS----VLPKALSSEIKVCLQ----
BEM2_YEAST/1981-2141ATDNSF..................TLEDDRWFEVNAIAGC----FKMY--LRELPDS----LFSHAMVNDFTDLAI----
ARAP3_HUMAN/920-1071RSVK......................LRPGEHFVEDVTDT----LKRF--FRELDDP----VTSARLLPRWR.E..----
Q8T3K2_DROME/784-935FNVE......................ITRNEYNEHDVANV----LKRF--MRDLPER----LLGK.LTDSFV.F..----
O60432_HUMAN/255-431AAVCLSEDLYPDINVITAVPSLALEASGALTRGDPVFTGI----LKDY--LRELPTP----LITQPLYKVVL....----
Q9N9Z9_DROME/395-545ATP........................HLGNTDIYVLCCC----VKDF--LRSLTEP----LIPTSQWKDFA.N..----
Q9BZ74_HUMAN/363-512TVPL.......................VSKVDDIHAICSL----LKDF--LRNFKEP----LLTFRLNKAFM.E..----
Q95VR1_9HYME/3-152GAL........................DLSEYDIPTITSA----LKQF--LRSLSEP----LVTYALRDTFI.E..----
Q9XUS9_CAEEL/437-588VP.........................NVGLHDVEVITDT----LKRF--LRDLKDP----LIPRTSRQELIVAAN----
O00886_DICDI/28-181GDLS.......................KFNSSDIHSVAGV----LKLY--LRELPEP----LFIWRYYSTFI.K..----
RHG01_HUMAN/260-408PVD........................FDQYNELHLPAVI----LKTF--LRELPEP----LLTFDLYPHVV....----
RHG08_MOUSE/210-360PVN........................FDDYGDMHLPAVI----LKTF--LRELPQP----LLTFQAYEQIL....----
RG68F_DROME/292-439DV.........................DLKSVNVHVIAGL----LKSF--LRDLAEP----LLTFELYEDVT....----
Q23130_CAEEL/263-421KIDFEND................PEYKDNEYVASLHASVL----LKTF--FRSLGEP----LTTNRLYPKLA....----
FA13B_MOUSE/39-190EVD........................LVKEADVPSAISL----LRFF--LQELPEP----VIPGSLHIHLLQL..----
Q8VHL8_MOUSE/532-684DPLE......................KGCTVHDLDSVAGV----LKLY--FRSLEPP----LFPLDMFNELL.A..----
Q19370_CAEEL/541-693DLFQ......................YLDDGSDANSAAGV----LKLY--FRELREP----IFPIFMFEQFC.D..----
O82458_LOTJA/159-296...........................VPNGVDVHCLAGL----IKAW--FRELPTG----ILDPLSPEEVM....----
O01443_CAEEL/529-695GGAVIN...................DNMVENTTSHDVATL----LKEY--FRDLPQS----LLPGEHYSAYI....----
RHG06_HUMAN/411-572DVS........................LEEEHSVHDVAAL----LKEF--LRDMPDP----LLTRELYTAFI....----
Q8SY28_DROME/579-731STAEC....................MDVFDLQQAYDVADM----LKQY--FRELPES----LLTTKMSETFV.A..----
Q8T0G4_DROME/380-537YQNPDN..................LDNLFRTATVHELSSL----LKRW--LRELPQP----LLTNELIQLFY....----
RGA1_SCHPO/862-1019DSI........................DYEQETPIQLAAL----LKKF--LRELPDP----LLTFKLFGLFI.T..----
TAGAP_HUMAN/101-250AV.........................DLERLPVHLLAVV----FKDF--LRSIPRK----LLSSDLFEEWM.G..----
Q9DAP3_MOUSE/308-455EM.........................NLREESVYIVASV----LKEF--IRNIPGS----LLCSNLYGKWL.A..----
Q9XW53_CAEEL/264-412VP.........................DFHKYNTHVLASI----LKEY--LRSIPGK----ILLSGNYELWMRE..----
BEM3_YEAST/927-1096DVDLCRYNESI........EAKDDEASPSLYIGVNTVSGL----LKLY--LRKLPHL----LFGDEQFLSFK.RVV----
RGA2_SCHPO/1083-1234DYDLL.....................SSDEEFDVHVIAGL----LKLY--LRNLPTN----LLDTSMHKLFE.L..----
Q8RWQ4_ARATH/176-325TE.........................FTFDEDPHVVGDC----IKHV--LRELPSS----PVSASCCTALL.E..----
YIL2_SCHPO/178-325MV.........................DLEAFGPIAACSL----IKHL--FRSLPSP----LFSAEFLNGLTDH.M----
RGA6_SCHPO/332-510HFWLDETS...............EIFKRIGFPSYIDIAAV----LKRY--IMLLPGG----LFTHKDILNLLVPLY----
RGA5_SCHPO/68-226DYGRS.....................FDWEGYTVHDAANV----FRRF--INLMPEH----VIPLEYYERFR.EPM----
BAG7_YEAST/76-235DYGRK....................FEGWCDFNVHDIATL----LKRY--LNSLSEP----LVPLALYDIFRNPIL----
P85AA_XENLA/128-280ASV........................DFEQFDIAILSDA----LKRY--FLDLPHP----VIPALMYSEMLSA..----
OCRL_HUMAN/735-875P..........................ETIPGSNHSVAEA----LLIF--LEALPEP----VICYELYQRCL....----
Q8STW6_ENCCU/162-313CV.........................DIENIDVLVLANA----LKNY--IREHLDG----LVPIEAFEKIKTCII----
Q8SRX9_ENCCU/91-256DRNLSYSE...............ARRLLIRDFNVIDLTTA----FKEI--LREYSTT----IIPESLIDTMFKIAK----
O96601_PLAFA/109-259P..........................TTDFNNIPSLVCS----FKLF--LNTQKHG----LLGKDAFSRLH....----
Q9VUR5_DROME/55-207LV.........................NVDNYSVFTIASV----LKKF--LRKIPNG----IFGRSGEMELFAIND----

PF08101

Q0TZ65_PHANO/41-476..............-------------..QMHDPATLCSI----IKWC..WSRLPGG---.VVTWDAYELFR--------
A5DN67_PICGU/33-435TVA....SEEVLRR-------------IVKEYDEFTLMCA----MKYL..WSRLPNH---EIIGWDVYLEFK--------
Q7SG59_NEUCR/43-514NGGPA.IRGEALQQ-------------ELRMTEPMVISGV----IKWC..WSRLEGG---.VVGWDAYELFK--------
Q0CXG4_ASPTN/42-520VERGSPLNGEALAQ-------------ELRLTDPLVLCGV----LKWC..WSRLPGG---.VVTWEAYELFK--------
Q2HFE8_CHAGB/40-505DGGQL.LRGEALAR-------------ELRMTEPM.....----VGYCDNFTRVVGG---.RVANIGDRSFR--------
Q6FSL9_CANGA/50-452NGQPV.NEKKQI.R-------------VVNKTDVWTLFQA----LKYI..WCRLPDS---EVVGWKAYKEFK--------
A6ZP33_YEAS7/67-473NGQPV.NEKKQL.R-------------IVSKADVWTLFQC----LKYI..WCRLPNS---EIIGWKSYLEFK--------
A7ELT0_SCLS1/44-518Q.....LSREMLAQ-------------ELRLTEPMVLCSV----LKWC..WSRMVGG---.VVSWDAYELFK--------
A7TPE0_VANPO/50-442LSL...EGGELRWS-------------SLVKANSFTLFQA----LKYI..WCRLPNG---GVIGWDSYKLFK--------
A7TL24_VANPO/23-432NEKII.TDTKSIKK-------------TISHADSFTLFQV----LKYI..WCRLPNG---EIIGWKSYLEFK--------
Q59KA9_CANAL/47-455ELR...TDNTLLQQ-------------LCSETDEFTLISA----LKYF..WSRLPNN---EIIGWDVYLEFK--------
A3LX57_PICST/32-439ELIDVDHDENHALI-------------IIQSYDEFTLICA----LKYM..WSRLPNN---EIIGWDVYLEYR--------
A6R3W6_AJECN/42-521PERPAPLRGEHLIQ-------------ELRLTEPMVLCSI----IKWC..WSRLPGG---.VVTWEAYELFK--------
Q75ED0_ASHGO/35-426NGQAV.PRAKAR.H-------------VIGETDSWTLVQA----LKYI..WCRLPGE---QVIGWETYWRFR--------
A5DVE6_LODEL/31-437VVS...RDATMVSE-------------LCKETNEFTLICS----LKYF..WSRLPNN---EIIGMDVYKEFK--------
Q6CUF4_KLULA/45-447NGQPV.ADEKIQ.K-------------ILNRTEVWTLFQA----LKYI..WCRLPNG---EIIGWAAYNEFK--------
MUG8_SCHPO/44-440KHGYV.IPKHEIRN-------------RIRLLSEASLISC----LRWL..LHRIPGG---.VITWSTYKLFD--------
Q6C001_YARLI/164-665FQP...LQGEELLR-------------TVRNADIYTLCGV----LKWC..WCRMPGG---.VVSWPVYNTFV--------
Q75EK6_ASHGO/152-598GCTLAGTALREAIE-------------REFRNNWNRLILA----LRIL..WAELPES---.IVPWDCFITFK--------

PF00616

RASL1_MOUSE/321-510....-----------------------VGMRYLHEVLRPV....ISRV.F..EEKKYM..ELDPCKMDLNRSR.......
Q75DK0_ASHGO/576-771....-----------------------IGQEYLDKSIGGI....IRRI.V..AEEDMC..ELDPARIK............
Q757I8_ASHGO/1558-1726....-----------------------KGGAYLINVLKPV....LEEV.V..ATGETF..DVEKIEPD............
RGAA_DICDI/239-445...K-----------------------QGTDYLKAVIGPI....LSNV.I..KQELNL..ELKPNLVYAAIISEQEIRTG
A5DN39_PICGU/903-1097...T-----------------------YQRSHLKKLIGKH....ICRI.T.EDDELNF..ESDPSQIYEDIVRKEVKVHG
GAPD1_MOUSE/152-353..LF-----------------------SAKLFLTATLHEP....IMQL.L.VEDEDHL..ETDPNKLIERFSPAQQEK..
GAP2_DROME/495-668....-----------------------TGEQYLQDTLSAP....INEL.I..QSERDC..EVDPTKTS............
Q0URT8_PHANO/796-948....-----------------------LGKEYLEETLSEK....LKEI.N..EKDPEC..EVDPNKVT............
A5DR10_PICGU/619-844....-----------------------IGQEYLEKVFGDF....FSKI.S..TDKKNC..EVDPRYVRAAIVAARKGDAG
Q6BPM2_DEBHA/608-836....-----------------------IGQEYLEKVFGEF....MGKI.S..YEEKDC..ETDPRYIRLQLKAERKGRTI
A3GHY3_PICST/1310-1472....-----------------------HGLDYLENTLKPV....IEDI.V..NNEVIF..EVEKVDQG............
Q0V6E4_PHANO/854-1062...P-----------------------RDRKFLKEVLGPV....IREN.IIENEHLDL..ESDPMQIYRSAINNEELRTG
Q6CFR5_YARLI/832-1039...A-----------------------APKKLLKSLLGPH....VSTV.V.DQHMLDL..ESDPIAIYRSLINQEELASG
IQGA2_MOUSE/938-1150...A-----------------------RGQNTLRQLLAPV....VKEI.I.EDKALVI..NTNPVEVYKAWVNQLETQTG
A5E5Z0_LODEL/955-1161...T-----------------------SQRQHLKALFGAF....VIQT..TEDDEFDF..ESDPTSILSTIIAKEIRVTG
Q5AH02_CANAL/977-1177...T-----------------------FQRQHLKALLGKF....VIRI..VDNEQVDF..ESDPIRIYNQIIDHEMKVYG
A3LY27_PICST/921-1130...T-----------------------YQRQHLKHLVGKF....VYSV..IESDMLDF..ESDPSEIYEAIVEREHRVNG
A6ZW14_YEAS7/881-1068....-----------------------ESPEFFSIIV.PV....LDYL...SDPVVDF..ESDPYKIYQEIHGFSS....
A7TK28_VANPO/900-1076....-----------------------EYPDLISLFL.PI....LEYI...NDRNIDF..TSDPSVIYRLIHGIEC....
Q6FSF6_CANGA/864-1037....-----------------------EYSEAFELFV.PV....LSFL...GNRETDF..TSDPYVLYEKFYSEA.....
Q6CR01_KLULA/879-1073....-----------------------FRSKEILTAFAQL....YKYL...DSNAIDF..ESDPSKIYAKLHPTAPP...
A7RYQ9_NEMVE/151-314..LF-----------------------SAKLYLTAALHTQ....ILQV............LGNDSRIQ............
Q1PQE2_DROMI/101-305..LF-----------------------SARIFLTAALHAP....LLGV..LSEHDIWL..DLDPHKLMQSFSQKER....
RME6_CAEEL/161-355..IH-----------------------PTMVYLTKALRKG....VLDVIQLGSFWLDI..DAKQSTAR............
Q54F48_DICDI/1131-1337...T-----------------------YGKPYMISVLKDL....VVSIIQ..DHNLNL..ENDPQKKAML..........
Q869U6_DICDI/119-289....-----------------------TCQQYIKDVLRQF....VLQL.V.QDKAINF..KYDLENSE............
A2G1P2_TRIVA/157-304...T-----------------------GVQTYLRLSLSNI....YIDF.INEEDLSKY..RMSSK...............
Q9XVW6_CAEEL/11-201..KF-----------------------QPDQSLRLILRQL....LHETKIDYHLEGSI..KKD.................
Q6BG44_PARTE/169-435...P-----------------------LCQSYIQQIC.......GQALNLLMNVKEEL..QLNPKIIYESQLKLKESKES
RASL2_HUMAN/323-512....-----------------------AGMQYLHGVLGPI....INKV.F..EEKKYV..ELDPSKVEVKDVGC......
A2CE77_DANRE/319-508....-----------------------AGMQYLHRLLGPI....INRI.F..EEKKYV..ELDPSKVELKEAGC......
Q66JF5_XENTR/327-516....-----------------------VGMPFLHEILRPI....ISKI.F..EEKRYI..ELDPCKIDLNRSRR......
Q4T1V0_TETNG/259-481RGMH-----------------------VGMPYLHEVLKPI....INRI.F..DERKYI..ELDPCKITLNRRR.......
RASA3_RAT/351-524....-----------------------AGMHYLHVTLKPT....IEEI.C..QSHKSC..EIDPVKLK............
RASA2_HUMAN/377-550....-----------------------VGGHYLKVTLKPI....LDEI.C..DSSKSC..EIDPIKLK............
A7RYE3_NEMVE/344-517....-----------------------AGMQYLHETIKTL....VDEI.Y..EERKCC..EIDPSRLR............
Q0C7B1_AEDAE/426-599....-----------------------SGLHYLHNTLRPI....VEEI.F..ADKKPC..EIDPARVK............
NGAP_DICDI/596-769....-----------------------IGIPYLSQTIGPL....IKKI.Y..SSKKSC..EIDPTKLE............
A7SJB4_NEMVE/409-582....-----------------------VAIPYLQHTIKDV....ILKI.L..ECKQSC..ELNPAKME............
Q4RUN4_TETNG/812-985....-----------------------TATPFVHHALKDT....ILKI.M..ESKQSC..ELNPSKLE............
Q17P86_AEDAE/660-835....-----------------------ECTVFLQSAVSDT....IQRI.L..DSKQSG..ELNPTKMD............
Q4TC99_TETNG/266-437....-----------------------IGQKYLQDALGEF....IKAL.Y..ESDENC..EVDPSR..............
Q4TB25_TETNG/371-543....-----------------------VGQKYLHDALGEF....VKAL.Y..ESDENC..EVDPSR..............
Q4SJ24_TETNG/320-491....-----------------------IGHRYLKDAIGDF....IRAL.Y..ESEENC..EVDPMR..............
Q6KAS9_MOUSE/518-689....-----------------------VAQEYLQDTLGQV....VRCL.C..ASTEDC..EVDPSK..............
A6ZJ45_CAEEL/167-340....-----------------------VADDYLDSTLSDF....IKTV.L..QCEDSC..EVDPQKLG............
A8XP25_CAEBR/203-376....-----------------------VASDYLEFTLRDF....IMTV.V..ACEDSC..EVDPQRLG............
A7SKG2_NEMVE/244-412....-----------------------VGE...SETLGDF....VQSV.Y..AMSEDC..EVDPAK..............
Q0CSQ0_ASPTN/793-964....-----------------------LGKEYLEETIGER....LRDI.D..ESDPEC..EVDPSRVH............
Q2GTK6_CHAGB/605-776....-----------------------LGKEYLIDTLADR....IQEI.N..ESDYSC..EVDPSKVP............
Q7RW81_NEUCR/919-1092....-----------------------LGKEYLEETLAAK....IREI.N..ELDLDC..EVDPSRMQ............
Q6C802_YARLI/650-829....-----------------------TAHSYLRDLVGKV....VRQV.L..DRDEKL..ELDPSRLD............
A3LZE1_PICST/612-848....-----------------------IGQEYLEKALAGF....FTKI.S..MEKKNC..ELDPRYVSLQEKKLRQGKEI
Q5A506_CANAL/642-872....-----------------------IGQEYLEKVFGDF....FAKI.S..NEKKNC..EVDPRYVRIQERALRKGKSI
A5E274_LODEL/753-994....-----------------------IGQEYLEKVFGDF....FAKI.N..KECKNC..EVDPRYVKIQERAARKGLLN
Q6FNM9_CANGA/542-738....-----------------------IGREYLEKAFGTL....IRNL.L..NEEVSF..EMDPMRISAK..........
BUD2_YEAST/541-721....-----------------------VGNEYLSKALSAI....LKEI.I..ESNKSC..ELDPARVKEK..........
Q6CW67_KLULA/546-743....-----------------------VGQEYLDKCIGTV....IRQL.V..EEDESY..EIDPNRIKES..........
Q4P4C4_USTMA/677-887....-----------------------LTLSWLDDCLGPT....VRKI.C...QDPHV..PSRPDTAASISSAGSVGGDD
Q8SSU4_DICDI/586-757....-----------------------SAQHYLQQTLTPL....VVDL.C..NSPLSL..EVDPIKLS............
Q55CR5_DICDI/1772-1943....-----------------------KGMPYLQKHITPL....VREI.I..DNPNGY..EVDPAKIN............
Q54RT3_DICDI/342-510....-----------------------TGRPYLVATLKPI....VDKL.L..KDSSGY..ELDPEKTS............
Q54Q13_DICDI/104-276....-----------------------VGESYLKYLLQPF....VIDL.C..SRNFSF..EIDPEKAG............
NF1_RAT/1258-1432....-----------------------YGATYLQKLLDPL....LRII.ITSSDWQHVSFEVDPTRLE............
Q8IMS2_DROME/1300-1475....-----------------------YGASYLQMLLEPL....IRPL.L..DEEEETCFEVDPARLD............
Q54T13_DICDI/179-351....-----------------------IGFGYLKEALCPL....IMSM.I..KNDINL..EVDPSKGG............
NFAA_DICDI/68-259....-----------------------IGANYLRFVLSDL....VTKV.V.LDSDLKL..EIDPRKLNDYYED.......
Q6FJ13_CANGA/1767-1935....-----------------------KGQSYLVRTLKPV....LDEF.F..ESRDSF..EIEKILPD............
IRA1_YEAST/1730-1898....-----------------------RGNKYLIKTLRPV....LQGI.V..DNKESF..EIDKMKPG............
A7TN87_VANPO/1674-1842....-----------------------KGNEYLVKIIGPV....LEQM.V..EDKAYF..EVEKLQLD............
Q6CMT2_KLULA/1529-1697....-----------------------KGMDYLSNILKPI....LEEL.I..NSKECF..DVEKLDPN............
IRA2_YEAST/1722-1890....-----------------------KGNEYLIRTLQPL....LKKI.I..QNRDFF..EIEKLKPE............
Q6FQA1_CANGA/1674-1842....-----------------------KGNKYLIKTLQPT....LLDL.I..RNQEVF..EVEKSKPP............
A7TEG6_VANPO/1672-1840....-----------------------VGHEYLVKTLSTV....FMEL.I..ELDEHF..DIERIGDN............
A5E1X9_LODEL/1368-1531....-----------------------YGQNYLNKTICPI....VKEI.V..DTEVYF..EVEKRETT............
Q5A3W3_CANAL/1300-1463....-----------------------NGVDYLNEVLLPV....IKEL.V..DNDVQF..EVEKQDNS............
Q8WZX6_NEUCS/1323-1495....-----------------------KGAGYLKATLQKV....LDRL.M..QTSKDLNLELDPTRVS............
A6SKM1_BOTFB/602-772....-----------------------KGAAYLKATLQKV....LERL.V..LTSKDLDLELDPART.............
Q4PF31_USTMA/1621-1793....-----------------------HGYDYLRSIMAPL....ITDF.ARKPAGFSV..EMDPSRVE............
Q5KFG6_CRYNJ/1321-1493....-----------------------YGYNHVRATLQPL....ILSL.AEKPAECSF..ELDPRKAA............
A2E9Q3_TRIVA/1023-1197....-----------------------FGQTWMTNHLRPL....FNNVIAEAERGVHY..QINPAKLP............
A2FFI6_TRIVA/1018-1191....-----------------------FGQQWLESSFKPM....ILNIIKEIDRGVKC..QINPSKI.............
A2GF60_TRIVA/1036-1210....-----------------------VAMDWLKQTLRPI....FDEVIASCENNVGF..IVNPAKLP............
A2DLG7_TRIVA/987-1164....-----------------------FGREWLKTIYSPM....SNLAKEIVKSGKSI..NIKTKYVP............
A2FB27_TRIVA/1019-1186....-----------------------VANEWLLGLMTPI....IRKVTLLAESGVSF..HIDQTRLD............
Q4DY44_TRYCC/96-330SNAG-----------------------GLEEQLLNCCNILREDDVAPT.LAGGESRL...EEDGGESRGEASSPKFP...
A2DU37_TRIVA/325-480....-----------------------FGKDYINNVIIPL....FNEVCKIPIDDIAD..ES..................
A2EAY4_TRIVA/330-471....-----------------------FGRKYYNEFLNRV....VMYI.Y.SKGDLQ...LKTPAA..............
A2G2R5_TRIVA/334-477....-----------------------FAKDYYERVIKPV....TDEVVSQGNVGIIK..PEDENEWP............
Q86JJ7_DICDI/392-554...P-----------------------SSTPYLKYLFDQS....ITNI.I..NYHDNY..RINTQ...............
A2R7H8_ASPNC/194-402...G-----------------------PGQSYLKQVLADQ....INA..LIELRDVDL..EINPLKVYETMVKQIEEEQG
Q7S5G6_NEUCR/166-375...G-----------------------PGQSFLKSVLADR....INS..LIELKDLDL..EINPLKVYERMIEEAEAKDP
Q6DNA0_SCHCO/171-379...G-----------------------PGQSYLKSVLAER....INS..LIEHKDLNL..EINPVKVYEQMINQIEEETG
Q54I64_DICDI/185-392...G-----------------------PGQQYLKQRLTKP....LAD..ITSNKDLIL..EVNPSTVYENYINEYETKTG
A7S5U4_NEMVE/139-338...G-----------------------PGQEYLKCTLEEP....LND..LMSQEDLVL..EINPIKVYIELYGHPMDE..
GAP1_SCHPO/175-379...G-----------------------PGQAYLRSILYQC....IND..VAIHPDLQL..DIHPLSVYRYLVNTGQLSPS
GAPA_DICDI/274-481...K-----------------------QGHEFLKQIIAPI....LENN.VVNAPDLNL..ELNAVQVYQNMISEQEIQTG
Q7SFX8_NEUCR/1171-1379...P-----------------------RDRKYLRDLLGPL....IRDN.IIEDPALDL..ESDPMQIYRSAINNEELRTG
A7F2A6_SCLS1/1177-1385...P-----------------------RDRKFLRDLLGPL....IMEN.IIEDPALDL..ESDPMQIYRSAINNEELRTG
A2QP50_ASPNC/1125-1333...P-----------------------RDRKFMRDILGTV....VREN.VVENPELDL..ESDPIQIYRSAINNEELRTG
A6R4D6_AJECN/1034-1242...P-----------------------KDRKFMRDILGEL....VKEH.IIENTELDL..ESDPMQIYRSAISNEELRTG
Q4P2J5_USTMA/1116-1323...A-----------------------RERKYLKDLLGPL....VSD..IMAQEGLDL..ETDPCAIYRATINQEEMETG
Q5KM85_CRYNJ/1428-1635...P-----------------------SLTPYIHDVIAPH....VMR..IVDAPELDL..CTDPVRIYIGTINAEETQTG
Q4RUQ1_TETNG/412-624...A-----------------------RGQNTLRQLLAPV....VKD..IIDDKNLNI..NTNPVDIYKAWVNQVETTTG
Q8BPA6_MOUSE/45-257...A-----------------------RGQNALRQILAPV....VKE..IMDDKSLNI..KTDPVDIYKSWVNQMESQTG
A7SXE3_NEMVE/113-325...A-----------------------RGQSSLRELLEPL....VND..VLNERNLNI..NTNPLDVYKGWVNQMESETG
Q9XZE9_HYDVU/1010-1222...S-----------------------KGQTSLRDILSPL....VKE..VITDKNLVI..NTNPTEVYKQWINQMESETG
A2RRC9_HUMAN/1009-1221...G-----------------------RGQSALQEILGKV....IQD..VLEDKVLSV..HTDPVHLYKNWINQTEAQTG
Q4SWD5_TETNG/1049-1261...A-----------------------GGQNALRDCLGPA....LQD..LLLDPGLSI..RTDPLQVYRAWINLSETQSG
RNG2_SCHPO/875-1077....-----------------------VREVKLWKTILGR....IHKV.LVADNHLDF..EINPLTLFKSFNPEVASQT.
Q8SUA0_ENCCU/433-602...S-----------------------QGSFALRDRILHV....VKNL.....ENIEV..DANPVLIYKALFNQTI....
Q552W4_DICDI/717-964....-----------------------KGFKYLKEIITPL....ILKV..LDQTDLNL..NFDPYWIQKEIQIAKELK..
A0DYI4_PARTE/179-497...P-----------------------ENVKYTKVIFKNS....LIQI.T..KVDKFL..DLDKRKIADKLREIMKEKDK
A0BIL6_PARTE/179-498...P-----------------------ENVKYTKVIFKNS....LIQI.T..KVDKFL..DLDKRKIAEKLRDIKKEQDK
Q23D35_TETTS/318-639...Q-----------------------DFQRYTKYIFKGP....LQYI....TKANKI..VVNPQKIFELLKKKQTSQGT

PF00620

RHG05_MOUSE/1274-1425--------------------------------------------------------------------------------
SYDE_DROME/968-1123--------------------------------------------------------------------------------
LRG1_YEAST/755-912--------------------------------------------------------------------------------
P85B_MOUSE/125-265--------------------------------------------------------------------------------
I5P2_MOUSE/830-972--------------------------------------------------------------------------------
RHG07_HUMAN/1092-1238--------------------------------------------------------------------------------
RHG28_HUMAN/399-552--------------------------------------------------------------------------------
ARAP2_HUMAN/1129-1281--------------------------------------------------------------------------------
MYO9A_HUMAN/2076-2225--------------------------------------------------------------------------------
Q20442_CAEEL/896-1053--------------------------------------------------------------------------------
RHG18_HUMAN/343-492--------------------------------------------------------------------------------
ARAP1_HUMAN/971-1120--------------------------------------------------------------------------------
PAC1_CAEEL/963-1123--------------------------------------------------------------------------------
Q9V4C2_DROME/875-1034--------------------------------------------------------------------------------
HMHA1_HUMAN/775-947--------------------------------------------------------------------------------
GMIP_HUMAN/565-728--------------------------------------------------------------------------------
RHG32_HUMAN/386-538--------------------------------------------------------------------------------
RG190_DROME/1364-1529--------------------------------------------------------------------------------
RG92B_DROME/265-418--------------------------------------------------------------------------------
RGAP1_ARATH/155-296--------------------------------------------------------------------------------
BCR_HUMAN/1068-1221--------------------------------------------------------------------------------
RHG21_HUMAN/1161-1314--------------------------------------------------------------------------------
RHG24_MOUSE/151-304--------------------------------------------------------------------------------
RHG17_RAT/266-415--------------------------------------------------------------------------------
RHG20_HUMAN/377-527--------------------------------------------------------------------------------
RBP1_RAT/210-356--------------------------------------------------------------------------------
CHIN_MOUSE/282-436--------------------------------------------------------------------------------
RHG09_HUMAN/556-726--------------------------------------------------------------------------------
FNBP2_HUMAN/505-657--------------------------------------------------------------------------------
Q9VDE9_DROME/1154-1302--------------------------------------------------------------------------------
RRC1_CAEEL/294-443--------------------------------------------------------------------------------
RHG35_RAT/1262-1413--------------------------------------------------------------------------------
RHG39_HUMAN/909-1055--------------------------------------------------------------------------------
Q9W4A9_DROME/319-473--------------------------------------------------------------------------------
Q8MSA6_DROME/346-502--------------------------------------------------------------------------------
RGA3_SCHPO/794-942--------------------------------------------------------------------------------
RGA4_SCHPO/761-910--------------------------------------------------------------------------------
MYO9B_RAT/1673-1822--------------------------------------------------------------------------------
RGA1_YEAST/805-985--------------------------------------------------------------------------------
Q9P8F2_ZYGRO/832-1008--------------------------------------------------------------------------------
RGA2_YEAST/802-985--------------------------------------------------------------------------------
Q8R1F4_MOUSE/140-291--------------------------------------------------------------------------------
TG325_CAEEL/624-775--------------------------------------------------------------------------------
Q9VWL9_DROME/292-441--------------------------------------------------------------------------------
CDGAP_DROME/438-593--------------------------------------------------------------------------------
O13384_COCHE/545-692--------------------------------------------------------------------------------
RGA7_SCHPO/520-671--------------------------------------------------------------------------------
Q95TR0_DROME/586-741--------------------------------------------------------------------------------
RGD1_YEAST/486-644--------------------------------------------------------------------------------
BEM2_YEAST/1981-2141--------------------------------------------------------------------------------
ARAP3_HUMAN/920-1071--------------------------------------------------------------------------------
Q8T3K2_DROME/784-935--------------------------------------------------------------------------------
O60432_HUMAN/255-431--------------------------------------------------------------------------------
Q9N9Z9_DROME/395-545--------------------------------------------------------------------------------
Q9BZ74_HUMAN/363-512--------------------------------------------------------------------------------
Q95VR1_9HYME/3-152--------------------------------------------------------------------------------
Q9XUS9_CAEEL/437-588--------------------------------------------------------------------------------
O00886_DICDI/28-181--------------------------------------------------------------------------------
RHG01_HUMAN/260-408--------------------------------------------------------------------------------
RHG08_MOUSE/210-360--------------------------------------------------------------------------------
RG68F_DROME/292-439--------------------------------------------------------------------------------
Q23130_CAEEL/263-421--------------------------------------------------------------------------------
FA13B_MOUSE/39-190--------------------------------------------------------------------------------
Q8VHL8_MOUSE/532-684--------------------------------------------------------------------------------
Q19370_CAEEL/541-693--------------------------------------------------------------------------------
O82458_LOTJA/159-296--------------------------------------------------------------------------------
O01443_CAEEL/529-695--------------------------------------------------------------------------------
RHG06_HUMAN/411-572--------------------------------------------------------------------------------
Q8SY28_DROME/579-731--------------------------------------------------------------------------------
Q8T0G4_DROME/380-537--------------------------------------------------------------------------------
RGA1_SCHPO/862-1019--------------------------------------------------------------------------------
TAGAP_HUMAN/101-250--------------------------------------------------------------------------------
Q9DAP3_MOUSE/308-455--------------------------------------------------------------------------------
Q9XW53_CAEEL/264-412--------------------------------------------------------------------------------
BEM3_YEAST/927-1096--------------------------------------------------------------------------------
RGA2_SCHPO/1083-1234--------------------------------------------------------------------------------
Q8RWQ4_ARATH/176-325--------------------------------------------------------------------------------
YIL2_SCHPO/178-325--------------------------------------------------------------------------------
RGA6_SCHPO/332-510--------------------------------------------------------------------------------
RGA5_SCHPO/68-226--------------------------------------------------------------------------------
BAG7_YEAST/76-235--------------------------------------------------------------------------------
P85AA_XENLA/128-280--------------------------------------------------------------------------------
OCRL_HUMAN/735-875--------------------------------------------------------------------------------
Q8STW6_ENCCU/162-313--------------------------------------------------------------------------------
Q8SRX9_ENCCU/91-256--------------------------------------------------------------------------------
O96601_PLAFA/109-259--------------------------------------------------------------------------------
Q9VUR5_DROME/55-207--------------------------------------------------------------------------------

PF08101

Q0TZ65_PHANO/41-476--------------------------------------------------------------------------------
A5DN67_PICGU/33-435--------------------------------------------------------------------------------
Q7SG59_NEUCR/43-514--------------------------------------------------------------------------------
Q0CXG4_ASPTN/42-520--------------------------------------------------------------------------------
Q2HFE8_CHAGB/40-505--------------------------------------------------------------------------------
Q6FSL9_CANGA/50-452--------------------------------------------------------------------------------
A6ZP33_YEAS7/67-473--------------------------------------------------------------------------------
A7ELT0_SCLS1/44-518--------------------------------------------------------------------------------
A7TPE0_VANPO/50-442--------------------------------------------------------------------------------
A7TL24_VANPO/23-432--------------------------------------------------------------------------------
Q59KA9_CANAL/47-455--------------------------------------------------------------------------------
A3LX57_PICST/32-439--------------------------------------------------------------------------------
A6R3W6_AJECN/42-521--------------------------------------------------------------------------------
Q75ED0_ASHGO/35-426--------------------------------------------------------------------------------
A5DVE6_LODEL/31-437--------------------------------------------------------------------------------
Q6CUF4_KLULA/45-447--------------------------------------------------------------------------------
MUG8_SCHPO/44-440--------------------------------------------------------------------------------
Q6C001_YARLI/164-665--------------------------------------------------------------------------------
Q75EK6_ASHGO/152-598--------------------------------------------------------------------------------

PF00616

RASL1_MOUSE/321-510................................................................................
Q75DK0_ASHGO/576-771................................................................................
Q757I8_ASHGO/1558-1726................................................................................
RGAA_DICDI/239-445EK..............................................................................
A5DN39_PICGU/903-1097F...............................................................................
GAPD1_MOUSE/152-353................................................................................
GAP2_DROME/495-668................................................................................
Q0URT8_PHANO/796-948................................................................................
A5DR10_PICGU/619-844SD..............................................................................
Q6BPM2_DEBHA/608-836DDSD............................................................................
A3GHY3_PICST/1310-1472................................................................................
Q0V6E4_PHANO/854-1062Q...............................................................................
Q6CFR5_YARLI/832-1039R...............................................................................
IQGA2_MOUSE/938-1150E...............................................................................
A5E5Z0_LODEL/955-1161T...............................................................................
Q5AH02_CANAL/977-1177R...............................................................................
A3LY27_PICST/921-1130F...............................................................................
A6ZW14_YEAS7/881-1068................................................................................
A7TK28_VANPO/900-1076................................................................................
Q6FSF6_CANGA/864-1037................................................................................
Q6CR01_KLULA/879-1073................................................................................
A7RYQ9_NEMVE/151-314................................................................................
Q1PQE2_DROMI/101-305................................................................................
RME6_CAEEL/161-355................................................................................
Q54F48_DICDI/1131-1337................................................................................
Q869U6_DICDI/119-289................................................................................
A2G1P2_TRIVA/157-304................................................................................
Q9XVW6_CAEEL/11-201................................................................................
Q6BG44_PARTE/169-435AKLLKLKQENKARKIMFNIIPMLM...................................................QGTEE
RASL2_HUMAN/323-512................................................................................
A2CE77_DANRE/319-508................................................................................
Q66JF5_XENTR/327-516................................................................................
Q4T1V0_TETNG/259-481................................................................................
RASA3_RAT/351-524................................................................................
RASA2_HUMAN/377-550................................................................................
A7RYE3_NEMVE/344-517................................................................................
Q0C7B1_AEDAE/426-599................................................................................
NGAP_DICDI/596-769................................................................................
A7SJB4_NEMVE/409-582................................................................................
Q4RUN4_TETNG/812-985................................................................................
Q17P86_AEDAE/660-835................................................................................
Q4TC99_TETNG/266-437................................................................................
Q4TB25_TETNG/371-543................................................................................
Q4SJ24_TETNG/320-491................................................................................
Q6KAS9_MOUSE/518-689................................................................................
A6ZJ45_CAEEL/167-340................................................................................
A8XP25_CAEBR/203-376................................................................................
A7SKG2_NEMVE/244-412................................................................................
Q0CSQ0_ASPTN/793-964................................................................................
Q2GTK6_CHAGB/605-776................................................................................
Q7RW81_NEUCR/919-1092................................................................................
Q6C802_YARLI/650-829................................................................................
A3LZE1_PICST/612-848DDSD............................................................................
Q5A506_CANAL/642-872HEATGLENGQNE....................................................................
A5E274_LODEL/753-994KDNDLTDLDDL.....................................................................
Q6FNM9_CANGA/542-738................................................................................
BUD2_YEAST/541-721................................................................................
Q6CW67_KLULA/546-743................................................................................
Q4P4C4_USTMA/677-887................................................................................
Q8SSU4_DICDI/586-757................................................................................
Q55CR5_DICDI/1772-1943................................................................................
Q54RT3_DICDI/342-510................................................................................
Q54Q13_DICDI/104-276................................................................................
NF1_RAT/1258-1432................................................................................
Q8IMS2_DROME/1300-1475................................................................................
Q54T13_DICDI/179-351................................................................................
NFAA_DICDI/68-259................................................................................
Q6FJ13_CANGA/1767-1935................................................................................
IRA1_YEAST/1730-1898................................................................................
A7TN87_VANPO/1674-1842................................................................................
Q6CMT2_KLULA/1529-1697................................................................................
IRA2_YEAST/1722-1890................................................................................
Q6FQA1_CANGA/1674-1842................................................................................
A7TEG6_VANPO/1672-1840................................................................................
A5E1X9_LODEL/1368-1531................................................................................
Q5A3W3_CANAL/1300-1463................................................................................
Q8WZX6_NEUCS/1323-1495................................................................................
A6SKM1_BOTFB/602-772................................................................................
Q4PF31_USTMA/1621-1793................................................................................
Q5KFG6_CRYNJ/1321-1493................................................................................
A2E9Q3_TRIVA/1023-1197................................................................................
A2FFI6_TRIVA/1018-1191................................................................................
A2GF60_TRIVA/1036-1210................................................................................
A2DLG7_TRIVA/987-1164................................................................................
A2FB27_TRIVA/1019-1186................................................................................
Q4DY44_TRYCC/96-330................................................................................
A2DU37_TRIVA/325-480................................................................................
A2EAY4_TRIVA/330-471................................................................................
A2G2R5_TRIVA/334-477................................................................................
Q86JJ7_DICDI/392-554................................................................................
A2R7H8_ASPNC/194-402SL..............................................................................
Q7S5G6_NEUCR/166-375ES..............................................................................
Q6DNA0_SCHCO/171-379SL..............................................................................
Q54I64_DICDI/185-392K...............................................................................
A7S5U4_NEMVE/139-338................................................................................
GAP1_SCHPO/175-379................................................................................
GAPA_DICDI/274-481A...............................................................................
Q7SFX8_NEUCR/1171-1379R...............................................................................
A7F2A6_SCLS1/1177-1385R...............................................................................
A2QP50_ASPNC/1125-1333K...............................................................................
A6R4D6_AJECN/1034-1242R...............................................................................
Q4P2J5_USTMA/1116-1323Q...............................................................................
Q5KM85_CRYNJ/1428-1635T...............................................................................
Q4RUQ1_TETNG/412-624E...............................................................................
Q8BPA6_MOUSE/45-257E...............................................................................
A7SXE3_NEMVE/113-325Q...............................................................................
Q9XZE9_HYDVU/1010-1222K...............................................................................
A2RRC9_HUMAN/1009-1221Q...............................................................................
Q4SWD5_TETNG/1049-1261C...............................................................................
RNG2_SCHPO/875-1077................................................................................
Q8SUA0_ENCCU/433-602................................................................................
Q552W4_DICDI/717-964................................................................................
A0DYI4_PARTE/179-497KQKEEKQSLNSSAFIVKQVPLMLNSSQKLPQRQIPIITPIRNIEMPQQNMTLYYANLIKQYDQSKKSNIKNSRRNQNQLA
A0BIL6_PARTE/179-498KQKDEKQSMTSSAFIVKQVPIMQNSSHKSIPQRQIPIILPIKNIEVPQQNMTVYYANLIKQYDQSKKANTKHSRRNQNQL
Q23D35_TETTS/318-639SIQQQIQRKTMGNNQKDMYVSYNSNQSMRTEPSISDNSNKNYAQKYEQ..ILRQYDSVNSNKNNIVSHNPANLQISTTNV

PF00620

RHG05_MOUSE/1274-1425----------------------------------------------------AAKI.............PDK---TER..
SYDE_DROME/968-1123----------------------------------------------------ALAVC..........LPDDP---EGN..
LRG1_YEAST/755-912----------------------------------------------------AAKI.............DLE---DEK..
P85B_MOUSE/125-265----------------------------------------------------.................RAL---REV..
I5P2_MOUSE/830-972----------------------------------------------------C...................---SGN..
RHG07_HUMAN/1092-1238----------------------------------------------------IYQY.............VPK---DQR..
RHG28_HUMAN/399-552----------------------------------------------------MERG.............PHV---KVQ..
ARAP2_HUMAN/1129-1281----------------------------------------------------ALDT.............QDD---KER..
MYO9A_HUMAN/2076-2225----------------------------------------------------AMGL.............QER---KET..
Q20442_CAEEL/896-1053----------------------------------------------------ICSV.............VPD---VER..
RHG18_HUMAN/343-492----------------------------------------------------VQNL.............PTK---KQQ..
ARAP1_HUMAN/971-1120----------------------------------------------------ASEI.............EDE---EEK..
PAC1_CAEEL/963-1123----------------------------------------------------ANRI.............STH---HNR..
Q9V4C2_DROME/875-1034----------------------------------------------------TQRI.............RNR---RLQ..
HMHA1_HUMAN/775-947----------------------------------------------------AKDS.............LKA---EAEAK
GMIP_HUMAN/565-728----------------------------------------------------LAKT.............LHA---DPGDD
RHG32_HUMAN/386-538----------------------------------------------------AVSA.............ATD---EER..
RG190_DROME/1364-1529----------------------------------------------------IAGSRGVGNSKLNVEVKTDR---SCR..
RG92B_DROME/265-418----------------------------------------------------IAER.............HSE---AER..
RGAP1_ARATH/155-296----------------------------------------------------..................DA---RSS..
BCR_HUMAN/1068-1221----------------------------------------------------GIAL.............SDP---VAK..
RHG21_HUMAN/1161-1314----------------------------------------------------ANRK.............EDP---LDR..
RHG24_MOUSE/151-304----------------------------------------------------TLLS.............KEE---EAG..
RHG17_RAT/266-415----------------------------------------------------VASV.............QDQ---DKK..
RHG20_HUMAN/377-527----------------------------------------------------VMDQ.............GND---EEK..
RBP1_RAT/210-356----------------------------------------------------ACGR.............TTE---VEK..
CHIN_MOUSE/282-436----------------------------------------------------SAKI.............MDP---DEQ..
RHG09_HUMAN/556-726----------------------------------------------------AALA.............LSE---SEQ..
FNBP2_HUMAN/505-657----------------------------------------------------CVTM.............DNL---QER..
Q9VDE9_DROME/1154-1302----------------------------------------------------T................EDP---DKA..
RRC1_CAEEL/294-443----------------------------------------------------AFEK............EDSL---SEK..
RHG35_RAT/1262-1413----------------------------------------------------AHKI.............NDR---EQK..
RHG39_HUMAN/909-1055----------------------------------------------------HYDS................---.....
Q9W4A9_DROME/319-473----------------------------------------------------AGRT.............GKQ---AEQ..
Q8MSA6_DROME/346-502----------------------------------------------------AFSN.............NNE---STR..
RGA3_SCHPO/794-942----------------------------------------------------AEKI.............EKE---EEK..
RGA4_SCHPO/761-910----------------------------------------------------AANC.............ASF---QDK..
MYO9B_RAT/1673-1822----------------------------------------------------AVEL.............PEK---QEQ..
RGA1_YEAST/805-985----------------------------------------------------LVKS.............KKM---MENLP
Q9P8F2_ZYGRO/832-1008----------------------------------------------------LVRE.............HRL---LNTLP
RGA2_YEAST/802-985----------------------------------------------------LVRN.............NQL---IERLP
Q8R1F4_MOUSE/140-291----------------------------------------------------NAIK.............QEP---RQR..
TG325_CAEEL/624-775----------------------------------------------------AMQM.............PNA---TTR..
Q9VWL9_DROME/292-441----------------------------------------------------.................LND---DAA..
CDGAP_DROME/438-593----------------------------------------------------QVKA.............DEA---DER..
O13384_COCHE/545-692----------------------------------------------------AARI.............DDD---TMR..
RGA7_SCHPO/520-671----------------------------------------------------AGNV.............EDE---SRR..
Q95TR0_DROME/586-741----------------------------------------------------EADK.............KFG---LER..
RGD1_YEAST/486-644----------------------------------------------------I................EDP---TTR..
BEM2_YEAST/1981-2141----------------------------------------------------KYKAH...........AMVN---EEY..
ARAP3_HUMAN/920-1071----------------------------------------------------AAEL.............PQK---NQR..
Q8T3K2_DROME/784-935----------------------------------------------------VTEL.............AVA---SEK..
O60432_HUMAN/255-431----------------------------------------------------EAMA.............RDP---PNRVP
Q9N9Z9_DROME/395-545----------------------------------------------------AVQN.............PDT---KTA..
Q9BZ74_HUMAN/363-512----------------------------------------------------AAEI.............TDE---DNS..
Q95VR1_9HYME/3-152----------------------------------------------------AAML.............PDA---RDR..
Q9XUS9_CAEEL/437-588----------------------------------------------------LYST.............DPD---NGR..
O00886_DICDI/28-181----------------------------------------------------VIKN.............PDH---LQR..
RHG01_HUMAN/260-408----------------------------------------------------GFLN.............IDE---SQR..
RHG08_MOUSE/210-360----------------------------------------------------GITS.............VES---SLR..
RG68F_DROME/292-439----------------------------------------------------GFLD.............WPK---EER..
Q23130_CAEEL/263-421----------------------------------------------------ALSE.............VSK---TEK..
FA13B_MOUSE/39-190----------------------------------------------------SQDY.............NNE---DEF..
Q8VHL8_MOUSE/532-684----------------------------------------------------SAEL.............EVV---GER..
Q19370_CAEEL/541-693----------------------------------------------------CAKS.............ESP---TEF..
O82458_LOTJA/159-296----------------------------------------------------QSQS................---.....
O01443_CAEEL/529-695----------------------------------------------------GAAK.............LNV---DER..
RHG06_HUMAN/411-572----------------------------------------------------NTLL.............LEP---EEQ..
Q8SY28_DROME/579-731----------------------------------------------------IFQH.............LPA---EVR..
Q8T0G4_DROME/380-537----------------------------------------------------QCHT.............LPS---IDQ..
RGA1_SCHPO/862-1019----------------------------------------------------SSKL.............ESE---EER..
TAGAP_HUMAN/101-250----------------------------------------------------ALEM.............QDE---EDR..
Q9DAP3_MOUSE/308-455----------------------------------------------------VLDQ.............EFH---DQK..
Q9XW53_CAEEL/264-412----------------------------------------------------IADE.............PNT---EKK..
BEM3_YEAST/927-1096----------------------------------------------------DENH.............NNP---VQI..
RGA2_SCHPO/1083-1234----------------------------------------------------LPNV.............PND---SAA..
Q8RWQ4_ARATH/176-325----------------------------------------------------AYRI.............ESK---EAR..
YIL2_SCHPO/178-325----------------------------------------------------.................DSG---IDY..
RGA6_SCHPO/332-510----------------------------------------------------VDSSR...........VKVP---IDI..
RGA5_SCHPO/68-226----------------------------------------------------TIPN.............LTD---NER..
BAG7_YEAST/76-235----------------------------------------------------ENPKI...........NEHK---EQI..
P85AA_XENLA/128-280----------------------------------------------------ARES.............ISS---DEY..
OCRL_HUMAN/735-875----------------------------------------------------.................DSA---YDP..
Q8STW6_ENCCU/162-313----------------------------------------------------S................NDR---YTR..
Q8SRX9_ENCCU/91-256----------------------------------------------------V................ENE---EDQ..
O96601_PLAFA/109-259----------------------------------------------------YLKS.............TSA---SDKV.
Q9VUR5_DROME/55-207----------------------------------------------------L................QNE---AEQ..

PF08101

Q0TZ65_PHANO/41-476----------------------------------------------------IGES-------------DSN---L.A--
A5DN67_PICGU/33-435----------------------------------------------------RKEE-------------EQG---F.P--
Q7SG59_NEUCR/43-514----------------------------------------------------VGEQ-------------DSN---M.A--
Q0CXG4_ASPTN/42-520----------------------------------------------------VGEQ-------------DSQ---F.A--
Q2HFE8_CHAGB/40-505----------------------------------------------------AWLS-------------GAG---ADS--
Q6FSL9_CANGA/50-452----------------------------------------------------IREK-------------EKD---Y.P--
A6ZP33_YEAS7/67-473----------------------------------------------------FREE-------------DKK---F.P--
A7ELT0_SCLS1/44-518----------------------------------------------------VGEH-------------DSN---Y.A--
A7TPE0_VANPO/50-442----------------------------------------------------VKEK-------------KKN---Y.P--
A7TL24_VANPO/23-432----------------------------------------------------AREK-------------YAN---Y.P--
Q59KA9_CANAL/47-455----------------------------------------------------RREA-------------EKG---Y.P--
A3LX57_PICST/32-439----------------------------------------------------RRER-------------EAG---Y.P--
A6R3W6_AJECN/42-521----------------------------------------------------VGEQ-------------DSQ---F.A--
Q75ED0_ASHGO/35-426----------------------------------------------------AEER-------------KLG---Y.P--
A5DVE6_LODEL/31-437----------------------------------------------------RKEE-------------KQG---Y.P--
Q6CUF4_KLULA/45-447----------------------------------------------------TKEA-------------EQN---Y.S--
MUG8_SCHPO/44-440----------------------------------------------------EAET-------------RAN---Y.P--
Q6C001_YARLI/164-665----------------------------------------------------QAEK-------------DGE---M.D--
Q75EK6_ASHGO/152-598----------------------------------------------------RLEE-------------RDG---Y.P--

PF00616

RASL1_MOUSE/321-510..........................................RISFKGTPT.EEQVRE........TSLGLL...TGY--
Q75DK0_ASHGO/576-771.............................................EPDEIK.KRVILE........TNQAKL...ISW--
Q757I8_ASHGO/1558-1726.....................................................DPDCQ........IHVDLF...CKY--
RGAA_DICDI/239-445................STLDRN..................VSHEKALEVPE.VTKTIK........ARVDQL...ISI--
A5DN39_PICGU/903-1097..................SDRP.S...............VLPAPSAIKEPD.VSSQFV........ENLMSL...REC--
GAPD1_MOUSE/152-353.....................L.................FGEKGSDRFRQK.VQEMVD........SNEAKL...VAL--
GAP2_DROME/495-668.................................................GS.SAGSLQ........RQQAAL...RGA--
Q0URT8_PHANO/796-948....................................................SQHELD........RNWRRL...INC--
A5DR10_PICGU/619-844.................YDDSD.D...............YDSDEEKETDDA.VRKQVD........SNFQNL...LGY--
Q6BPM2_DEBHA/608-836...............LESDDSD.D...............YDSDIEKENEEL.IKERVN........TNFGNL...YHY--
A3GHY3_PICST/1310-1472...................................................................DSVVF...MKY--
Q0V6E4_PHANO/854-1062.................RSRRD.P...............NVSRDVALKDPE.TRGTFI........HNLQDL...RDV--
Q6CFR5_YARLI/832-1039.................TSARD.P...............NLPVDEAIQDPE.TRQTFI........ANLQRL...REL--
IQGA2_MOUSE/938-1150.................ASKLP.Y...............DVTTEQALTYPE.VKNKLE........ASIENL...RKV--
A5E5Z0_LODEL/955-1161..................STKK.P...............TSDPQEAIRCPE.VSTQFV........RNLTSL...REH--
Q5AH02_CANAL/977-1177..................SEKS.R...............DISPQAAIQLPE.VSNKFV........GNLMSL...RET--
A3LY27_PICST/921-1130..................SERP.R...............GISPQHAIKEED.VSAKFV........NNLMNL...REV--
A6ZW14_YEAS7/881-1068........................................PQHCSPVDDAS.TKNKFI........DNLRCL...WHA--
A7TK28_VANPO/900-1076........................................TDRSSAIEDDQ.TKIHFI........ENLKNV...WHA--
Q6FSF6_CANGA/864-1037.........................................PSSQPIENQR.VKNEFI........KNLRNI...WHA--
Q6CR01_KLULA/879-1073........................................QLAHEAIEDSS.TSKRFI........KNMTSLWGAVEL--
A7RYQ9_NEMVE/151-314.....................................................................AKL...PYI--
Q1PQE2_DROMI/101-305.........................................ERRFGQAGEGEHGEEYQRNVARFHAETLGKL...HTH--
RME6_CAEEL/161-355.................................................FLRDNKQNEDRLPEYRALVVSKL...VDF--
Q54F48_DICDI/1131-1337...............................................ASIG.IVDDDDDDSGLPVIDQQILL...QQF--
Q869U6_DICDI/119-289.....................................................NVVIH........NEFSNL...IVW--
A2G1P2_TRIVA/157-304..................................................................EYLQVC...ARY--
Q9XVW6_CAEEL/11-201..................................................................VQIKIS...RHS--
Q6BG44_PARTE/169-435NKDINVYENVRRTNIPEYILNA.IMEQ.........ISPAIQSYCQTPLQRIMDPQLLEETAKILYDRHKVT...EMI--
RASL2_HUMAN/323-512...........................................SGLHRPQT.EAEVLE........QSAQTL...RAH--
A2CE77_DANRE/319-508...........................................AGLHRQQT.ESDVIQ........QSSSLL...QSY--
Q66JF5_XENTR/327-516...........................................ISFKGSMS.EHHILE........SSLETL...RGY--
Q4T1V0_TETNG/259-481...........................................ISFKGAVS.EEEVRD........SSVEML...QDY--
RASA3_RAT/351-524....................................................DGENLE........NNMESL...RQY--
RASA2_HUMAN/377-550....................................................EGDNVE........NNKENL...RYY--
A7RYE3_NEMVE/344-517....................................................DGDSLP........QNLANL...QGY--
Q0C7B1_AEDAE/426-599....................................................DKSMID........TNLVNL...QEY--
NGAP_DICDI/596-769....................................................KGEDIK........KNCKNL...LSW--
A7SJB4_NEMVE/409-582....................................................KGADTV........VNLKQL...LEF--
Q4RUN4_TETNG/812-985....................................................KNEDVN........LNLSHL...LNI--
Q17P86_AEDAE/660-835....................................................VNDDAC........SNAEFL...LMI--
Q4TC99_TETNG/266-437..................................................C.ATSDLS........EHQANL...RMC--
Q4TB25_TETNG/371-543..................................................C.PPADLP........EHQSNL...KMC--
Q4SJ24_TETNG/320-491..................................................I.PPSVLA........DHQANL...RMC--
Q6KAS9_MOUSE/518-689..................................................C.PTPELP........KHQARL...RDS--
A6ZJ45_CAEEL/167-340.................................................NV.SNSSLE........KNRALL...MRY--
A8XP25_CAEBR/203-376.................................................NV.PSSVLE........KNRALL...TRY--
A7SKG2_NEMVE/244-412..................................................S.VNGSIQ........SNQENL...KAF--
Q0CSQ0_ASPTN/793-964....................................................RSDDLE........RNWRNL...ISL--
Q2GTK6_CHAGB/605-776....................................................HGEDVQ........QHWNHL...IQF--
Q7RW81_NEUCR/919-1092....................................................NGDDIQ........QHWAKL...IEL--
Q6C802_YARLI/650-829....................................................DGHGITPEIEQLKVHNQERL...MAH--
A3LZE1_PICST/612-848...............SDSEFTS.D..............SEDEVVDEEEREKNVNKMLE........DNFENL...YDY--
Q5A506_CANAL/642-872.......DVSDDDDDDDDNSSD.DD............ADYNAEKERERNER.IKQMVE........ENFQNL...YGY--
A5E274_LODEL/753-994........CGSSDDDDDDDGDG.NG............NGYDSELEREKDER.IKKMVE........DNYQNL...YGY--
Q6FNM9_CANGA/542-738...............................................DDIE.RRQIIQ........HNSEDL...KQW--
BUD2_YEAST/541-721...............................................DEVK.KRKIIA........DNYKRL...YSW--
Q6CW67_KLULA/546-743...............................................ELTE.KEKIIE........TNFQKL...LSL--
Q4P4C4_USTMA/677-887...................APF.................DFSTSIRSPPSF.PDNIIETIP..DGPITINAL...RKL--
Q8SSU4_DICDI/586-757....................................................PGEDIE........MNIKNL...KIV--
Q55CR5_DICDI/1772-1943..................................................E.GSEELM........TNMMNL...IQI--
Q54RT3_DICDI/342-510.......................................................NTE........GNVERL...SQI--
Q54Q13_DICDI/104-276....................................................KGVNIQ........ANLEKL...ITI--
NF1_RAT/1258-1432....................................................PSESLE........ENQRNL...LQM--
Q8IMS2_DROME/1300-1475....................................................PTEDIE........QHRNNL...IAL--
Q54T13_DICDI/179-351...................................................ITEAEVE........QNAIQL...SFF--
NFAA_DICDI/68-259...........................................KIEFEKKV.AEVELR........DNQKSL...HNI--
Q6FJ13_CANGA/1767-1935.....................................................DPEAE........KNVDMF...IHY--
IRA1_YEAST/1730-1898.....................................................SENSE........KMLDLF...EKY--
A7TN87_VANPO/1674-1842.....................................................DPNAS........EQLDLF...EKY--
Q6CMT2_KLULA/1529-1697.....................................................DVDAP........RNLMLF...KKY--
IRA2_YEAST/1722-1890.....................................................DSDAE........RQIELF...VKY--
Q6FQA1_CANGA/1674-1842.....................................................GENYE........RDVALF...KKY--
A7TEG6_VANPO/1672-1840.....................................................EVEIE........RNIRLF...KKY--
A5E1X9_LODEL/1368-1531..................................................................EDSAKF...IHF--
Q5A3W3_CANAL/1300-1463..................................................................DTADLF...ILY--
Q8WZX6_NEUCS/1323-1495....................................................SPEELQ........KNALQL...EIV--
A6SKM1_BOTFB/602-772..................................................T.SPEELQ........KNALQL...RVV--
Q4PF31_USTMA/1621-1793....................................................PGGSAL........KNQTAL...EEI--
Q5KFG6_CRYNJ/1321-1493....................................................PGDDIE........RNSDHL...RLM--
A2E9Q3_TRIVA/1023-1197....................................................EGQDIE........QNRKNF...RGV--
A2FFI6_TRIVA/1018-1191....................................................TDGNLN........LNRDNF...RSI--
A2GF60_TRIVA/1036-1210....................................................EGQTIE........VNTENF...RQL--
A2DLG7_TRIVA/987-1164....................................................SNENIE........ENRKTF...RQL--
A2FB27_TRIVA/1019-1186....................................................PHENIN........ENREQF...RQV--
Q4DY44_TRYCC/96-330.......................................FEGLNYFESMTA.VPSEDDGGISHNEDTYTQAI...VEM--
A2DU37_TRIVA/325-480..................................................................NDVEII...RRY--
A2EAY4_TRIVA/330-471..................................................................ADSHRA...KQM--
A2G2R5_TRIVA/334-477..................................................................EKQEKV...AKL--
Q86JJ7_DICDI/392-554..................................................................QGITNL...IAE--
A2R7H8_ASPNC/194-402.................PESLQ.R...............SVTAEDAAANAQ.VQAIIE........PRLKML...TDY--
Q7S5G6_NEUCR/166-375................PEAMLP.K...............GITQEEAAENPK.VQEIIN........PRLTML...TEI--
Q6DNA0_SCHCO/171-379.................PPNLP.R...............GVPPEVAQENPD.VQAIIA........PRLTML...MEI--
Q54I64_DICDI/185-392.................PSPLK.R...............KVSPEECADNQN.VKDIIK........PRIDKL...IEI--
A7S5U4_NEMVE/139-338.....................S.................SLTLERAMDDPE.VMFRTK........LRIKKL...QDI--
GAP1_SCHPO/175-379..................EDDN.................LLTNEEVSEFPA.VKNAIQ........ERSAQL...LLL--
GAPA_DICDI/274-481.................KSTLN.R...............GLAEDQIIQLKE.VQSILE........PRVEKC...IQI--
Q7SFX8_NEUCR/1171-1379.................PSQRP.L...............DVPREVAIKDPE.TRELFI........DHLRDL...REI--
A7F2A6_SCLS1/1177-1385.................PSQRA.L...............EIPRDQAIKDPE.TRDMFI........DHLRDL...REI--
A2QP50_ASPNC/1125-1333.................RSRRR.L...............DILREEAIRDPE.TRATFI........QHLQDL...RDI--
A6R4D6_AJECN/1034-1242.................KSRRR.I...............DVPREEAIRDPE.TRETFI........RHLQDL...RDI--
Q4P2J5_USTMA/1116-1323.................PSRRP.L...............EVAFNEALADPM.ARTIFI........RHLQSL...RAT--
Q5KM85_CRYNJ/1428-1635.................PSALP.R...............DRNADQILQEHAITRALFI........RNLQEL...RNL--
Q4RUQ1_TETNG/412-624.................ASKLP.Y...............EVTPEQAMSHEE.VRSRLE........ASSLAL...RAA--
Q8BPA6_MOUSE/45-257.................ASKLP.Y...............DVTPEQALSHEE.VKTRLD........NSIRNM...RAV--
A7SXE3_NEMVE/113-325.................TSKLP.Y...............DVDPEQALSHPE.VREKIA........MSMRNL...IQA--
Q9XZE9_HYDVU/1010-1222.................PSELP.Y...............DVDNEFAMKQPE.VARRLD........ASVKAL...EVA--
A2RRC9_HUMAN/1009-1221.................RSHLP.Y...............DVTPEQALSHPE.VQRRLD........IALRNL...LAM--
Q4SWD5_TETNG/1049-1261.................RSSLP.Y...............EVSPAEALRHPE.VRRRVE........VAAVNL...RSL--
RNG2_SCHPO/875-1077...................DSP.................KLTLSLAMQHPP.TRNLYV........SRLREL...RKL--
Q8SUA0_ENCCU/433-602.........................................SVDKALENER.VRETVQ........TRLMVM...RGV--
Q552W4_DICDI/717-964....................DG.................KKSEKKTLDQTF.EQLMANNDVVSIFNSRCLQL...VEL--
A0DYI4_PARTE/179-497EFSLKVLQFGEEQRQAKFLTMERRSVAPIQE.SQSESPIRKLSKVYSHSNK.SDQYMNNEINSVLIACIDKF...KQL--
A0BIL6_PARTE/179-498TEFSLKVLQFGEEQRQAKFLTMERRSIPPIQESHSESPIRKLSEVYSHNSR.SDQYMNNEINSVLIACIDKF...KQL--
Q23D35_TETTS/318-639KESSNLTVSKADSIQMPLSARNYSSNQGKD..AIQDFSGVIKRGPESGLDK.ESQMMQDNVNRLLKKNIDIL...KNL--

PF00620

RHG05_MOUSE/1274-1425...................FHALKEIVK.-.K-------F-HPVNYDVFRYVITHLNRVSQ..Q----NK----------
SYDE_DROME/968-1123...................AKLMLSILD.-.C-------L-PRANRATLVFLLDHLSLVVS..N----SE----------
LRG1_YEAST/755-912...................QRVILLIYS.-.L-------L-PTYNRNLLEALLSFLHWTSS..F----SY----------
P85B_MOUSE/125-265...................AGPVGLVLEP-PT-------L-PLHQALTLRFLLQHLGRVAR..R----AP----------
I5P2_MOUSE/830-972...................YAASKQIIL.-.T-------L-PSFHKNVFNYLMAFLQELLK..N----SA----------
RHG07_HUMAN/1092-1238...................LQAIKAAIM.-.L-------L-PDENREVLQTLLYFLSDVTA..A----VK----------
RHG28_HUMAN/399-552...................FQALHLMVM.-.A-------L-PDANRDAAQALMTFFNKVIA..N----ES----------
ARAP2_HUMAN/1129-1281...................IKKYGAFIR.-.S-------L-PGVNRATLAAIIEHLYRVQK..C----SE----------
MYO9A_HUMAN/2076-2225...................IRGVYSVID.-.Q-------L-SRTHLNTLERLIFHLVRIAL..Q----ED----------
Q20442_CAEEL/896-1053...................ITALQYAIL.-.L-------L-PDENREALKTLLLFLKEVSR..N----SQ----------
RHG18_HUMAN/343-492...................LQALNLLVI.-.L-------L-PDANRDTLKALLEFLQRVID..N----KE----------
ARAP1_HUMAN/971-1120...................VSRYRELLV.-.R-------L-PPVNRATVKALISHLYCVQC..F----SD----------
PAC1_CAEEL/963-1123...................LHKLRNLLR.-.K-------L-PRPHYDTLRFLIVHLSEITK..H----SD----------
Q9V4C2_DROME/875-1034...................LEAISHLIR.-.L-------L-PIPHRDTLYVLLVFLAKVAA..H----SD----------
HMHA1_HUMAN/775-947AASRGRQDGSESEAVAVALAGRLRELLR.-.D-------L-PPENRASLQYLLRHLRRIVE..V----EQ----------
GMIP_HUMAN/565-728PGTP.........SPSPEVIRSLKTLLV.-.Q-------L-PDSNYNTLRHLVAHLFRVAA..R----FM----------
RHG32_HUMAN/386-538...................LIKIHDVIQ.-.Q-------L-PPPHYRTLEFLMRHLSLLAD..Y----CS----------
RG190_DROME/1364-1529...................LIALKSLLQ.-.K-------L-PPINFAILKYIFQHFVHVSD..N----SK----------
RG92B_DROME/265-418...................KTEIKAILT.-.K-------L-PKENYANLRYLTRFLSIVQQ..R----SA----------
RGAP1_ARATH/155-296...................IHRMRQSLQ.-.K-------L-SNVNYNTLEFITALLLRVSQ..K----SL----------
BCR_HUMAN/1068-1221...................ESCMLNLLL.-.S-------L-PEANLLTFLFLLDHLKRVAE..K----EA----------
RHG21_HUMAN/1161-1314...................LKTLKRLIH.-.D-------L-PEHHYETLKFLSAHLKTVAE..N----SE----------
RHG24_MOUSE/151-304...................VKELMKQVK.-.S-------L-PVVNYNLLKYICRFLDEVQS..Y----SG----------
RHG17_RAT/266-415...................LQYLWTTCQ.-.K-------L-PPQNFVNFRYLIKFLAKLAQ..T----SD----------
RHG20_HUMAN/377-527...................INTVQRLLD.-.Q-------L-PRANVVLLRYLFGVLHNIEQ..H----SS----------
RBP1_RAT/210-356...................VQEFQRLLR.-.E-------L-PEYNHLLLSWLIVHMDHVIA..K----EL----------
CHIN_MOUSE/282-436...................LETLHEALR.-.S-------L-PPAHCETLRYLMAHLKRVTL..H----EK----------
RHG09_HUMAN/556-726..................CLSQIQELIG.-.S-------M-PKPNHDTLRYLLEHLCRVIA..H----SD----------
FNBP2_HUMAN/505-657...................ALHIRKVLL.-.V-------L-PKTTLIIMRYLFAFLNHLSQ..F----SE----------
Q9VDE9_DROME/1154-1302.......................KEIVN.-.K-------L-PEINQLVLTYLIHFLQQFAI..P----EV----------
RRC1_CAEEL/294-443...................VESLRFSLE.-.T-------M-PEAHYRTAKFLMEHLTRLCK..S----KS----------
RHG35_RAT/1262-1413...................LHALKEVLK.-.K-------F-PKENHEVFKYVISHLNRVSH..N----NK----------
RHG39_HUMAN/909-1055...................PEAAVAVVH.-.A-------L-PRINRMVLCYLIRFLQVFVQPAN----VA----------
Q9W4A9_DROME/319-473...................RQLMAEAVR.-.R-------L-PPAHHSCLQYMLEHLKRVAS..H----YA----------
Q8MSA6_DROME/346-502...................INELLKVFE.-.E-------L-PQANKASITSILDHLIRVHE..K----ET----------
RGA3_SCHPO/794-942...................IERVVEVMK.-.T-------L-HPAHLSVFRFLIAHLGRVCK..H----AE----------
RGA4_SCHPO/761-910...................LDGFIMVIK.-.S-------L-PPAHAEILQLIIRHLARVAA..Y----SH----------
MYO9B_RAT/1673-1822...................LAAIYAVLD.-.H-------L-PEANHTSLERLIFHLVKVAL..L----ED----------
RGA1_YEAST/805-985FVGGKLSLEAKNSDTYMSSKSALKNILE.-.D-------L-PREHYRVLRVLSEHIEKVTR..Y----SH----------
Q9P8F2_ZYGRO/832-1008LKSGGNT...DKNPLYLNALESVTKILK.-.N-------L-PREHYDLLRYLSRHISKITS..Y----SE----------
RGA2_YEAST/802-985LNNDKFLDSPQKVTIYEMVLKSLLEIFK.-.I-------L-PVEHQEVLKVLAAHIGKVRR..C----SE----------
Q8R1F4_MOUSE/140-291...................VTAVKDLIR.-.Q-------L-PKPNQDTMQILFRHLKRVIE..N----GE----------
TG325_CAEEL/624-775...................FKKFEELLS.-.R-------L-PNENRETLKMLLRHLNRVAS..H----SS----------
Q9VWL9_DROME/292-441...................IERMSLAFD.-.D-------M-PEPNRSTLRFLIRHLTRVAA..A----SA----------
CDGAP_DROME/438-593...................LRLMKETVL.-.K-------L-PPPHYRTLKYLAEHLYKVSQ..H----HG----------
O13384_COCHE/545-692...................RDSMHALIN.-.A-------L-PDPNYATLRALALHLHRVQQ..S----SE----------
RGA7_SCHPO/520-671...................RDAVHRAIN.-.D-------L-PDANYSTIRHLTIHLAKIKE..N----SD----------
Q95TR0_DROME/586-741...................IVLLREIVE.-.S-------L-PRHPYETMKHLIRHLCRVSG..N----CD----------
RGD1_YEAST/486-644...................KNFMHGLIY.-.N-------L-PDAQYWTLRALVFHLKRVLA..H----EA----------
BEM2_YEAST/1981-2141...................KRMMNELLQ.-.K-------L-PTCYYQTLKRIVFHLNKVHQ..H----VV----------
ARAP3_HUMAN/920-1071...................LEKYKDVIG.-.C-------L-PRVNRRTLATLIGHLYRVQK..C----AA----------
Q8T3K2_DROME/784-935...................IPIYRELLA.-.R-------L-SAIERETLRRIVGHLVFISS..Q----QA----------
O60432_HUMAN/255-431.................PTTEGTRGLLS.-.C-------L-PDVERATLTLLLDHLRLVSS..F----HA----------
Q9N9Z9_DROME/395-545...................QDMLVKSVK.-.Q-------L-PQANRDTLAFLILHFQRIAQ..C----PV----------
Q9BZ74_HUMAN/363-512...................ISAMYQAVG.-.E-------L-PQANRDTLVFLMIHLQRVAQ..S----PY----------
Q95VR1_9HYME/3-152...................DVELGSVVM.-.Q-------L-PQANLDTLAYLMLHLQRVSE..S----EE----------
Q9XUS9_CAEEL/437-588....................LALNRVIC.-.E-------L-PQANRDTLAYLFIHWRKVIA..Q----SS----------
O00886_DICDI/28-181...................ALHLRMLCY.-.G-------L-PKVNRDLVLSLMVFLNKISL..N----NR----------
RHG01_HUMAN/260-408...................VPATLQVLQ.-.T-------L-PEENYQVLRFLTAFLVQISA..H----SD----------
RHG08_MOUSE/210-360...................VTHCRLILR.-.S-------L-PEHNYAVLRYLMGFLHEVSL..E----SI----------
RG68F_DROME/292-439...................SRNVTQLIR.-EK-------L-PEENYELFKYIVEFLVRVMD..C----ED----------
Q23130_CAEEL/263-421...................SAAVKEFVK.-.L-------L-PRENYILLKTVIKFLTRVAE..N----SK----------
FA13B_MOUSE/39-190...................GRKLRFLLQ.-.Q-------L-PPVNYSLLKFLCRFLANVAS..H----HE----------
Q8VHL8_MOUSE/532-684...................VEPVSHLLF.-.K-------L-PRPVLVVLRYLFTFLNHLAQ..Y----SD----------
Q19370_CAEEL/541-693...................VRRARELVS.-.K-------L-PVSHVLLLRFLFAFLSHLCE..F----AD----------
O82458_LOTJA/159-296...................EEECDQLVR.-.L-------L-PPTEAALLDWAINLMADVAQ..M----EH----------
O01443_CAEEL/529-695...................IEAIRLLFA.-.L-------L-VSPILDTLFVLLKFLHEVSC..H----SQ----------
RHG06_HUMAN/411-572...................LGTLQLLIY.-.L-------L-PPCNCDTLHRLLQFLSIVAR..H----AD----------
Q8SY28_DROME/579-731...................LDAVQCAVL.-.L-------L-PDENREILYVLLEFLTIVAA..N----SQ----------
Q8T0G4_DROME/380-537...................MNALSILCH.-.L-------L-PPENRNTLRSLLSFFNIIIN..L----KD----------
RGA1_SCHPO/862-1019...................MRVLHLTIC.-.L-------L-PKGHRDTMEVIFGFLYWVAS..F----SH----------
TAGAP_HUMAN/101-250...................IEALKQVAD.-.K-------L-PRPNLLLLKHLVYVLHLISK..N----SE----------
Q9DAP3_MOUSE/308-455...................ISAIQSLLI.-.Q-------M-PLPNVLLLRHLLSVLHKIKG..R----SS----------
Q9XW53_CAEEL/264-412...................VSCCRALLS.-.H-------L-PTSHSILLANVLKLLNKISN..S----PS----------
BEM3_YEAST/927-1096...................SLGFKELIES-GL-------V-PHANLSLMYALFELLVRINE..N----SK----------
RGA2_SCHPO/1083-1234...................LGELCDVIS.-.K-------L-PPENFALLDSLLHHLRRIIA..F----EK----------
Q8RWQ4_ARATH/176-325...................ISSLRSAIA.-ET-------F-PEPNRRLLQRILKMMHTISS..H----SH----------
YIL2_SCHPO/178-325...................AVSLQKLID.-AS-------M-DKNSQKLARLIFSLLYQITQ..H----EQ----------
RGA6_SCHPO/332-510...................RNEMAALCFS-QI-------D-SYVRFSILCSLLALLHQIAT..R----TQ----------
RGA5_SCHPO/68-226...................VEMYRRRID.-.E-------L-PIPNRQLLLYLLDLLSVFAM..N----SS----------
BAG7_YEAST/76-235...................IKDYEDIYM.-.L-------L-PQQNRHLILYLAALLNLFAR..N----EK----------
P85AA_XENLA/128-280...................VQLLRKIIRC-AN-------V-PQQYWLTLQYLLKHFFQLCQ..S----SS----------
OCRL_HUMAN/735-875....................RICRQVIS.-.Q-------L-PRCHRNVFRYLMAFLRELLK..F----SE----------
Q8STW6_ENCCU/162-313...................EALFSYMPF.-.I-------F-TDAERRLLTSLFELLKMIDK..N----SD----------
Q8SRX9_ENCCU/91-256...................VILCQMLFI.-.S-------M-PKTNRHVLEATIYFLYVIHDIAT----DK----------
O96601_PLAFA/109-259..................IKLNLSKLYE.-.K-------L-SQGIKQCVLCLLHFFKTISE..H----AS----------
Q9VUR5_DROME/55-207...................TERLHRLFG.-.S-------L-PKYTQHLLVLLFGTFRVIASNAA----HA----------

PF08101

Q0TZ65_PHANO/41-476-------------------RHAFDTFIPL-SV-------D-CEARKHIIFDFFDLLSAVAA--R....GK----------
A5DN67_PICGU/33-435-------------------RTAFLTIMPK-CL-------S-SPSHASIVYDFLDLLVSIAS--N....SQ----------
Q7SG59_NEUCR/43-514-------------------RDSFKTFIPL-SV-------D-NRARTEIIFQFFDLLSAVAA--H....GK----------
Q0CXG4_ASPTN/42-520-------------------PDAFSTFIPI-SV-------D-SDARSQIIFDFFDLLTAIAA--H....GK----------
Q2HFE8_CHAGB/40-505-------------------RAALLGGTPT-SF-------.-SRSESMIIFDFFDLLAAIAA--H....SK----------
Q6FSL9_CANGA/50-452-------------------RKSFLEIMPQ-CL-------A-SPNHASIVYDFFDLIVTISS--N....SK----------
A6ZP33_YEAS7/67-473-------------------RKSFLEIMPQ-CL-------A-SPNHASIVYDFFDLIISISS--N....SR----------
A7ELT0_SCLS1/44-518-------------------RDAFVTFIPL-SV-------E-SDARRDIIFDFFDLLSAIAA--H....GK----------
A7TPE0_VANPO/50-442-------------------TRAFLEIVPE-SL-------T-SYAHNSVVYDFFELILTFTS--K......----------
A7TL24_VANPO/23-432-------------------QKAFLEIMPK-CL-------S-SSNHASIVYDFLDLIVTIAS--N....SK----------
Q59KA9_CANAL/47-455-------------------KNAFLSIMPK-CL-------S-SPAHASIVYDFLDLILSITS--N....SQ----------
A3LX57_PICST/32-439-------------------KNAFLSIMPK-CL-------S-SPAHASIVYDFLDLLISITS--N....SQ----------
A6R3W6_AJECN/42-521-------------------RDAFSTFIPL-SV-------E-SDSRTKIIFDFFDLMSAIAA--H....GK----------
Q75ED0_ASHGO/35-426-------------------SDAFMQVLPG-CL-------S-SSSHASIVYDFFDLLVAVAA--N....VS----------
A5DVE6_LODEL/31-437-------------------KNAFLTIMPK-CL-------S-SPAHASIVYDFLDLLLSVIA--N....SQ----------
Q6CUF4_KLULA/45-447-------------------QKSFLEIMPK-CL-------D-SPNHASIVYDFFDLIVTMAS--N....SK----------
MUG8_SCHPO/44-440-------------------VRGFDIFMKH-AT-------K-HSCHFNILKCFLKLLMSLSA--KLAVSSN----------
Q6C001_YARLI/164-665-------------------HDAFLTLIPR-CI-------S-TEAHASILYDFMDLLAAIAT--H....GK----------
Q75EK6_ASHGO/152-598-------------------TSAFFMLLKQ-VL-------P-SHDYMCTTYAFLEILVTIVG--R......----------

PF00616

RASL1_MOUSE/321-510-------------------LGSVVDAIVS.ST.GR....C.PLALRLAFKQLQRCVEKRFS--G----IE..........
Q75DK0_ASHGO/576-771-------------------AKEIWHIIYK.TS.ND....L.PDAIKVQLTHIRKKLEIVCG--D----SN..........
Q757I8_ASHGO/1558-1726-------------------LNKLVDSIVG.SV.AD....F.PPEFFVICQSIYSSVKENF.--.----............
RGAA_DICDI/239-445-------------------CEQFLDGIIS.SL.NR....L.PYGIRWICKQIYQIAEKNFT--K----ST..........
A5DN39_PICGU/903-1097-------------------VSEILSTLEA.VV.ES....V.PLHIRIACKYAFDLVKINFP--E----KT..........
GAPD1_MOUSE/152-353-------------------VNKFIGYLKQ.NT.YC....F.PHSLRWIVSQMYKTLSCVDR--L----EV..........
GAP2_DROME/495-668-------------------VRGAWQCIFE.SH.KH....F.PAQLRNCFATFRERLQQLG.--.----RQ..........
Q0URT8_PHANO/796-948-------------------TEEVWRAIYN.SI.SR....C.PQELRLIFRHIRACAEDRYG--D----YL..........
A5DR10_PICGU/619-844-------------------CEEIWDKICK.TS.KD....L.PEQIKKQLKNFRTKVELACD--P----ED..........
Q6BPM2_DEBHA/608-836-------------------AEEVWNKIYI.TS.ND....L.PQQIKSQLKNFRTKVELSCD--P----DD..........
A3GHY3_PICST/1310-1472-------------------FNKLVDSIVS.SA.ES....L.PDSFKFICAEVYRCVQKKF.--.----.E..........
Q0V6E4_PHANO/854-1062-------------------ADQYFSMFEE.IL.HR....M.PYGVRYLAQQMFEELRLQFP--Y----EA..........
Q6CFR5_YARLI/832-1039-------------------TSEFLHTIES.SV.LQ....L.PYHVRYVARECYRSVQKTFP--H----ES..........
IQGA2_MOUSE/938-1150-------------------TDKVLGSIIS.SL.DL....L.PYGLRYIAKVLKNSIREKFP--D----AT..........
A5E5Z0_LODEL/955-1161-------------------CHEFFGKVQK.CV.DK....I.PHHIRVLCREAYVLSKSRYP--E----KS..........
Q5AH02_CANAL/977-1177-------------------CSDLLSMLQKNASGNKALLQI.PDHVKLICRQGYLCAQRKFP--D----KS..........
A3LY27_PICST/921-1130-------------------ATEFLNTLEL.SA.DR....V.PLHVKVICKQAYELSQLQFP--E----KS..........
A6ZW14_YEAS7/881-1068-------------------IEMVAEIYTR.KV.HT....I.PVEIRYLCTKIFCYAADKNI--.----............
A7TK28_VANPO/900-1076-------------------VEMIAEIFTS.RI.EA....I.PVEIRYLCSKIFTFAADQNY--.----............
Q6FSF6_CANGA/864-1037-------------------IEMIAEIFSR.KT.NE....I.PVELRYICTKTLCYFADKNI--.----............
Q6CR01_KLULA/879-1073-------------------VCAVLDHIVS.ST.........RNDLKYLASRAYRSSANKDT--.----............
A7RYQ9_NEMVE/151-314-------------------CTLFVQSLEE.KL.YC....F.PSSLRWLVCQLYNTLKTKGK--M----SD..........
Q1PQE2_DROMI/101-305-------------------AQVFVKSLQQ.SW.AL....F.PSSLRWLLQTLSQQLRQTHR--H----KE..........
RME6_CAEEL/161-355-------------------VDTFLENISK.AL.PM....L.PPNLNWIIRDIFCSLYEVVD--D----V...........
Q54F48_DICDI/1131-1337-------------------SGEFLRRVCALSS..S....I.PYALRWISKVVIELWRQHVK--Q----QRKPDFVP....
Q869U6_DICDI/119-289-------------------SNRLSEIITSQESLDK....M.PMSIKVIAMFFHEIWPQD..--.----............
A2G1P2_TRIVA/157-304-------------------ASLFTDKLLE.NI.PF....M.PSLLRYFFRRAFVAAQEIFG--E----DS..........
Q9XVW6_CAEEL/11-201-------------------MSVLSKYLKNDEA..D....L.AEEREAVRSALSNIFSVKPP--A----PD..........
Q6BG44_PARTE/169-435-------------------INSICDNILN.SL.HN....L.PFMIRALCRLQYQIFKVLYQ--S----YK..........
RASL2_HUMAN/323-512-------------------LGALLSALSR.SV.RA....C.PAVVRATFRQLFRRVRERF.--.----PGA.........
A2CE77_DANRE/319-508-------------------LSELLTSILQ.SA.SY....C.PLLICQVFHQLYLRVQERF.--.----PDP.........
Q66JF5_XENTR/327-516-------------------LSDIIDAILR.SV.EQ....C.PSGMRLCFKQLHKRVEEQF.--.----PGA.........
Q4T1V0_TETNG/259-481-------------------LSSITEAIVG.SV.SQ....C.PPVMRVTFKQLHKRVEERF.--.----TEPENEVGPHSK
RASA3_RAT/351-524-------------------VDRIFSVITK.SG.VS....C.PTVMCDIFFSLREAAAKRF.--.----QD..........
RASA2_HUMAN/377-550-------------------VDKLFNTIVK.SS.MS....C.PTVMCDIFYSLRQMATQRF.--.----PN..........
A7RYE3_NEMVE/344-517-------------------VNKLCAAITC.SA.MA....C.PTAMSKVFVTIRESAVQRF.--.----SD..........
Q0C7B1_AEDAE/426-599-------------------VEKVFEAITK.SA.VK....C.PAVLCQIFHDLRECAAKYF.--.----PQ..........
NGAP_DICDI/596-769-------------------VKKMTTAILS.SV.NN....C.PGPLREVFKSIQDKVVQRY.--.----PK..........
A7SJB4_NEMVE/409-582-------------------LFEAIDAIFT.SA.EE....C.PKTLRYLFGCLQQNVKDKW.--.----AD..........
Q4RUN4_TETNG/812-985-------------------LSELVEKIFM.AA.EI....L.PPTLRFIYGCLQKSVQQKW.--.----PN..........
Q17P86_AEDAE/660-835-------------------LDQVTQSIFT.SP.DA....C.PRTVRYICNCLQKAVVAKWP--S----PN..........
Q4TC99_TETNG/266-437-------------------CELAFCKILD.SY.KV....F.PRELKEVFASWRQECSNR.R--R----............
Q4TB25_TETNG/371-543-------------------CELAFCKIIN.TY.CV....F.PRELKEVFAAWRQQCLVRGH--R----............
Q4SJ24_TETNG/320-491-------------------CELLLCKIIN.SL.CI....F.PRELKEVFASWRARCAER.G--R----............
Q6KAS9_MOUSE/518-689-------------------CEEVFENIIH.SY.NC....F.PAELGSVFSSWREACKAR.G--S----............
A6ZJ45_CAEEL/167-340-------------------VEVAWTKILN.NV.HQ....L.PKNLRDVFSALRCRLEAQ.N--R----............
A8XP25_CAEBR/203-376-------------------VEVAWTKIIN.SV.HM....V.PKILGKVFATLRLRLEAQ.N--R----............
A7SKG2_NEMVE/244-412-------------------AEKAWNHILC.SS.CI....F.PCDLQDTFHEFRQRSIN..G--S----............
Q0CSQ0_ASPTN/793-964-------------------TTSVWKSIAG.SA.SR....C.PAELRLIFRHIRACAEDRY.--.----GDF.........
Q2GTK6_CHAGB/605-776-------------------TTDIWDCIVS.SA.AR....L.PPELRHILKYIRAVAEDRY.--.----GDF.........
Q7RW81_NEUCR/919-1092-------------------TSAVWRCIAS.SA.HR....L.PSEIRHVLKYIRAVAEDRY.--.----GHF.........
Q6C802_YARLI/650-829-------------------AETIWVNIRN.TI.AD....I.PQSLVVVFQYLRQQLEGLH.--.----QD..........
A3LZE1_PICST/612-848-------------------VEEVWHKIYI.TS.ND....L.PAQIKIQLKNFRTKVELACD--P----DD..........
Q5A506_CANAL/642-872-------------------VEEIWYKIYI.TS.ND....L.PDQIKLQLKNFRTKVELVCD--P----ED..........
A5E274_LODEL/753-994-------------------AEEIWHKIYI.TS.ND....I.PEQIKLQLKNFRTKVELVCE--P----ND..........
Q6FNM9_CANGA/542-738-------------------VCTIWNRIIE.TS.ND....L.PKKIKKQLHELRKGFEIICL--E----KG..........
BUD2_YEAST/541-721-------------------VTKIWKRLYA.TS.ND....L.PIEIRNVLKIFRQKLEIICI--D----DT..........
Q6CW67_KLULA/546-743-------------------AERTWKLIFE.TS.ND....L.PQGIKTQLKCFRKKLEIIEP--D----EKI.........
Q4P4C4_USTMA/677-887-------------------SESMWQNIYR.QR.HS....C.PPDLRTVLHKVRTKVNERYR--G----TK..........
Q8SSU4_DICDI/586-757-------------------SQKFFDRIIN.SI.EQ....C.PKSIIEICYYFKKIVSRKF.--.----............
Q55CR5_DICDI/1772-1943-------------------CEKFTDAIID.SV.EN....L.PASLREISSYLQQEVVKKF.--.----............
Q54RT3_DICDI/342-510-------------------CQEFLYAIYN.SL.DS....C.PLPFREMANHLQKEVVKVF.--.----............
Q54Q13_DICDI/104-276-------------------TQQLLDKILD.SV.DQ....C.PLPIRQILNHTQEKVEKRF.--.----............
NF1_RAT/1258-1432-------------------TEKFFHAIIS.SS.SE....F.PSQLRSVCHCLYQVVSQRF.--.----............
Q8IMS2_DROME/1300-1475-------------------TQKVFDAIIN.SS.DR....F.PPQLRSMCHCLYQVLSKRF.--.----..P.........
Q54T13_DICDI/179-351-------------------CSSFITAIKA.SLADQ....L.PIEIRQICQIINQLVEKKYP--N----DN..........
NFAA_DICDI/68-259-------------------AQQFLDRITDPSVVVE....M.PREIRAIADYTAESALRYA.--.----............
Q6FJ13_CANGA/1767-1935-------------------MSKLINAITE.SV.DY....F.PPELINICQTIFHSVKEKF.--.----............
IRA1_YEAST/1730-1898-------------------MTRLIDAITS.SI.DD....F.PIELVDICKTIYNAASVNF.--.----............
A7TN87_VANPO/1674-1842-------------------MKILIDAIIG.SI.DC....F.PVELFVVCQVIYSEVRKKF.--.----............
Q6CMT2_KLULA/1529-1697-------------------MTKVVDAITG.SV.DS....F.PPQFFVICQAIHSSASERF.--.----............
IRA2_YEAST/1722-1890-------------------MNELLESISN.SV.SY....F.PPPLFYICQNIYKVACEKF.--.----............
Q6FQA1_CANGA/1674-1842-------------------MNKILDSITD.SL.SY....M.PPELFYICQGIYQNVKEKF.--.----............
A7TEG6_VANPO/1672-1840-------------------MDKVITSIEK.SI.TY....F.PPDFFSICQNIHTTTLEKF.--.----............
A5E1X9_LODEL/1368-1531-------------------FEQTVQLITD.SL.ED....L.PEAFKYVCHVISETVSAKF.--.----............
Q5A3W3_CANAL/1300-1463-------------------LSRIIDSIVN.ST.DK....L.PHAFKSVSKAIYDSVSNKF.--.----............
Q8WZX6_NEUCS/1323-1495-------------------ANVFIDDICA.SS.AR....I.PPSFRKICSIIAAAVMPRF.--.----............
A6SKM1_BOTFB/602-772-------------------TKVFIDDICN.SA.SR....I.PVSFRKICNIISSCVMRRF.--.----............
Q4PF31_USTMA/1621-1793-------------------AQAFIDAICS.SA.HR....V.PAVLRELCRHIRNVLDARF.--.----............
Q5KFG6_CRYNJ/1321-1493-------------------CQALLDLICS.ST.PR....V.PLMFRAVCHHIWEVVDDRF.--.----............
A2E9Q3_TRIVA/1023-1197-------------------LRKAIDTILS.AL.KS....I.PLAIVRVIQILYKRINEVFD--G----LG..........
A2FFI6_TRIVA/1018-1191-------------------LLSTISTILS.AL.RS....L.PIPVVRAAQIIYHRINEVYD--G----LG..........
A2GF60_TRIVA/1036-1210-------------------LQKTVQAILD.GQ.TT....M.PDSLTYASQIIFEKVFEKVG--E----FA..........
A2DLG7_TRIVA/987-1164-------------------FIKSIDIITN.SI.PR....L.PTQIIRMVQIVYKKVAEKFQ--D----............
A2FB27_TRIVA/1019-1186-------------------FSDFVNQFEN.NI.ET....M.PRGLIKAAQILYNSIVNQSQ--F----VA..........
Q4DY44_TRYCC/96-330-------------------AYRISNVVYA.SV.CQ....W.PWSLRQSLRCLLETVGASFR--D----DVHLGPT.....
A2DU37_TRIVA/325-480-------------------ILMFADTVMN.SF.DK....I.PRAIRHLATHIFYATECTLG--T----W...........
A2EAY4_TRIVA/330-471-------------------VFTVINRICS.SL.NH....I.PPEMRHFASILKNAASIRFN--S----Q...........
A2G2R5_TRIVA/334-477-------------------LNSVLDKLLS.SG.PY....I.PAQFHHLASILKICTAVVLR--S----K...........
Q86JJ7_DICDI/392-554-------------------FEYVLNIFQG.SC.EY....L.PPPFKKASIEIQNGLNKLSP--G----SK..........
A2R7H8_ASPNC/194-402-------------------ANRFLNIIIE.SV.EE....T.PYGIRWICKQIRSLSRRKYP--D----AQ..........
Q7S5G6_NEUCR/166-375-------------------ANGFLETIID.GL.EE....T.PYGIRWICKQIRSLTKRKYP--D----AN..........
Q6DNA0_SCHCO/171-379-------------------ANSFLLTIIE.SM.ES....V.PYGIRWICKQIRSLTRRKYP--E----AT..........
Q54I64_DICDI/185-392-------------------GDQFLDSILS.SV.DA....V.PYGIRWICKQIRELVKQKFP--Q----AT..........
A7S5U4_NEMVE/139-338-------------------SSLFLGIIIS.SL.SQ....V.PYGIQWLCRAIKELAMEKFP--E----AT..........
GAP1_SCHPO/175-379-------------------TKRFLDAVLN.SI.DE....I.PYGIRWVCKLIRNLTNRLFP--S----IS..........
GAPA_DICDI/274-481-------------------CERFFTGIIQ.SL.NR....L.PYGIRWICKQIQSIAQKNF.--D----SK..........
Q7SFX8_NEUCR/1171-1379-------------------CDQFLLALED.LL.PR....M.PYGLRFVCRQTYEALCQHFQ--R----DH..........
A7F2A6_SCLS1/1177-1385-------------------SDLFMLALES.LL.HR....M.PYGVRFICQQIFDGLCQQFP--R----ES..........
A2QP50_ASPNC/1125-1333-------------------ADQFFSAFEE.LL.YR....M.PFGIRYIAKQMYESLLARFP--Q----EN..........
A6R4D6_AJECN/1034-1242-------------------ADQFFTSLEE.YL.PR....M.PFGVRFVAQQIYEHLLSKFE--N----ED..........
Q4P2J5_USTMA/1116-1323-------------------TEAFLSAILS.ST.RK....M.PYGVRYIAREVFRALQSKFP--D----EP..........
Q5KM85_CRYNJ/1428-1635-------------------TDFLLTDLLQ.SH.DK....L.PYTIRLMAREALLALQRKFP--E----AM..........
Q4RUQ1_TETNG/412-624-------------------TDKVLNSIVS.SL.DN....L.PYGMRYIAKVLKNSLHEKFP--D----SS..........
Q8BPA6_MOUSE/45-257-------------------TDKFLSAIVS.SV.DK....I.PYGMRFIAKVLKDSLHEKFP--D----AG..........
A7SXE3_NEMVE/113-325-------------------TDKFLNSIVQ.SV.EK....I.PYGMRYVAMTLRLALTEKFP--N----LS..........
Q9XZE9_HYDVU/1010-1222-------------------SDKFLNHFIK.SI.DK....I.PYGMRFIQIPYKESLREKFP--E----AK..........
A2RRC9_HUMAN/1009-1221-------------------TDKFLLAITS.SV.DQ....I.PYGMRYVAKVLKATLAEKFP--D----AT..........
Q4SWD5_TETNG/1049-1261-------------------TDRVLNAVTS.SL.GK....L.PYGLRYSAKVLRDALQAKFP--G----AS..........
RNG2_SCHPO/875-1077-------------------CQSFLVALSK.NI.EN....I.PYALCYTAAQLKNSLQRYFP--A----AH..........
Q8SUA0_ENCCU/433-602-------------------ITSTLDFLES.SV.ES....I.PYILRYFLKLYG........--.----............
Q552W4_DICDI/717-964-------------------GNAFLERITK.SI.EQ....L.PVQLRYLCRIIAEKSKYAFP--T----NNTNNHHNGGGI
A0DYI4_PARTE/179-497-------------------VNNIMENIFK.NI..Y....LIPQGIRIICKMIQITILKKFP--D----AT..........
A0BIL6_PARTE/179-498-------------------VNNIMENIFK.NI..Y....LIPQGIRIICKMIQITILKKFP--D----AT..........
Q23D35_TETTS/318-639-------------------TNIVFDSIFK.NL.YN....I.PVPIRITCKIIEIVTKEKFQ--N----IS..........

PF00620

RHG05_MOUSE/1274-1425----------------------------I............NLMTADNL-------------------------------
SYDE_DROME/968-1123----------------------------R............NKMSAQAL-------------------------------
LRG1_YEAST/755-912----------------------------IEN.......EMGSKMDIHNL-------------------------------
P85B_MOUSE/125-265----------------------------S............PDTAVHAL-------------------------------
I5P2_MOUSE/830-972----------------------------N............NHLDENIL-------------------------------
RHG07_HUMAN/1092-1238----------------------------E............NQMTPTNL-------------------------------
RHG28_HUMAN/399-552----------------------------K............NRMSLWNI-------------------------------
ARAP2_HUMAN/1129-1281----------------------------I............NHMNAHNL-------------------------------
MYO9A_HUMAN/2076-2225----------------------------T............NRMSANAL-------------------------------
Q20442_CAEEL/896-1053----------------------------V............NNMTAQNL-------------------------------
RHG18_HUMAN/343-492----------------------------K............NKMTVMNV-------------------------------
ARAP1_HUMAN/971-1120----------------------------T............NQMNVHNL-------------------------------
PAC1_CAEEL/963-1123----------------------------V............NKMECRNL-------------------------------
Q9V4C2_DROME/875-1034----------------------------DIWSTEGCCLTLGNKMDSYNL-------------------------------
HMHA1_HUMAN/775-947----------------------------D............NKMTPGNL-------------------------------
GMIP_HUMAN/565-728----------------------------E............NKMSANNL-------------------------------
RHG32_HUMAN/386-538----------------------------I............TNMHAKNL-------------------------------
RG190_DROME/1364-1529----------------------------L............NSMDSKNL-------------------------------
RG92B_DROME/265-418----------------------------L............NKMSSQNL-------------------------------
RGAP1_ARATH/155-296----------------------------L............NKMDSHSL-------------------------------
BCR_HUMAN/1068-1221----------------------------V............NKMSLHNL-------------------------------
RHG21_HUMAN/1161-1314----------------------------K............NKMEPRNL-------------------------------
RHG24_MOUSE/151-304----------------------------V............NKMSAQNL-------------------------------
RHG17_RAT/266-415----------------------------V............NKMTPSNI-------------------------------
RHG20_HUMAN/377-527----------------------------S............NQMTAFNL-------------------------------
RBP1_RAT/210-356----------------------------E............TKMNIQNI-------------------------------
CHIN_MOUSE/282-436----------------------------E............NLMSAENL-------------------------------
RHG09_HUMAN/556-726----------------------------K............NRMTPHNL-------------------------------
FNBP2_HUMAN/505-657----------------------------E............NMMDPYNL-------------------------------
Q9VDE9_DROME/1154-1302----------------------------VS..........CTKMDSSNL-------------------------------
RRC1_CAEEL/294-443----------------------------L............TDMTSKNL-------------------------------
RHG35_RAT/1262-1413----------------------------V............NLMTSENL-------------------------------
RHG39_HUMAN/909-1055----------------------------V............TKMDVSNL-------------------------------
Q9W4A9_DROME/319-473----------------------------V............NKMNEHNL-------------------------------
Q8MSA6_DROME/346-502----------------------------D............NKMSLHNL-------------------------------
RGA3_SCHPO/794-942----------------------------K............NLMNSKNV-------------------------------
RGA4_SCHPO/761-910----------------------------A............NRMTSKNL-------------------------------
MYO9B_RAT/1673-1822----------------------------V............NRMSPGAL-------------------------------
RGA1_YEAST/805-985----------------------------W............NRMTLYNL-------------------------------
Q9P8F2_ZYGRO/832-1008----------------------------W............NLMNLYNL-------------------------------
RGA2_YEAST/802-985----------------------------R............NLMNLHNL-------------------------------
Q8R1F4_MOUSE/140-291----------------------------K............NRMTYQSI-------------------------------
TG325_CAEEL/624-775----------------------------Q............NRMQQHNL-------------------------------
Q9VWL9_DROME/292-441----------------------------S............NRMPSTNL-------------------------------
CDGAP_DROME/438-593----------------------------R............TGMTDKNL-------------------------------
O13384_COCHE/545-692----------------------------I............NRMSTANL-------------------------------
RGA7_SCHPO/520-671----------------------------V............NKMSTNNL-------------------------------
Q95TR0_DROME/586-741----------------------------V............NRMEPKNL-------------------------------
RGD1_YEAST/486-644----------------------------Q............NRMNLRAL-------------------------------
BEM2_YEAST/1981-2141----------------------------N............NKMDASNL-------------------------------
ARAP3_HUMAN/920-1071----------------------------L............NQMCTRNL-------------------------------
Q8T3K2_DROME/784-935----------------------------K............NKMSVQNL-------------------------------
O60432_HUMAN/255-431----------------------------Y............NRMTPQNL-------------------------------
Q9N9Z9_DROME/395-545----------------------------.............VLMPIDNI-------------------------------
Q9BZ74_HUMAN/363-512----------------------------.............TKMNVANL-------------------------------
Q95VR1_9HYME/3-152----------------------------.............CKMPKSNL-------------------------------
Q9XUS9_CAEEL/437-588----------------------------R............NKMNCEAM-------------------------------
O00886_DICDI/28-181----------------------------V............NKMTSQNL-------------------------------
RHG01_HUMAN/260-408----------------------------Q............NKMTNTNL-------------------------------
RHG08_MOUSE/210-360----------------------------S............NKMNSSNL-------------------------------
RG68F_DROME/292-439----------------------------L............NKMTSSNL-------------------------------
Q23130_CAEEL/263-421----------------------------V............NLMTANNL-------------------------------
FA13B_MOUSE/39-190----------------------------.............EIWSANSL-------------------------------
Q8VHL8_MOUSE/532-684----------------------------E............NMMDSYNL-------------------------------
Q19370_CAEEL/541-693----------------------------E............NMMEPHNL-------------------------------
O82458_LOTJA/159-296----------------------------F............NKMNARNI-------------------------------
O01443_CAEEL/529-695----------------------------DRHDED.GELLSGNKMDARNL-------------------------------
RHG06_HUMAN/411-572----------------------------DNISKD.GQEVTGNKMTSLNL-------------------------------
Q8SY28_DROME/579-731----------------------------Q............NQMTSNNL-------------------------------
Q8T0G4_DROME/380-537----------------------------I............NKMNVHNV-------------------------------
RGA1_SCHPO/862-1019----------------------------IDD.......EVGSKMDIHNL-------------------------------
TAGAP_HUMAN/101-250----------------------------V............NRMDSSNL-------------------------------
Q9DAP3_MOUSE/308-455----------------------------I............THMTAYAL-------------------------------
Q9XW53_CAEEL/264-412----------------------------.............SKMNASSL-------------------------------
BEM3_YEAST/927-1096----------------------------F............NKMNLRNL-------------------------------
RGA2_SCHPO/1083-1234----------------------------V............NKMNIRNV-------------------------------
Q8RWQ4_ARATH/176-325----------------------------E............NRMNPNAV-------------------------------
YIL2_SCHPO/178-325----------------------------E............NMMNAQNL-------------------------------
RGA6_SCHPO/332-510----------------------------ELENGM.ENTKDSTLMKPEAL-------------------------------
RGA5_SCHPO/68-226----------------------------K............NLMTADNL-------------------------------
BAG7_YEAST/76-235----------------------------K............NLMSASNL-------------------------------
P85AA_XENLA/128-280----------------------------K............NLLSAKSL-------------------------------
OCRL_HUMAN/735-875----------------------------Y............NSVNANMI-------------------------------
Q8STW6_ENCCU/162-313----------------------------A............TEMNIDSL-------------------------------
Q8SRX9_ENCCU/91-256----------------------------GKN........HKDNMNMEGI-------------------------------
O96601_PLAFA/109-259----------------------------E............NNMTILAL-------------------------------
Q9VUR5_DROME/55-207----------------------------S............TGMTSEAL-------------------------------

PF08101

Q0TZ65_PHANO/41-476----------------------------T------------NGMGGRKL.SRLAGWWAFEFAED.G..............
A5DN67_PICGU/33-435----------------------------Y------------NYLSGRKI.AKMSSLWAFNPARE.RMKSAFYDATID...
Q7SG59_NEUCR/43-514----------------------------M------------NGFGGRKL.SRMAAWWAFEHDDG.G..............
Q0CXG4_ASPTN/42-520----------------------------S------------NGLGGRKL.SRYAGWWAFEHTDT.G..............
Q2HFE8_CHAGB/40-505----------------------------S------------NGFGGRKL.SRMAAWWAFEPNDN.G..............
Q6FSL9_CANGA/50-452----------------------------K------------NKMSARKI.SKMCAIWAFNDN...KSSSTDYDFDSSSP.
A6ZP33_YEAS7/67-473----------------------------V------------NKMSARKI.SKMCAIWAFSKQIP.NSDIQDYDFESAAMK
A7ELT0_SCLS1/44-518----------------------------L------------NGLAGRKL.SRYAGWWAFDHVDT.G..............
A7TPE0_VANPO/50-442----------------------------.------------TGLHTTQI.AYIFSLWAFEYPSQ.YKDGFQKQILT....
A7TL24_VANPO/23-432----------------------------I------------NKLSARKI.SKMSAIWAFNNKEF.PRNLSDENINLPE..
Q59KA9_CANAL/47-455----------------------------F------------NYLSGRKI.SKMASFWAFSCRQQ.FLQSPFYDATQEE..
A3LX57_PICST/32-439----------------------------Y------------NYLSGRKV.TKMASIWAFNPTSK.LSKSAFYDATIN...
A6R3W6_AJECN/42-521----------------------------T------------NGFGGRKL.SRYAGWWAFEHVDT.G..............
Q75ED0_ASHGO/35-426----------------------------E------------NRMSGRKV.AKMSAIWAFGDYRH.PDGGGN.........
A5DVE6_LODEL/31-437----------------------------Y------------NYLSGRKV.SRMASFWAFNSNLNVRNKLVFADFDNE...
Q6CUF4_KLULA/45-447----------------------------K------------NKMSARKI.SKMCAVWAFQMD...QDTATNMIFDARR..
MUG8_SCHPO/44-440----------------------------S------------STVSSLELVSQIASIWAFDWPMM.N..............
Q6C001_YARLI/164-665----------------------------K------------NGMGGRKL.ARLAGSWAFDVNTG.A..............
Q75EK6_ASHGO/152-598----------------------------.------------TDLLVEKT.TQMDLIFTAGQVCF.PSCKAVEEYKDAN..

PF00616

RASL1_MOUSE/321-510......................HQDV.KY------------LAISGFLF-------------------------------
Q75DK0_ASHGO/576-771......................LKTV..L------------NCISGFLF-------------------------------
Q757I8_ASHGO/1558-1726......................PDSA..E------------IAVGSFIF-------------------------------
RGAA_DICDI/239-445......................QDEI..L------------KVIGYFIY-------------------------------
A5DN39_PICGU/903-1097.......................NLQ..H------------LAVAGVIF-------------------------------
GAPD1_MOUSE/152-353.......................GEV..R------------AMCTDLLL-------------------------------
GAP2_DROME/495-668.......................DMA..D------------NLISASIF-------------------------------
Q0URT8_PHANO/796-948......................RTVA..Y------------SSVSGFLF-------------------------------
A5DR10_PICGU/619-844......................KVTA..L------------NCLSAFIF-------------------------------
Q6BPM2_DEBHA/608-836......................KVTA..L------------NCLSSFIF-------------------------------
A3GHY3_PICST/1310-1472.......................DAA..L------------IAVGSFVF-------------------------------
Q0V6E4_PHANO/854-1062......................QEQL..L------------VIVGHWVW-------------------------------
Q6CFR5_YARLI/832-1039......................EDRH..L------------AVIGVVLV-------------------------------
IQGA2_MOUSE/938-1150......................EEEL..L------------KIVGNLLY-------------------------------
A5E5Z0_LODEL/955-1161.......................SKQ..H------------MAVAGVVF-------------------------------
Q5AH02_CANAL/977-1177.......................DQQ..H------------LAVAGVIF-------------------------------
A3LY27_PICST/921-1130.......................DQQ..H------------LAVAGVVF-------------------------------
A6ZW14_YEAS7/881-1068.......................EEIDSL------------RAISSILV-------------------------------
A7TK28_VANPO/900-1076.......................DQTSSL------------RCISKIVV-------------------------------
Q6FSF6_CANGA/864-1037.......................CEEEAL------------KAISMVLI-------------------------------
Q6CR01_KLULA/879-1073.......................EESSAL------------SAISKIVV-------------------------------
A7RYQ9_NEMVE/151-314.......................REA..K------------SMVSELLF-------------------------------
Q1PQE2_DROMI/101-305.......................QEI..R------------QLLTDLVF-------------------------------
RME6_CAEEL/161-355.......................SAIELS------------HACKDMIV-------------------------------
Q54F48_DICDI/1131-1337................SEISKVRDKQEER------------EFIIRLIF-------------------------------
Q869U6_DICDI/119-289.......................DQG..G------------QGVSNFLI-------------------------------
A2G1P2_TRIVA/157-304.......................QQP..T------------QLIEIFFF-------------------------------
Q9XVW6_CAEEL/11-201......................RTWQDTF------------VTLQPFIF-------------------------------
Q6BG44_PARTE/169-435......................QEEI..F------------NLLIQFFI-------------------------------
RASL2_HUMAN/323-512....................QHENVP..F------------IAVTSFLC-------------------------------
A2CE77_DANRE/319-508....................EYRKVK..F------------IAVTSFLC-------------------------------
Q66JF5_XENTR/327-516....................VYQDVK..Y------------AAISGFLF-------------------------------
Q4T1V0_TETNG/259-481CTFSHSGNADRCRVFMLKLHCRQDVK..Y------------LAISGFFF-------------------------------
RASA3_RAT/351-524.....................DLDVR..Y------------TAVSSFIF-------------------------------
RASA2_HUMAN/377-550.....................DPHVQ..Y------------SAVSSFVF-------------------------------
A7RYE3_NEMVE/344-517.....................EPDVR..Y------------TAVSGFVF-------------------------------
Q0C7B1_AEDAE/426-599.....................NKEVR..Y------------SVVSGFIF-------------------------------
NGAP_DICDI/596-769.....................DEITR..Y------------TAVSGFIF-------------------------------
A7SJB4_NEMVE/409-582.....................NQTVR..T------------RVVSGFLF-------------------------------
Q4RUN4_TETNG/812-985.....................NTTMR..T------------RVVSGFVF-------------------------------
Q17P86_AEDAE/660-835.....................ERLVR..T------------RVVSGFIF-------------------------------
Q4TC99_TETNG/266-437......................PDIS..E------------RLISASLF-------------------------------
Q4TB25_TETNG/371-543......................EDIG..K------------RLISSSLF-------------------------------
Q4SJ24_TETNG/320-491......................EDMA..D------------SLISSSLF-------------------------------
Q6KAS9_MOUSE/518-689......................EALG..P------------RLVCASLF-------------------------------
A6ZJ45_CAEEL/167-340......................EALA..D------------TLISSSIF-------------------------------
A8XP25_CAEBR/203-376......................GEHA..E------------TIISSSIF-------------------------------
A7SKG2_NEMVE/244-412......................RDLS..N------------KLISASIF-------------------------------
Q0CSQ0_ASPTN/793-964.....................LRTVT..Y------------SSVSGFLF-------------------------------
Q2GTK6_CHAGB/605-776.....................LRTVT..Y------------TSVSGFLF-------------------------------
Q7RW81_NEUCR/919-1092.....................IRTATAVY------------TSVSGFLF-------------------------------
Q6C802_YARLI/650-829......................EEVV..F------------NGISGFLF-------------------------------
A3LZE1_PICST/612-848......................KTTP..L------------NCLSAFIF-------------------------------
Q5A506_CANAL/642-872......................KVTS..L------------NCLSAFIF-------------------------------
A5E274_LODEL/753-994......................KVTS..L------------NCISAFIF-------------------------------
Q6FNM9_CANGA/542-738......................QQSI..L------------NCISAFLF-------------------------------
BUD2_YEAST/541-721......................LQII..L------------NGISGLLF-------------------------------
Q6CW67_KLULA/546-743.....................SSKSL..L------------NCISGFLF-------------------------------
Q4P4C4_USTMA/677-887.......................STRPGI------------QGVGAFVF-------------------------------
Q8SSU4_DICDI/586-757......................PTHW..K------------SAVGGFIF-------------------------------
Q55CR5_DICDI/1772-1943......................PDNK..Y------------SSVGGFIF-------------------------------
Q54RT3_DICDI/342-510......................PESK..H------------TSVGGFIF-------------------------------
Q54Q13_DICDI/104-276......................KSMK..T------------TVVGGFIF-------------------------------
NF1_RAT/1258-1432......................PQNS..I------------GAVGSAMF-------------------------------
Q8IMS2_DROME/1300-1475....................NLLQNN..I------------GAVGTVIF-------------------------------
Q54T13_DICDI/179-351............................I------------KSVGGFFF-------------------------------
NFAA_DICDI/68-259......................PESL..A------------PLVGGFIM-------------------------------
Q6FJ13_CANGA/1767-1935......................PDYS..F------------IAVGSFVF-------------------------------
IRA1_YEAST/1730-1898......................PEYA..Y------------IAVGSFVF-------------------------------
A7TN87_VANPO/1674-1842......................PEYS..L------------VAVGSFVF-------------------------------
Q6CMT2_KLULA/1529-1697......................PEYA..D------------IAVGSFLF-------------------------------
IRA2_YEAST/1722-1890......................PDHA..I------------IAAGSFVF-------------------------------
Q6FQA1_CANGA/1674-1842......................PDYA..L------------VAVGSCMF-------------------------------
A7TEG6_VANPO/1672-1840......................PEHA..I------------IAVGSFFF-------------------------------
A5E1X9_LODEL/1368-1531......................ENAA..L------------SAVGSFLF-------------------------------
Q5A3W3_CANAL/1300-1463......................PEAA..L------------TAVSSFVF-------------------------------
Q8WZX6_NEUCS/1323-1495......................SEAK..Y------------TAVGAFIF-------------------------------
A6SKM1_BOTFB/602-772......................PDAK..F------------TAVGAFIF-------------------------------
Q4PF31_USTMA/1621-1793......................PASR..Y------------QGVGGLMF-------------------------------
Q5KFG6_CRYNJ/1321-1493......................PDSR..H------------SAVGSFIF-------------------------------
A2E9Q3_TRIVA/1023-1197............................I------------HIVFGFVF-------------------------------
A2FFI6_TRIVA/1018-1191............................I------------QIVYGFIF-------------------------------
A2GF60_TRIVA/1036-1210............................Y------------SILSSFLF-------------------------------
A2DLG7_TRIVA/987-1164.......................NHG..I------------MIVNGIIF-------------------------------
A2FB27_TRIVA/1019-1186............................V------------QAIASFIF-------------------------------
Q4DY44_TRYCC/96-330.................GSDMEMLTVLQQ------------NMMATIVV-------------------------------
A2DU37_TRIVA/325-480.......................EAT..F------------NSITNLFI-------------------------------
A2EAY4_TRIVA/330-471.......................QAT..Y------------NTLSGFFC-------------------------------
A2G2R5_TRIVA/334-477.......................HAV..Y------------NALSSFMY-------------------------------
Q86JJ7_DICDI/392-554............................S------------PPIGCLLF-------------------------------
A2R7H8_ASPNC/194-402......................DQTI..C------------TLIGGFFF-------------------------------
Q7S5G6_NEUCR/166-375......................DQII..C------------TLIGSFFF-------------------------------
Q6DNA0_SCHCO/171-379......................DYAI..C------------SLIGGFFF-------------------------------
Q54I64_DICDI/185-392......................RAQT..C------------GLIGGFFL-------------------------------
A7S5U4_NEMVE/139-338......................PEQI..N------------AMIGGFFL-------------------------------
GAP1_SCHPO/175-379......................DSTI..C------------SLIGGFFF-------------------------------
GAPA_DICDI/274-481......................PDEI..A------------KVIGYFVY-------------------------------
Q7SFX8_NEUCR/1171-1379......................PQNV..L------------QFVSNWLW-------------------------------
A7F2A6_SCLS1/1177-1385......................QRNL..L------------QLVGNWLF-------------------------------
A2QP50_ASPNC/1125-1333......................PGFI..L------------QTAGHWVW-------------------------------
A6R4D6_AJECN/1034-1242......................HGYV..L------------QVTGQWVW-------------------------------
Q4P2J5_USTMA/1116-1323......................QDAL..I------------KVVGHLVY-------------------------------
Q5KM85_CRYNJ/1428-1635......................DDDL..V------------PVVARTVI-------------------------------
Q4RUQ1_TETNG/412-624......................EDEL..M------------KIVGNLLY-------------------------------
Q8BPA6_MOUSE/45-257......................EDEL..L------------KIIGNLLY-------------------------------
A7SXE3_NEMVE/113-325......................EEEI..I------------KVVGNLVY-------------------------------
Q9XZE9_HYDVU/1010-1222......................DDEI..L------------KVVGNLIS-------------------------------
A2RRC9_HUMAN/1009-1221......................DSEV..Y------------KVVGNLLY-------------------------------
Q4SWD5_TETNG/1049-1261......................EDEL..Y------------KVVGNLVY-------------------------------
RNG2_SCHPO/875-1077......................KEEI..F------------GVIGKFVY-------------------------------
Q8SUA0_ENCCU/433-602.............................------------...PGMFY-------------------------------
Q552W4_DICDI/717-964SSDESGSTTANITLNNNRSKQLPENR..E------------KYISYFLI-------------------------------
A0DYI4_PARTE/179-497......................EQQI..Q------------ENIFSFLF-------------------------------
A0BIL6_PARTE/179-498......................EQQI..Q------------ENIFSFLF-------------------------------
Q23D35_TETTS/318-639......................DEDL..F------------TIIGYFLF-------------------------------

PF00620

RHG05_MOUSE/1274-1425--------------------------------------------------------------------------------
SYDE_DROME/968-1123--------------------------------------------------------------------------------
LRG1_YEAST/755-912--------------------------------------------------------------------------------
P85B_MOUSE/125-265--------------------------------------------------------------------------------
I5P2_MOUSE/830-972--------------------------------------------------------------------------------
RHG07_HUMAN/1092-1238--------------------------------------------------------------------------------
RHG28_HUMAN/399-552--------------------------------------------------------------------------------
ARAP2_HUMAN/1129-1281--------------------------------------------------------------------------------
MYO9A_HUMAN/2076-2225--------------------------------------------------------------------------------
Q20442_CAEEL/896-1053--------------------------------------------------------------------------------
RHG18_HUMAN/343-492--------------------------------------------------------------------------------
ARAP1_HUMAN/971-1120--------------------------------------------------------------------------------
PAC1_CAEEL/963-1123--------------------------------------------------------------------------------
Q9V4C2_DROME/875-1034--------------------------------------------------------------------------------
HMHA1_HUMAN/775-947--------------------------------------------------------------------------------
GMIP_HUMAN/565-728--------------------------------------------------------------------------------
RHG32_HUMAN/386-538--------------------------------------------------------------------------------
RG190_DROME/1364-1529--------------------------------------------------------------------------------
RG92B_DROME/265-418--------------------------------------------------------------------------------
RGAP1_ARATH/155-296--------------------------------------------------------------------------------
BCR_HUMAN/1068-1221--------------------------------------------------------------------------------
RHG21_HUMAN/1161-1314--------------------------------------------------------------------------------
RHG24_MOUSE/151-304--------------------------------------------------------------------------------
RHG17_RAT/266-415--------------------------------------------------------------------------------
RHG20_HUMAN/377-527--------------------------------------------------------------------------------
RBP1_RAT/210-356--------------------------------------------------------------------------------
CHIN_MOUSE/282-436--------------------------------------------------------------------------------
RHG09_HUMAN/556-726--------------------------------------------------------------------------------
FNBP2_HUMAN/505-657--------------------------------------------------------------------------------
Q9VDE9_DROME/1154-1302--------------------------------------------------------------------------------
RRC1_CAEEL/294-443--------------------------------------------------------------------------------
RHG35_RAT/1262-1413--------------------------------------------------------------------------------
RHG39_HUMAN/909-1055--------------------------------------------------------------------------------
Q9W4A9_DROME/319-473--------------------------------------------------------------------------------
Q8MSA6_DROME/346-502--------------------------------------------------------------------------------
RGA3_SCHPO/794-942--------------------------------------------------------------------------------
RGA4_SCHPO/761-910--------------------------------------------------------------------------------
MYO9B_RAT/1673-1822--------------------------------------------------------------------------------
RGA1_YEAST/805-985--------------------------------------------------------------------------------
Q9P8F2_ZYGRO/832-1008--------------------------------------------------------------------------------
RGA2_YEAST/802-985--------------------------------------------------------------------------------
Q8R1F4_MOUSE/140-291--------------------------------------------------------------------------------
TG325_CAEEL/624-775--------------------------------------------------------------------------------
Q9VWL9_DROME/292-441--------------------------------------------------------------------------------
CDGAP_DROME/438-593--------------------------------------------------------------------------------
O13384_COCHE/545-692--------------------------------------------------------------------------------
RGA7_SCHPO/520-671--------------------------------------------------------------------------------
Q95TR0_DROME/586-741--------------------------------------------------------------------------------
RGD1_YEAST/486-644--------------------------------------------------------------------------------
BEM2_YEAST/1981-2141--------------------------------------------------------------------------------
ARAP3_HUMAN/920-1071--------------------------------------------------------------------------------
Q8T3K2_DROME/784-935--------------------------------------------------------------------------------
O60432_HUMAN/255-431--------------------------------------------------------------------------------
Q9N9Z9_DROME/395-545--------------------------------------------------------------------------------
Q9BZ74_HUMAN/363-512--------------------------------------------------------------------------------
Q95VR1_9HYME/3-152--------------------------------------------------------------------------------
Q9XUS9_CAEEL/437-588--------------------------------------------------------------------------------
O00886_DICDI/28-181--------------------------------------------------------------------------------
RHG01_HUMAN/260-408--------------------------------------------------------------------------------
RHG08_MOUSE/210-360--------------------------------------------------------------------------------
RG68F_DROME/292-439--------------------------------------------------------------------------------
Q23130_CAEEL/263-421--------------------------------------------------------------------------------
FA13B_MOUSE/39-190--------------------------------------------------------------------------------
Q8VHL8_MOUSE/532-684--------------------------------------------------------------------------------
Q19370_CAEEL/541-693--------------------------------------------------------------------------------
O82458_LOTJA/159-296--------------------------------------------------------------------------------
O01443_CAEEL/529-695--------------------------------------------------------------------------------
RHG06_HUMAN/411-572--------------------------------------------------------------------------------
Q8SY28_DROME/579-731--------------------------------------------------------------------------------
Q8T0G4_DROME/380-537--------------------------------------------------------------------------------
RGA1_SCHPO/862-1019--------------------------------------------------------------------------------
TAGAP_HUMAN/101-250--------------------------------------------------------------------------------
Q9DAP3_MOUSE/308-455--------------------------------------------------------------------------------
Q9XW53_CAEEL/264-412--------------------------------------------------------------------------------
BEM3_YEAST/927-1096--------------------------------------------------------------------------------
RGA2_SCHPO/1083-1234--------------------------------------------------------------------------------
Q8RWQ4_ARATH/176-325--------------------------------------------------------------------------------
YIL2_SCHPO/178-325--------------------------------------------------------------------------------
RGA6_SCHPO/332-510--------------------------------------------------------------------------------
RGA5_SCHPO/68-226--------------------------------------------------------------------------------
BAG7_YEAST/76-235--------------------------------------------------------------------------------
P85AA_XENLA/128-280--------------------------------------------------------------------------------
OCRL_HUMAN/735-875--------------------------------------------------------------------------------
Q8STW6_ENCCU/162-313--------------------------------------------------------------------------------
Q8SRX9_ENCCU/91-256--------------------------------------------------------------------------------
O96601_PLAFA/109-259--------------------------------------------------------------------------------
Q9VUR5_DROME/55-207--------------------------------------------------------------------------------

PF08101

Q0TZ65_PHANO/41-476.....KG...FDGGYRTWEKAADAASHLFFAYLRSLAPESNTVGGI.SGLPRSLQSLLSQTEYPPQ.TPTLMQTHTT...
A5DN67_PICGU/33-435...RDHS...FIDGLDRWKQSSGALFHLLLSFLRAMLPENDMDTL...KLPKTLQSLLISNSYPPL.ANN.DSVKSM...
Q7SG59_NEUCR/43-514.....QG...FEGGYKSWLKAADATSHLFFAYLRCLAPLPTLG..AISTLPLSLQKLLQETEYPPQ.RPALLQSSTH...
Q0CXG4_ASPTN/42-520.....NG...FEAAYKNWSTAADATSHLFFAYLRSLSPET.RGMGGISTLPIALQTLVQATEYPPE.TPTLLQVSTT...
Q2HFE8_CHAGB/40-505.....NG...FEGG......AADATSHLFFAYMRSLAPEPVQG..GISLLPMSLQKLLQETEYPPQ.RPALMQTSTN...
Q6FSL9_CANGA/50-452.QTVNNS...IQNGFDQWIPGSDAMFHLLLAFLRSFVPKDVENA....KLPRTLKNLLFTNEYPPQ.DSTAFNSETI...
A6ZP33_YEAS7/67-473SFAPNNS...IQDGLDQWIPASDAMFHLLLAFLRSFVPQDLESA....KLPRTLKSLLFNNQYPPR.KSTAYTSETI...
A7ELT0_SCLS1/44-518.....NG...FEGGYKGWSTAADAASHLFFAYLRSLSPESVRGMSGISKLPMSLQKLVQETEYPPE.HPSLLQQSTM...
A7TPE0_VANPO/50-442.....NS...ISSGFESWIPGADATLHMLLSFLKIYVSQNLQKS....KISGTEIQFLLNSEYPPL.....EIKETIKKS
A7TL24_VANPO/23-432..FNDNS...IQDGFQQWIPASDAMFHLLLAFLKSFLPDDANETDTYNKLPRNLKSLLINNEYPPVLKSTAYTSETI...
Q59KA9_CANAL/47-455...AEHN...FIEGIDTWKKSTNALFHLVLAFLRSMLPETNSETL...KIPKTLQSLLVTTQYPPS.SDN.ESDQSMLRG
A3LX57_PICST/32-439...QEFN...FIQGVEAWKSSGNALFHLLLSFLRAMLPENDAETL...KLPKALQSLLITTAYPPS.EDTGRTLKSM...
A6R3W6_AJECN/42-521.....NG...FESSYKNWASAADATSHLFFAYLRSLSPDSLRGSNGISALPISLQSLVQATEYPPE.TPALLQMEST...
Q75ED0_ASHGO/35-426.....NS...FQEGLAQWRRGANAMFHLFLAFLRAFAVDEQKSG....KFTRELEAILFQNAYPPP.EDLQEDPAKL...
A5DVE6_LODEL/31-437...QEHD...FPEGLDNWKVTTMALFHLVLSFLRSMLPENDSETL...KLPKALQNLLVTTQYPPE.EK..ENLRKV...
Q6CUF4_KLULA/45-447..ADTND...YKQGLSQWIPAAEAMFHLLLAFIRSFVPTDSTKV....KLPKSLRNILFDNAYPPK.NSDTFTSETI...
MUG8_SCHPO/44-440..........LQETFIYWDRCTNACLRLLLCYIRY...TNKSSETGFSCLPSALQSQLQSFNYPPS.LKKLNDAKAH...
Q6C001_YARLI/164-665.....DGPVSFQDGLDAWSRAAEATNHLFFSFLRTMLPTK.ESRIEANRIPRSLEALLVSSVYPPL...PLHKSRLV...
Q75EK6_ASHGO/152-598..DEGNDDELILNKI..YRNRGSALYHLFVAYLRSLADKGKIKD.......FYLLDNFDVHEYPPGPYRPMTQRALT...

PF00616

RASL1_MOUSE/321-510--------------------------------------------------------------------------------
Q75DK0_ASHGO/576-771--------------------------------------------------------------------------------
Q757I8_ASHGO/1558-1726--------------------------------------------------------------------------------
RGAA_DICDI/239-445--------------------------------------------------------------------------------
A5DN39_PICGU/903-1097--------------------------------------------------------------------------------
GAPD1_MOUSE/152-353--------------------------------------------------------------------------------
GAP2_DROME/495-668--------------------------------------------------------------------------------
Q0URT8_PHANO/796-948--------------------------------------------------------------------------------
A5DR10_PICGU/619-844--------------------------------------------------------------------------------
Q6BPM2_DEBHA/608-836--------------------------------------------------------------------------------
A3GHY3_PICST/1310-1472--------------------------------------------------------------------------------
Q0V6E4_PHANO/854-1062--------------------------------------------------------------------------------
Q6CFR5_YARLI/832-1039--------------------------------------------------------------------------------
IQGA2_MOUSE/938-1150--------------------------------------------------------------------------------
A5E5Z0_LODEL/955-1161--------------------------------------------------------------------------------
Q5AH02_CANAL/977-1177--------------------------------------------------------------------------------
A3LY27_PICST/921-1130--------------------------------------------------------------------------------
A6ZW14_YEAS7/881-1068--------------------------------------------------------------------------------
A7TK28_VANPO/900-1076--------------------------------------------------------------------------------
Q6FSF6_CANGA/864-1037--------------------------------------------------------------------------------
Q6CR01_KLULA/879-1073--------------------------------------------------------------------------------
A7RYQ9_NEMVE/151-314--------------------------------------------------------------------------------
Q1PQE2_DROMI/101-305--------------------------------------------------------------------------------
RME6_CAEEL/161-355--------------------------------------------------------------------------------
Q54F48_DICDI/1131-1337--------------------------------------------------------------------------------
Q869U6_DICDI/119-289--------------------------------------------------------------------------------
A2G1P2_TRIVA/157-304--------------------------------------------------------------------------------
Q9XVW6_CAEEL/11-201--------------------------------------------------------------------------------
Q6BG44_PARTE/169-435--------------------------------------------------------------------------------
RASL2_HUMAN/323-512--------------------------------------------------------------------------------
A2CE77_DANRE/319-508--------------------------------------------------------------------------------
Q66JF5_XENTR/327-516--------------------------------------------------------------------------------
Q4T1V0_TETNG/259-481--------------------------------------------------------------------------------
RASA3_RAT/351-524--------------------------------------------------------------------------------
RASA2_HUMAN/377-550--------------------------------------------------------------------------------
A7RYE3_NEMVE/344-517--------------------------------------------------------------------------------
Q0C7B1_AEDAE/426-599--------------------------------------------------------------------------------
NGAP_DICDI/596-769--------------------------------------------------------------------------------
A7SJB4_NEMVE/409-582--------------------------------------------------------------------------------
Q4RUN4_TETNG/812-985--------------------------------------------------------------------------------
Q17P86_AEDAE/660-835--------------------------------------------------------------------------------
Q4TC99_TETNG/266-437--------------------------------------------------------------------------------
Q4TB25_TETNG/371-543--------------------------------------------------------------------------------
Q4SJ24_TETNG/320-491--------------------------------------------------------------------------------
Q6KAS9_MOUSE/518-689--------------------------------------------------------------------------------
A6ZJ45_CAEEL/167-340--------------------------------------------------------------------------------
A8XP25_CAEBR/203-376--------------------------------------------------------------------------------
A7SKG2_NEMVE/244-412--------------------------------------------------------------------------------
Q0CSQ0_ASPTN/793-964--------------------------------------------------------------------------------
Q2GTK6_CHAGB/605-776--------------------------------------------------------------------------------
Q7RW81_NEUCR/919-1092--------------------------------------------------------------------------------
Q6C802_YARLI/650-829--------------------------------------------------------------------------------
A3LZE1_PICST/612-848--------------------------------------------------------------------------------
Q5A506_CANAL/642-872--------------------------------------------------------------------------------
A5E274_LODEL/753-994--------------------------------------------------------------------------------
Q6FNM9_CANGA/542-738--------------------------------------------------------------------------------
BUD2_YEAST/541-721--------------------------------------------------------------------------------
Q6CW67_KLULA/546-743--------------------------------------------------------------------------------
Q4P4C4_USTMA/677-887--------------------------------------------------------------------------------
Q8SSU4_DICDI/586-757--------------------------------------------------------------------------------
Q55CR5_DICDI/1772-1943--------------------------------------------------------------------------------
Q54RT3_DICDI/342-510--------------------------------------------------------------------------------
Q54Q13_DICDI/104-276--------------------------------------------------------------------------------
NF1_RAT/1258-1432--------------------------------------------------------------------------------
Q8IMS2_DROME/1300-1475--------------------------------------------------------------------------------
Q54T13_DICDI/179-351--------------------------------------------------------------------------------
NFAA_DICDI/68-259--------------------------------------------------------------------------------
Q6FJ13_CANGA/1767-1935--------------------------------------------------------------------------------
IRA1_YEAST/1730-1898--------------------------------------------------------------------------------
A7TN87_VANPO/1674-1842--------------------------------------------------------------------------------
Q6CMT2_KLULA/1529-1697--------------------------------------------------------------------------------
IRA2_YEAST/1722-1890--------------------------------------------------------------------------------
Q6FQA1_CANGA/1674-1842--------------------------------------------------------------------------------
A7TEG6_VANPO/1672-1840--------------------------------------------------------------------------------
A5E1X9_LODEL/1368-1531--------------------------------------------------------------------------------
Q5A3W3_CANAL/1300-1463--------------------------------------------------------------------------------
Q8WZX6_NEUCS/1323-1495--------------------------------------------------------------------------------
A6SKM1_BOTFB/602-772--------------------------------------------------------------------------------
Q4PF31_USTMA/1621-1793--------------------------------------------------------------------------------
Q5KFG6_CRYNJ/1321-1493--------------------------------------------------------------------------------
A2E9Q3_TRIVA/1023-1197--------------------------------------------------------------------------------
A2FFI6_TRIVA/1018-1191--------------------------------------------------------------------------------
A2GF60_TRIVA/1036-1210--------------------------------------------------------------------------------
A2DLG7_TRIVA/987-1164--------------------------------------------------------------------------------
A2FB27_TRIVA/1019-1186--------------------------------------------------------------------------------
Q4DY44_TRYCC/96-330--------------------------------------------------------------------------------
A2DU37_TRIVA/325-480--------------------------------------------------------------------------------
A2EAY4_TRIVA/330-471--------------------------------------------------------------------------------
A2G2R5_TRIVA/334-477--------------------------------------------------------------------------------
Q86JJ7_DICDI/392-554--------------------------------------------------------------------------------
A2R7H8_ASPNC/194-402--------------------------------------------------------------------------------
Q7S5G6_NEUCR/166-375--------------------------------------------------------------------------------
Q6DNA0_SCHCO/171-379--------------------------------------------------------------------------------
Q54I64_DICDI/185-392--------------------------------------------------------------------------------
A7S5U4_NEMVE/139-338--------------------------------------------------------------------------------
GAP1_SCHPO/175-379--------------------------------------------------------------------------------
GAPA_DICDI/274-481--------------------------------------------------------------------------------
Q7SFX8_NEUCR/1171-1379--------------------------------------------------------------------------------
A7F2A6_SCLS1/1177-1385--------------------------------------------------------------------------------
A2QP50_ASPNC/1125-1333--------------------------------------------------------------------------------
A6R4D6_AJECN/1034-1242--------------------------------------------------------------------------------
Q4P2J5_USTMA/1116-1323--------------------------------------------------------------------------------
Q5KM85_CRYNJ/1428-1635--------------------------------------------------------------------------------
Q4RUQ1_TETNG/412-624--------------------------------------------------------------------------------
Q8BPA6_MOUSE/45-257--------------------------------------------------------------------------------
A7SXE3_NEMVE/113-325--------------------------------------------------------------------------------
Q9XZE9_HYDVU/1010-1222--------------------------------------------------------------------------------
A2RRC9_HUMAN/1009-1221--------------------------------------------------------------------------------
Q4SWD5_TETNG/1049-1261--------------------------------------------------------------------------------
RNG2_SCHPO/875-1077--------------------------------------------------------------------------------
Q8SUA0_ENCCU/433-602--------------------------------------------------------------------------------
Q552W4_DICDI/717-964--------------------------------------------------------------------------------
A0DYI4_PARTE/179-497--------------------------------------------------------------------------------
A0BIL6_PARTE/179-498--------------------------------------------------------------------------------
Q23D35_TETTS/318-639--------------------------------------------------------------------------------

PF00620

RHG05_MOUSE/1274-1425--------------------------------------------------------------------------------
SYDE_DROME/968-1123--------------------------------------------------------------------------------
LRG1_YEAST/755-912--------------------------------------------------------------------------------
P85B_MOUSE/125-265--------------------------------------------------------------------------------
I5P2_MOUSE/830-972--------------------------------------------------------------------------------
RHG07_HUMAN/1092-1238--------------------------------------------------------------------------------
RHG28_HUMAN/399-552--------------------------------------------------------------------------------
ARAP2_HUMAN/1129-1281--------------------------------------------------------------------------------
MYO9A_HUMAN/2076-2225--------------------------------------------------------------------------------
Q20442_CAEEL/896-1053--------------------------------------------------------------------------------
RHG18_HUMAN/343-492--------------------------------------------------------------------------------
ARAP1_HUMAN/971-1120--------------------------------------------------------------------------------
PAC1_CAEEL/963-1123--------------------------------------------------------------------------------
Q9V4C2_DROME/875-1034--------------------------------------------------------------------------------
HMHA1_HUMAN/775-947--------------------------------------------------------------------------------
GMIP_HUMAN/565-728--------------------------------------------------------------------------------
RHG32_HUMAN/386-538--------------------------------------------------------------------------------
RG190_DROME/1364-1529--------------------------------------------------------------------------------
RG92B_DROME/265-418--------------------------------------------------------------------------------
RGAP1_ARATH/155-296--------------------------------------------------------------------------------
BCR_HUMAN/1068-1221--------------------------------------------------------------------------------
RHG21_HUMAN/1161-1314--------------------------------------------------------------------------------
RHG24_MOUSE/151-304--------------------------------------------------------------------------------
RHG17_RAT/266-415--------------------------------------------------------------------------------
RHG20_HUMAN/377-527--------------------------------------------------------------------------------
RBP1_RAT/210-356--------------------------------------------------------------------------------
CHIN_MOUSE/282-436--------------------------------------------------------------------------------
RHG09_HUMAN/556-726--------------------------------------------------------------------------------
FNBP2_HUMAN/505-657--------------------------------------------------------------------------------
Q9VDE9_DROME/1154-1302--------------------------------------------------------------------------------
RRC1_CAEEL/294-443--------------------------------------------------------------------------------
RHG35_RAT/1262-1413--------------------------------------------------------------------------------
RHG39_HUMAN/909-1055--------------------------------------------------------------------------------
Q9W4A9_DROME/319-473--------------------------------------------------------------------------------
Q8MSA6_DROME/346-502--------------------------------------------------------------------------------
RGA3_SCHPO/794-942--------------------------------------------------------------------------------
RGA4_SCHPO/761-910--------------------------------------------------------------------------------
MYO9B_RAT/1673-1822--------------------------------------------------------------------------------
RGA1_YEAST/805-985--------------------------------------------------------------------------------
Q9P8F2_ZYGRO/832-1008--------------------------------------------------------------------------------
RGA2_YEAST/802-985--------------------------------------------------------------------------------
Q8R1F4_MOUSE/140-291--------------------------------------------------------------------------------
TG325_CAEEL/624-775--------------------------------------------------------------------------------
Q9VWL9_DROME/292-441--------------------------------------------------------------------------------
CDGAP_DROME/438-593--------------------------------------------------------------------------------
O13384_COCHE/545-692--------------------------------------------------------------------------------
RGA7_SCHPO/520-671--------------------------------------------------------------------------------
Q95TR0_DROME/586-741--------------------------------------------------------------------------------
RGD1_YEAST/486-644--------------------------------------------------------------------------------
BEM2_YEAST/1981-2141--------------------------------------------------------------------------------
ARAP3_HUMAN/920-1071--------------------------------------------------------------------------------
Q8T3K2_DROME/784-935--------------------------------------------------------------------------------
O60432_HUMAN/255-431--------------------------------------------------------------------------------
Q9N9Z9_DROME/395-545--------------------------------------------------------------------------------
Q9BZ74_HUMAN/363-512--------------------------------------------------------------------------------
Q95VR1_9HYME/3-152--------------------------------------------------------------------------------
Q9XUS9_CAEEL/437-588--------------------------------------------------------------------------------
O00886_DICDI/28-181--------------------------------------------------------------------------------
RHG01_HUMAN/260-408--------------------------------------------------------------------------------
RHG08_MOUSE/210-360--------------------------------------------------------------------------------
RG68F_DROME/292-439--------------------------------------------------------------------------------
Q23130_CAEEL/263-421--------------------------------------------------------------------------------
FA13B_MOUSE/39-190--------------------------------------------------------------------------------
Q8VHL8_MOUSE/532-684--------------------------------------------------------------------------------
Q19370_CAEEL/541-693--------------------------------------------------------------------------------
O82458_LOTJA/159-296--------------------------------------------------------------------------------
O01443_CAEEL/529-695--------------------------------------------------------------------------------
RHG06_HUMAN/411-572--------------------------------------------------------------------------------
Q8SY28_DROME/579-731--------------------------------------------------------------------------------
Q8T0G4_DROME/380-537--------------------------------------------------------------------------------
RGA1_SCHPO/862-1019--------------------------------------------------------------------------------
TAGAP_HUMAN/101-250--------------------------------------------------------------------------------
Q9DAP3_MOUSE/308-455--------------------------------------------------------------------------------
Q9XW53_CAEEL/264-412--------------------------------------------------------------------------------
BEM3_YEAST/927-1096--------------------------------------------------------------------------------
RGA2_SCHPO/1083-1234--------------------------------------------------------------------------------
Q8RWQ4_ARATH/176-325--------------------------------------------------------------------------------
YIL2_SCHPO/178-325--------------------------------------------------------------------------------
RGA6_SCHPO/332-510--------------------------------------------------------------------------------
RGA5_SCHPO/68-226--------------------------------------------------------------------------------
BAG7_YEAST/76-235--------------------------------------------------------------------------------
P85AA_XENLA/128-280--------------------------------------------------------------------------------
OCRL_HUMAN/735-875--------------------------------------------------------------------------------
Q8STW6_ENCCU/162-313--------------------------------------------------------------------------------
Q8SRX9_ENCCU/91-256--------------------------------------------------------------------------------
O96601_PLAFA/109-259--------------------------------------------------------------------------------
Q9VUR5_DROME/55-207--------------------------------------------------------------------------------

PF08101

Q0TZ65_PHANO/41-476..KVIMIVDSV...SPTPFALLRRAKH.........FEYRDDDAALQQFS..AYEDTV.....KALTDECRRVLECIS..
A5DN67_PICGU/33-435.IKIPCVLLKSTKPSENVYELLSKVRRTIKFDKKDDFMSVENYTILKNIF..KKDSTAD..IVASLSEESRRIMGRLTDI
Q7SG59_NEUCR/43-514..KVAMIVETV...SPTPFALLRRANH.........FQYREEDKALREWS..EYDDPV.....QALTEECRRVLKAVS..
Q0CXG4_ASPTN/42-520..KVVMIVDTV...SPTPFALLRRAKN.........FEYRDSDHHLQEFA..SFEDPL.....RALTDECVRVLKCIS..
Q2HFE8_CHAGB/40-505..RVAMIVDTV...SPTPFTLLRRANH.........FQYRDEDRALQEWS..EYEDPI.....QALTEECRRVLRAIA..
Q6FSL9_CANGA/50-452.LTIPLVTLHTDEFSRKPWQLLERCNEMLDFSDHEAFEAREDYALLKSLF..KKKNNVE.GISRKMSQESRRLMKVLS..
A6ZP33_YEAS7/67-473.LTIPLVTLKTDVFSRKPWQLLERCNDLLDFSDHDAFEAREDYALLKSLF..RKKNTVE.GISRKMSQESRRLMKAMS..
A7ELT0_SCLS1/44-518..KVVMIVNSV...SPTPFALLRRANH.........FQYRDDDRALQQFS..EYEDPV.....RALTDECRRVLRSIS..
A7TPE0_VANPO/50-442HRTIPLVTLKALN.CKTAISLLRRCAKLLDFSNNDNFEAYEDYVILKSIF..KSSSNKHFDIRKMLTHESLLTYNFLT..
A7TL24_VANPO/23-432.LTIPLVTLFTNQFSRKPWELLERCNNLLDFNDHNSFEAREDYALLKSLF..NKKHNIE.GISRKMSQESRRIMKLIQ..
Q59KA9_CANAL/47-455AITIPCVCVSTTQPSKDAYELISKVRHNLKFDKKDDFLSIENYTILKNLF..SKKGTFE..IVNSLTDESKRILSRISSE
A3LX57_PICST/32-439.ITIPCVVVKSTRPSSNVYELLSKVRHTLSFDKKDAFLSIENYTILKNIF..KKDSTDD..IVRGLTEESRRVLGRLTDD
A6R3W6_AJECN/42-521..KVVMIVENV...SPTPFALLRRAKN.........FEYRDSDHALQRFS..NFEDPV.....KALTDECRRVLRCIS..
Q75ED0_ASHGO/35-426.ISVPVLTLKTDRFSRKPWELFERCNSLFQTAGHYG.GPLEDYTLLQSLF..MRKNQAN.ALSKKMTGETRRLLKEMS..
A5DVE6_LODEL/31-437.VAVPCICVSTTRPSLSAYDLISKVRQSLPLDKKDEF.SKENYTILKNVF..LKKSTSE..VVDTFTQESTRVLDRISDD
Q6CUF4_KLULA/45-447.LTVPIVTLMTTKFTRKPWQLIERCNELMDFDEPEKFETREDFALLKSLF..KKKKNIE.GISSKMSKESKRLMKCMS..
MUG8_SCHPO/44-440...VFTFSMNYYM.TRDPLEMIQIVTKMNIPDHLTATLPRSSDDIQNDCL.............FALRQVSKRSSYH....
Q6C001_YARLI/164-665..PVPLVTLTVGKLSSSPLVLLKRAAKTVRFDNPAVFATEDDFNTL..FF..LFKDPKI..VDQKLSPESKRVLHDIV..
Q75EK6_ASHGO/152-598.LTVPRFIPESDM.RNDFNQLIKFVAK....AGSRIYSSQHAFSKLENSFLDKFEENPLKVVEGLFSKSSKRYLYKFDKH

PF00616

RASL1_MOUSE/321-510--------------------------------------------------------------------------------
Q75DK0_ASHGO/576-771--------------------------------------------------------------------------------
Q757I8_ASHGO/1558-1726--------------------------------------------------------------------------------
RGAA_DICDI/239-445--------------------------------------------------------------------------------
A5DN39_PICGU/903-1097--------------------------------------------------------------------------------
GAPD1_MOUSE/152-353--------------------------------------------------------------------------------
GAP2_DROME/495-668--------------------------------------------------------------------------------
Q0URT8_PHANO/796-948--------------------------------------------------------------------------------
A5DR10_PICGU/619-844--------------------------------------------------------------------------------
Q6BPM2_DEBHA/608-836--------------------------------------------------------------------------------
A3GHY3_PICST/1310-1472--------------------------------------------------------------------------------
Q0V6E4_PHANO/854-1062--------------------------------------------------------------------------------
Q6CFR5_YARLI/832-1039--------------------------------------------------------------------------------
IQGA2_MOUSE/938-1150--------------------------------------------------------------------------------
A5E5Z0_LODEL/955-1161--------------------------------------------------------------------------------
Q5AH02_CANAL/977-1177--------------------------------------------------------------------------------
A3LY27_PICST/921-1130--------------------------------------------------------------------------------
A6ZW14_YEAS7/881-1068--------------------------------------------------------------------------------
A7TK28_VANPO/900-1076--------------------------------------------------------------------------------
Q6FSF6_CANGA/864-1037--------------------------------------------------------------------------------
Q6CR01_KLULA/879-1073--------------------------------------------------------------------------------
A7RYQ9_NEMVE/151-314--------------------------------------------------------------------------------
Q1PQE2_DROMI/101-305--------------------------------------------------------------------------------
RME6_CAEEL/161-355--------------------------------------------------------------------------------
Q54F48_DICDI/1131-1337--------------------------------------------------------------------------------
Q869U6_DICDI/119-289--------------------------------------------------------------------------------
A2G1P2_TRIVA/157-304--------------------------------------------------------------------------------
Q9XVW6_CAEEL/11-201--------------------------------------------------------------------------------
Q6BG44_PARTE/169-435--------------------------------------------------------------------------------
RASL2_HUMAN/323-512--------------------------------------------------------------------------------
A2CE77_DANRE/319-508--------------------------------------------------------------------------------
Q66JF5_XENTR/327-516--------------------------------------------------------------------------------
Q4T1V0_TETNG/259-481--------------------------------------------------------------------------------
RASA3_RAT/351-524--------------------------------------------------------------------------------
RASA2_HUMAN/377-550--------------------------------------------------------------------------------
A7RYE3_NEMVE/344-517--------------------------------------------------------------------------------
Q0C7B1_AEDAE/426-599--------------------------------------------------------------------------------
NGAP_DICDI/596-769--------------------------------------------------------------------------------
A7SJB4_NEMVE/409-582--------------------------------------------------------------------------------
Q4RUN4_TETNG/812-985--------------------------------------------------------------------------------
Q17P86_AEDAE/660-835--------------------------------------------------------------------------------
Q4TC99_TETNG/266-437--------------------------------------------------------------------------------
Q4TB25_TETNG/371-543--------------------------------------------------------------------------------
Q4SJ24_TETNG/320-491--------------------------------------------------------------------------------
Q6KAS9_MOUSE/518-689--------------------------------------------------------------------------------
A6ZJ45_CAEEL/167-340--------------------------------------------------------------------------------
A8XP25_CAEBR/203-376--------------------------------------------------------------------------------
A7SKG2_NEMVE/244-412--------------------------------------------------------------------------------
Q0CSQ0_ASPTN/793-964--------------------------------------------------------------------------------
Q2GTK6_CHAGB/605-776--------------------------------------------------------------------------------
Q7RW81_NEUCR/919-1092--------------------------------------------------------------------------------
Q6C802_YARLI/650-829--------------------------------------------------------------------------------
A3LZE1_PICST/612-848--------------------------------------------------------------------------------
Q5A506_CANAL/642-872--------------------------------------------------------------------------------
A5E274_LODEL/753-994--------------------------------------------------------------------------------
Q6FNM9_CANGA/542-738--------------------------------------------------------------------------------
BUD2_YEAST/541-721--------------------------------------------------------------------------------
Q6CW67_KLULA/546-743--------------------------------------------------------------------------------
Q4P4C4_USTMA/677-887--------------------------------------------------------------------------------
Q8SSU4_DICDI/586-757--------------------------------------------------------------------------------
Q55CR5_DICDI/1772-1943--------------------------------------------------------------------------------
Q54RT3_DICDI/342-510--------------------------------------------------------------------------------
Q54Q13_DICDI/104-276--------------------------------------------------------------------------------
NF1_RAT/1258-1432--------------------------------------------------------------------------------
Q8IMS2_DROME/1300-1475--------------------------------------------------------------------------------
Q54T13_DICDI/179-351--------------------------------------------------------------------------------
NFAA_DICDI/68-259--------------------------------------------------------------------------------
Q6FJ13_CANGA/1767-1935--------------------------------------------------------------------------------
IRA1_YEAST/1730-1898--------------------------------------------------------------------------------
A7TN87_VANPO/1674-1842--------------------------------------------------------------------------------
Q6CMT2_KLULA/1529-1697--------------------------------------------------------------------------------
IRA2_YEAST/1722-1890--------------------------------------------------------------------------------
Q6FQA1_CANGA/1674-1842--------------------------------------------------------------------------------
A7TEG6_VANPO/1672-1840--------------------------------------------------------------------------------
A5E1X9_LODEL/1368-1531--------------------------------------------------------------------------------
Q5A3W3_CANAL/1300-1463--------------------------------------------------------------------------------
Q8WZX6_NEUCS/1323-1495--------------------------------------------------------------------------------
A6SKM1_BOTFB/602-772--------------------------------------------------------------------------------
Q4PF31_USTMA/1621-1793--------------------------------------------------------------------------------
Q5KFG6_CRYNJ/1321-1493--------------------------------------------------------------------------------
A2E9Q3_TRIVA/1023-1197--------------------------------------------------------------------------------
A2FFI6_TRIVA/1018-1191--------------------------------------------------------------------------------
A2GF60_TRIVA/1036-1210--------------------------------------------------------------------------------
A2DLG7_TRIVA/987-1164--------------------------------------------------------------------------------
A2FB27_TRIVA/1019-1186--------------------------------------------------------------------------------
Q4DY44_TRYCC/96-330--------------------------------------------------------------------------------
A2DU37_TRIVA/325-480--------------------------------------------------------------------------------
A2EAY4_TRIVA/330-471--------------------------------------------------------------------------------
A2G2R5_TRIVA/334-477--------------------------------------------------------------------------------
Q86JJ7_DICDI/392-554--------------------------------------------------------------------------------
A2R7H8_ASPNC/194-402--------------------------------------------------------------------------------
Q7S5G6_NEUCR/166-375--------------------------------------------------------------------------------
Q6DNA0_SCHCO/171-379--------------------------------------------------------------------------------
Q54I64_DICDI/185-392--------------------------------------------------------------------------------
A7S5U4_NEMVE/139-338--------------------------------------------------------------------------------
GAP1_SCHPO/175-379--------------------------------------------------------------------------------
GAPA_DICDI/274-481--------------------------------------------------------------------------------
Q7SFX8_NEUCR/1171-1379--------------------------------------------------------------------------------
A7F2A6_SCLS1/1177-1385--------------------------------------------------------------------------------
A2QP50_ASPNC/1125-1333--------------------------------------------------------------------------------
A6R4D6_AJECN/1034-1242--------------------------------------------------------------------------------
Q4P2J5_USTMA/1116-1323--------------------------------------------------------------------------------
Q5KM85_CRYNJ/1428-1635--------------------------------------------------------------------------------
Q4RUQ1_TETNG/412-624--------------------------------------------------------------------------------
Q8BPA6_MOUSE/45-257--------------------------------------------------------------------------------
A7SXE3_NEMVE/113-325--------------------------------------------------------------------------------
Q9XZE9_HYDVU/1010-1222--------------------------------------------------------------------------------
A2RRC9_HUMAN/1009-1221--------------------------------------------------------------------------------
Q4SWD5_TETNG/1049-1261--------------------------------------------------------------------------------
RNG2_SCHPO/875-1077--------------------------------------------------------------------------------
Q8SUA0_ENCCU/433-602--------------------------------------------------------------------------------
Q552W4_DICDI/717-964--------------------------------------------------------------------------------
A0DYI4_PARTE/179-497--------------------------------------------------------------------------------
A0BIL6_PARTE/179-498--------------------------------------------------------------------------------
Q23D35_TETTS/318-639--------------------------------------------------------------------------------

PF00620

RHG05_MOUSE/1274-1425--------------------------------------------------------------------------------
SYDE_DROME/968-1123--------------------------------------------------------------------------------
LRG1_YEAST/755-912--------------------------------------------------------------------------------
P85B_MOUSE/125-265--------------------------------------------------------------------------------
I5P2_MOUSE/830-972--------------------------------------------------------------------------------
RHG07_HUMAN/1092-1238--------------------------------------------------------------------------------
RHG28_HUMAN/399-552--------------------------------------------------------------------------------
ARAP2_HUMAN/1129-1281--------------------------------------------------------------------------------
MYO9A_HUMAN/2076-2225--------------------------------------------------------------------------------
Q20442_CAEEL/896-1053--------------------------------------------------------------------------------
RHG18_HUMAN/343-492--------------------------------------------------------------------------------
ARAP1_HUMAN/971-1120--------------------------------------------------------------------------------
PAC1_CAEEL/963-1123--------------------------------------------------------------------------------
Q9V4C2_DROME/875-1034--------------------------------------------------------------------------------
HMHA1_HUMAN/775-947--------------------------------------------------------------------------------
GMIP_HUMAN/565-728--------------------------------------------------------------------------------
RHG32_HUMAN/386-538--------------------------------------------------------------------------------
RG190_DROME/1364-1529--------------------------------------------------------------------------------
RG92B_DROME/265-418--------------------------------------------------------------------------------
RGAP1_ARATH/155-296--------------------------------------------------------------------------------
BCR_HUMAN/1068-1221--------------------------------------------------------------------------------
RHG21_HUMAN/1161-1314--------------------------------------------------------------------------------
RHG24_MOUSE/151-304--------------------------------------------------------------------------------
RHG17_RAT/266-415--------------------------------------------------------------------------------
RHG20_HUMAN/377-527--------------------------------------------------------------------------------
RBP1_RAT/210-356--------------------------------------------------------------------------------
CHIN_MOUSE/282-436--------------------------------------------------------------------------------
RHG09_HUMAN/556-726--------------------------------------------------------------------------------
FNBP2_HUMAN/505-657--------------------------------------------------------------------------------
Q9VDE9_DROME/1154-1302--------------------------------------------------------------------------------
RRC1_CAEEL/294-443--------------------------------------------------------------------------------
RHG35_RAT/1262-1413--------------------------------------------------------------------------------
RHG39_HUMAN/909-1055--------------------------------------------------------------------------------
Q9W4A9_DROME/319-473--------------------------------------------------------------------------------
Q8MSA6_DROME/346-502--------------------------------------------------------------------------------
RGA3_SCHPO/794-942--------------------------------------------------------------------------------
RGA4_SCHPO/761-910--------------------------------------------------------------------------------
MYO9B_RAT/1673-1822--------------------------------------------------------------------------------
RGA1_YEAST/805-985--------------------------------------------------------------------------------
Q9P8F2_ZYGRO/832-1008--------------------------------------------------------------------------------
RGA2_YEAST/802-985--------------------------------------------------------------------------------
Q8R1F4_MOUSE/140-291--------------------------------------------------------------------------------
TG325_CAEEL/624-775--------------------------------------------------------------------------------
Q9VWL9_DROME/292-441--------------------------------------------------------------------------------
CDGAP_DROME/438-593--------------------------------------------------------------------------------
O13384_COCHE/545-692--------------------------------------------------------------------------------
RGA7_SCHPO/520-671--------------------------------------------------------------------------------
Q95TR0_DROME/586-741--------------------------------------------------------------------------------
RGD1_YEAST/486-644--------------------------------------------------------------------------------
BEM2_YEAST/1981-2141--------------------------------------------------------------------------------
ARAP3_HUMAN/920-1071--------------------------------------------------------------------------------
Q8T3K2_DROME/784-935--------------------------------------------------------------------------------
O60432_HUMAN/255-431--------------------------------------------------------------------------------
Q9N9Z9_DROME/395-545--------------------------------------------------------------------------------
Q9BZ74_HUMAN/363-512--------------------------------------------------------------------------------
Q95VR1_9HYME/3-152--------------------------------------------------------------------------------
Q9XUS9_CAEEL/437-588--------------------------------------------------------------------------------
O00886_DICDI/28-181--------------------------------------------------------------------------------
RHG01_HUMAN/260-408--------------------------------------------------------------------------------
RHG08_MOUSE/210-360--------------------------------------------------------------------------------
RG68F_DROME/292-439--------------------------------------------------------------------------------
Q23130_CAEEL/263-421--------------------------------------------------------------------------------
FA13B_MOUSE/39-190--------------------------------------------------------------------------------
Q8VHL8_MOUSE/532-684--------------------------------------------------------------------------------
Q19370_CAEEL/541-693--------------------------------------------------------------------------------
O82458_LOTJA/159-296--------------------------------------------------------------------------------
O01443_CAEEL/529-695--------------------------------------------------------------------------------
RHG06_HUMAN/411-572--------------------------------------------------------------------------------
Q8SY28_DROME/579-731--------------------------------------------------------------------------------
Q8T0G4_DROME/380-537--------------------------------------------------------------------------------
RGA1_SCHPO/862-1019--------------------------------------------------------------------------------
TAGAP_HUMAN/101-250--------------------------------------------------------------------------------
Q9DAP3_MOUSE/308-455--------------------------------------------------------------------------------
Q9XW53_CAEEL/264-412--------------------------------------------------------------------------------
BEM3_YEAST/927-1096--------------------------------------------------------------------------------
RGA2_SCHPO/1083-1234--------------------------------------------------------------------------------
Q8RWQ4_ARATH/176-325--------------------------------------------------------------------------------
YIL2_SCHPO/178-325--------------------------------------------------------------------------------
RGA6_SCHPO/332-510--------------------------------------------------------------------------------
RGA5_SCHPO/68-226--------------------------------------------------------------------------------
BAG7_YEAST/76-235--------------------------------------------------------------------------------
P85AA_XENLA/128-280--------------------------------------------------------------------------------
OCRL_HUMAN/735-875--------------------------------------------------------------------------------
Q8STW6_ENCCU/162-313--------------------------------------------------------------------------------
Q8SRX9_ENCCU/91-256--------------------------------------------------------------------------------
O96601_PLAFA/109-259--------------------------------------------------------------------------------
Q9VUR5_DROME/55-207--------------------------------------------------------------------------------

PF08101

Q0TZ65_PHANO/41-476..TANQSTAAAEATTTDPSWSKFEDFGFSGLLESS...........ASSVHGTSSTGGMREFSSMRSGPRSKNTDFGRPT
A5DN67_PICGU/33-435SDSSD........................................................................YDL
Q7SG59_NEUCR/43-514..AANQSQAVSSTKHSTSLRDASWSRFEDMGFSGS...........IEEDSTDDETTLAAKREKAIKAQIAANADMGRPT
Q0CXG4_ASPTN/42-520..STNQSSVTDPTSSAQDASWSRFEDMGFGSTLDTD..........LEEDRKSASLARREFGGGLKSAPQSGAGDLGRPT
Q2HFE8_CHAGB/40-505..AANQSQAVSSSKHSTSLRDASWSRFEDIGFASAL..........EEDDMDDDALAKRRMQQGLRNTPASGNGDLGRPT
Q6FSL9_CANGA/50-452..TKH........................................................................STF
A6ZP33_YEAS7/67-473..TKH........................................................................STF
A7ELT0_SCLS1/44-518..STNQSQISNSQDSTGLPDASWSRFEDVGFSATFDD.......RAGDDNGFLAPGKPKPVQGLRNTPANAVVKSGDRPT
A7TPE0_VANPO/50-442..DNP........................................................................NNF
A7TL24_VANPO/23-432..TKH........................................................................STF
Q59KA9_CANAL/47-455PISSK........................................................................FNI
A3LX57_PICST/32-439SIESK........................................................................YEL
A6R3W6_AJECN/42-521..STNQSKITALAEGPIRDASWSRFEDLGFTASIEE.........GDGEGDGDRTMSKHTGPPGLRSAPQSRTADLGRPT
Q75ED0_ASHGO/35-426..TKH........................................................................STF
A5DVE6_LODEL/31-437GVENE........................................................................FGL
Q6CUF4_KLULA/45-447..TKH........................................................................STF
MUG8_SCHPO/44-440..SVF........................................................................SAQ
Q6C001_YARLI/164-665..QENPLNNEVYYDTRAAEWKVRSSKLPAGQHGDYRAKTWSKHYNSTFTDPATGARSSNPHNYVYDADEGYSYKMRSNQN
Q75EK6_ASHGO/152-598FSTNYFKTLNDRQGW...................................................NRALHELDPTNQYA

PF00616

RASL1_MOUSE/321-510--------------------------------------------------------------------------------
Q75DK0_ASHGO/576-771--------------------------------------------------------------------------------
Q757I8_ASHGO/1558-1726--------------------------------------------------------------------------------
RGAA_DICDI/239-445--------------------------------------------------------------------------------
A5DN39_PICGU/903-1097--------------------------------------------------------------------------------
GAPD1_MOUSE/152-353--------------------------------------------------------------------------------
GAP2_DROME/495-668--------------------------------------------------------------------------------
Q0URT8_PHANO/796-948--------------------------------------------------------------------------------
A5DR10_PICGU/619-844--------------------------------------------------------------------------------
Q6BPM2_DEBHA/608-836--------------------------------------------------------------------------------
A3GHY3_PICST/1310-1472--------------------------------------------------------------------------------
Q0V6E4_PHANO/854-1062--------------------------------------------------------------------------------
Q6CFR5_YARLI/832-1039--------------------------------------------------------------------------------
IQGA2_MOUSE/938-1150--------------------------------------------------------------------------------
A5E5Z0_LODEL/955-1161--------------------------------------------------------------------------------
Q5AH02_CANAL/977-1177--------------------------------------------------------------------------------
A3LY27_PICST/921-1130--------------------------------------------------------------------------------
A6ZW14_YEAS7/881-1068--------------------------------------------------------------------------------
A7TK28_VANPO/900-1076--------------------------------------------------------------------------------
Q6FSF6_CANGA/864-1037--------------------------------------------------------------------------------
Q6CR01_KLULA/879-1073--------------------------------------------------------------------------------
A7RYQ9_NEMVE/151-314--------------------------------------------------------------------------------
Q1PQE2_DROMI/101-305--------------------------------------------------------------------------------
RME6_CAEEL/161-355--------------------------------------------------------------------------------
Q54F48_DICDI/1131-1337--------------------------------------------------------------------------------
Q869U6_DICDI/119-289--------------------------------------------------------------------------------
A2G1P2_TRIVA/157-304--------------------------------------------------------------------------------
Q9XVW6_CAEEL/11-201--------------------------------------------------------------------------------
Q6BG44_PARTE/169-435--------------------------------------------------------------------------------
RASL2_HUMAN/323-512--------------------------------------------------------------------------------
A2CE77_DANRE/319-508--------------------------------------------------------------------------------
Q66JF5_XENTR/327-516--------------------------------------------------------------------------------
Q4T1V0_TETNG/259-481--------------------------------------------------------------------------------
RASA3_RAT/351-524--------------------------------------------------------------------------------
RASA2_HUMAN/377-550--------------------------------------------------------------------------------
A7RYE3_NEMVE/344-517--------------------------------------------------------------------------------
Q0C7B1_AEDAE/426-599--------------------------------------------------------------------------------
NGAP_DICDI/596-769--------------------------------------------------------------------------------
A7SJB4_NEMVE/409-582--------------------------------------------------------------------------------
Q4RUN4_TETNG/812-985--------------------------------------------------------------------------------
Q17P86_AEDAE/660-835--------------------------------------------------------------------------------
Q4TC99_TETNG/266-437--------------------------------------------------------------------------------
Q4TB25_TETNG/371-543--------------------------------------------------------------------------------
Q4SJ24_TETNG/320-491--------------------------------------------------------------------------------
Q6KAS9_MOUSE/518-689--------------------------------------------------------------------------------
A6ZJ45_CAEEL/167-340--------------------------------------------------------------------------------
A8XP25_CAEBR/203-376--------------------------------------------------------------------------------
A7SKG2_NEMVE/244-412--------------------------------------------------------------------------------
Q0CSQ0_ASPTN/793-964--------------------------------------------------------------------------------
Q2GTK6_CHAGB/605-776--------------------------------------------------------------------------------
Q7RW81_NEUCR/919-1092--------------------------------------------------------------------------------
Q6C802_YARLI/650-829--------------------------------------------------------------------------------
A3LZE1_PICST/612-848--------------------------------------------------------------------------------
Q5A506_CANAL/642-872--------------------------------------------------------------------------------
A5E274_LODEL/753-994--------------------------------------------------------------------------------
Q6FNM9_CANGA/542-738--------------------------------------------------------------------------------
BUD2_YEAST/541-721--------------------------------------------------------------------------------
Q6CW67_KLULA/546-743--------------------------------------------------------------------------------
Q4P4C4_USTMA/677-887--------------------------------------------------------------------------------
Q8SSU4_DICDI/586-757--------------------------------------------------------------------------------
Q55CR5_DICDI/1772-1943--------------------------------------------------------------------------------
Q54RT3_DICDI/342-510--------------------------------------------------------------------------------
Q54Q13_DICDI/104-276--------------------------------------------------------------------------------
NF1_RAT/1258-1432--------------------------------------------------------------------------------
Q8IMS2_DROME/1300-1475--------------------------------------------------------------------------------
Q54T13_DICDI/179-351--------------------------------------------------------------------------------
NFAA_DICDI/68-259--------------------------------------------------------------------------------
Q6FJ13_CANGA/1767-1935--------------------------------------------------------------------------------
IRA1_YEAST/1730-1898--------------------------------------------------------------------------------
A7TN87_VANPO/1674-1842--------------------------------------------------------------------------------
Q6CMT2_KLULA/1529-1697--------------------------------------------------------------------------------
IRA2_YEAST/1722-1890--------------------------------------------------------------------------------
Q6FQA1_CANGA/1674-1842--------------------------------------------------------------------------------
A7TEG6_VANPO/1672-1840--------------------------------------------------------------------------------
A5E1X9_LODEL/1368-1531--------------------------------------------------------------------------------
Q5A3W3_CANAL/1300-1463--------------------------------------------------------------------------------
Q8WZX6_NEUCS/1323-1495--------------------------------------------------------------------------------
A6SKM1_BOTFB/602-772--------------------------------------------------------------------------------
Q4PF31_USTMA/1621-1793--------------------------------------------------------------------------------
Q5KFG6_CRYNJ/1321-1493--------------------------------------------------------------------------------
A2E9Q3_TRIVA/1023-1197--------------------------------------------------------------------------------
A2FFI6_TRIVA/1018-1191--------------------------------------------------------------------------------
A2GF60_TRIVA/1036-1210--------------------------------------------------------------------------------
A2DLG7_TRIVA/987-1164--------------------------------------------------------------------------------
A2FB27_TRIVA/1019-1186--------------------------------------------------------------------------------
Q4DY44_TRYCC/96-330--------------------------------------------------------------------------------
A2DU37_TRIVA/325-480--------------------------------------------------------------------------------
A2EAY4_TRIVA/330-471--------------------------------------------------------------------------------
A2G2R5_TRIVA/334-477--------------------------------------------------------------------------------
Q86JJ7_DICDI/392-554--------------------------------------------------------------------------------
A2R7H8_ASPNC/194-402--------------------------------------------------------------------------------
Q7S5G6_NEUCR/166-375--------------------------------------------------------------------------------
Q6DNA0_SCHCO/171-379--------------------------------------------------------------------------------
Q54I64_DICDI/185-392--------------------------------------------------------------------------------
A7S5U4_NEMVE/139-338--------------------------------------------------------------------------------
GAP1_SCHPO/175-379--------------------------------------------------------------------------------
GAPA_DICDI/274-481--------------------------------------------------------------------------------
Q7SFX8_NEUCR/1171-1379--------------------------------------------------------------------------------
A7F2A6_SCLS1/1177-1385--------------------------------------------------------------------------------
A2QP50_ASPNC/1125-1333--------------------------------------------------------------------------------
A6R4D6_AJECN/1034-1242--------------------------------------------------------------------------------
Q4P2J5_USTMA/1116-1323--------------------------------------------------------------------------------
Q5KM85_CRYNJ/1428-1635--------------------------------------------------------------------------------
Q4RUQ1_TETNG/412-624--------------------------------------------------------------------------------
Q8BPA6_MOUSE/45-257--------------------------------------------------------------------------------
A7SXE3_NEMVE/113-325--------------------------------------------------------------------------------
Q9XZE9_HYDVU/1010-1222--------------------------------------------------------------------------------
A2RRC9_HUMAN/1009-1221--------------------------------------------------------------------------------
Q4SWD5_TETNG/1049-1261--------------------------------------------------------------------------------
RNG2_SCHPO/875-1077--------------------------------------------------------------------------------
Q8SUA0_ENCCU/433-602--------------------------------------------------------------------------------
Q552W4_DICDI/717-964--------------------------------------------------------------------------------
A0DYI4_PARTE/179-497--------------------------------------------------------------------------------
A0BIL6_PARTE/179-498--------------------------------------------------------------------------------
Q23D35_TETTS/318-639--------------------------------------------------------------------------------

PF00620

RHG05_MOUSE/1274-1425--------------------------------------------------------------------------------
SYDE_DROME/968-1123--------------------------------------------------------------------------------
LRG1_YEAST/755-912--------------------------------------------------------------------------------
P85B_MOUSE/125-265--------------------------------------------------------------------------------
I5P2_MOUSE/830-972--------------------------------------------------------------------------------
RHG07_HUMAN/1092-1238--------------------------------------------------------------------------------
RHG28_HUMAN/399-552--------------------------------------------------------------------------------
ARAP2_HUMAN/1129-1281--------------------------------------------------------------------------------
MYO9A_HUMAN/2076-2225--------------------------------------------------------------------------------
Q20442_CAEEL/896-1053--------------------------------------------------------------------------------
RHG18_HUMAN/343-492--------------------------------------------------------------------------------
ARAP1_HUMAN/971-1120--------------------------------------------------------------------------------
PAC1_CAEEL/963-1123--------------------------------------------------------------------------------
Q9V4C2_DROME/875-1034--------------------------------------------------------------------------------
HMHA1_HUMAN/775-947--------------------------------------------------------------------------------
GMIP_HUMAN/565-728--------------------------------------------------------------------------------
RHG32_HUMAN/386-538--------------------------------------------------------------------------------
RG190_DROME/1364-1529--------------------------------------------------------------------------------
RG92B_DROME/265-418--------------------------------------------------------------------------------
RGAP1_ARATH/155-296--------------------------------------------------------------------------------
BCR_HUMAN/1068-1221--------------------------------------------------------------------------------
RHG21_HUMAN/1161-1314--------------------------------------------------------------------------------
RHG24_MOUSE/151-304--------------------------------------------------------------------------------
RHG17_RAT/266-415--------------------------------------------------------------------------------
RHG20_HUMAN/377-527--------------------------------------------------------------------------------
RBP1_RAT/210-356--------------------------------------------------------------------------------
CHIN_MOUSE/282-436--------------------------------------------------------------------------------
RHG09_HUMAN/556-726--------------------------------------------------------------------------------
FNBP2_HUMAN/505-657--------------------------------------------------------------------------------
Q9VDE9_DROME/1154-1302--------------------------------------------------------------------------------
RRC1_CAEEL/294-443--------------------------------------------------------------------------------
RHG35_RAT/1262-1413--------------------------------------------------------------------------------
RHG39_HUMAN/909-1055--------------------------------------------------------------------------------
Q9W4A9_DROME/319-473--------------------------------------------------------------------------------
Q8MSA6_DROME/346-502--------------------------------------------------------------------------------
RGA3_SCHPO/794-942--------------------------------------------------------------------------------
RGA4_SCHPO/761-910--------------------------------------------------------------------------------
MYO9B_RAT/1673-1822--------------------------------------------------------------------------------
RGA1_YEAST/805-985--------------------------------------------------------------------------------
Q9P8F2_ZYGRO/832-1008--------------------------------------------------------------------------------
RGA2_YEAST/802-985--------------------------------------------------------------------------------
Q8R1F4_MOUSE/140-291--------------------------------------------------------------------------------
TG325_CAEEL/624-775--------------------------------------------------------------------------------
Q9VWL9_DROME/292-441--------------------------------------------------------------------------------
CDGAP_DROME/438-593--------------------------------------------------------------------------------
O13384_COCHE/545-692--------------------------------------------------------------------------------
RGA7_SCHPO/520-671--------------------------------------------------------------------------------
Q95TR0_DROME/586-741--------------------------------------------------------------------------------
RGD1_YEAST/486-644--------------------------------------------------------------------------------
BEM2_YEAST/1981-2141--------------------------------------------------------------------------------
ARAP3_HUMAN/920-1071--------------------------------------------------------------------------------
Q8T3K2_DROME/784-935--------------------------------------------------------------------------------
O60432_HUMAN/255-431--------------------------------------------------------------------------------
Q9N9Z9_DROME/395-545--------------------------------------------------------------------------------
Q9BZ74_HUMAN/363-512--------------------------------------------------------------------------------
Q95VR1_9HYME/3-152--------------------------------------------------------------------------------
Q9XUS9_CAEEL/437-588--------------------------------------------------------------------------------
O00886_DICDI/28-181--------------------------------------------------------------------------------
RHG01_HUMAN/260-408--------------------------------------------------------------------------------
RHG08_MOUSE/210-360--------------------------------------------------------------------------------
RG68F_DROME/292-439--------------------------------------------------------------------------------
Q23130_CAEEL/263-421--------------------------------------------------------------------------------
FA13B_MOUSE/39-190--------------------------------------------------------------------------------
Q8VHL8_MOUSE/532-684--------------------------------------------------------------------------------
Q19370_CAEEL/541-693--------------------------------------------------------------------------------
O82458_LOTJA/159-296--------------------------------------------------------------------------------
O01443_CAEEL/529-695--------------------------------------------------------------------------------
RHG06_HUMAN/411-572--------------------------------------------------------------------------------
Q8SY28_DROME/579-731--------------------------------------------------------------------------------
Q8T0G4_DROME/380-537--------------------------------------------------------------------------------
RGA1_SCHPO/862-1019--------------------------------------------------------------------------------
TAGAP_HUMAN/101-250--------------------------------------------------------------------------------
Q9DAP3_MOUSE/308-455--------------------------------------------------------------------------------
Q9XW53_CAEEL/264-412--------------------------------------------------------------------------------
BEM3_YEAST/927-1096--------------------------------------------------------------------------------
RGA2_SCHPO/1083-1234--------------------------------------------------------------------------------
Q8RWQ4_ARATH/176-325--------------------------------------------------------------------------------
YIL2_SCHPO/178-325--------------------------------------------------------------------------------
RGA6_SCHPO/332-510--------------------------------------------------------------------------------
RGA5_SCHPO/68-226--------------------------------------------------------------------------------
BAG7_YEAST/76-235--------------------------------------------------------------------------------
P85AA_XENLA/128-280--------------------------------------------------------------------------------
OCRL_HUMAN/735-875--------------------------------------------------------------------------------
Q8STW6_ENCCU/162-313--------------------------------------------------------------------------------
Q8SRX9_ENCCU/91-256--------------------------------------------------------------------------------
O96601_PLAFA/109-259--------------------------------------------------------------------------------
Q9VUR5_DROME/55-207--------------------------------------------------------------------------------

PF08101

Q0TZ65_PHANO/41-476TPSWADFLS....SGFADENGNQSAPTTLLLPTQK.LP....PLGEGARVHSSQSHVRNGI...QTEEDLEPGELASITQ
A5DN67_PICGU/33-435YPGWAP...................................................FGG....KVDENIPLFTELTIQD
Q7SG59_NEUCR/43-514TPSWADFLS....SGFDDKS...HGSHNILLPPDKILP....PIETTVRQK.SSESHKPRF...E..DALQPGELASITR
Q0CXG4_ASPTN/42-520TPSWADFMS....SGFSDENPFKAPVTPVLLPPDKVLP....PIAMDRGQ..SSQSHKRNL...DSEPSIDPGELASITT
Q2HFE8_CHAGB/40-505TPSWADFLS....SGFVDER....GAPNMLLPPDKVLP....PIDTGTARQRSSQSHKPRL...ETDNQFEPGELASIVR
Q6FSL9_CANGA/50-452QAGWAP...................................................RKAL.....ANDLGLKSKISVNR
A6ZP33_YEAS7/67-473QPGWAP...................................................RKCI.....ENISHLKECIEVKR
A7ELT0_SCLS1/44-518TPSWADFLS....SGFTDDGT..TSPPPLLLPPDKILP....PINTRAGS...SQSHQPRL...ESNKDLEPGELASITR
A7TPE0_VANPO/50-442LSGWVS...................................................QD.....QKDNIEFVKDEVIVER
A7TL24_VANPO/23-432QAGWGK...................................................RSC....SPDSSKSLKENIEVSR
Q59KA9_CANAL/47-455SPGWNK...................................................SKV....ETDPDIPLFSEISIKD
A3LX57_PICST/32-439YPGWPK...................................................SQP....EIDDNIPLFSQVSVYD
A6R3W6_AJECN/42-521TPSWADFLS....SGFADENE.PRSRPPFLLPPDKVLP....PIQTVRGQ..SSQSHKRLF...DEESSFEPGSLASITT
Q75ED0_ASHGO/35-426QAGWGN...................................................RNPL.....PNRLNLTESISWTR
A5DVE6_LODEL/31-437RPGWAK...................................................PTMLQASSSDKGLPLFSHIVVKD
Q6CUF4_KLULA/45-447QAGWSK...................................................GRNL...PSSNPDLIEESISISR
MUG8_SCHPO/44-440ESAWTDFIK....NGFDHPILPTCTQETVYSLLTGNDTACVYPFPN...........KPYRLPDVDFEIFSHCSFESLTT
Q6C001_YARLI/164-665VSTWEEFKQ....SGFEA........NDVIRRPSTALSGRSIPMNIPWASTLPGQNGDTAP...AVKSGYEQKVTAAVSQ
Q75EK6_ASHGO/152-598VSTWIESCKQHGFSEFLSMLEDNMGGEGTLALGHPLLASLTEELSF..................NAKEEEEELAAVRLSK

PF00616

RASL1_MOUSE/321-510--------------------------------------------------------------------------------
Q75DK0_ASHGO/576-771--------------------------------------------------------------------------------
Q757I8_ASHGO/1558-1726--------------------------------------------------------------------------------
RGAA_DICDI/239-445--------------------------------------------------------------------------------
A5DN39_PICGU/903-1097--------------------------------------------------------------------------------
GAPD1_MOUSE/152-353--------------------------------------------------------------------------------
GAP2_DROME/495-668--------------------------------------------------------------------------------
Q0URT8_PHANO/796-948--------------------------------------------------------------------------------
A5DR10_PICGU/619-844--------------------------------------------------------------------------------
Q6BPM2_DEBHA/608-836--------------------------------------------------------------------------------
A3GHY3_PICST/1310-1472--------------------------------------------------------------------------------
Q0V6E4_PHANO/854-1062--------------------------------------------------------------------------------
Q6CFR5_YARLI/832-1039--------------------------------------------------------------------------------
IQGA2_MOUSE/938-1150--------------------------------------------------------------------------------
A5E5Z0_LODEL/955-1161--------------------------------------------------------------------------------
Q5AH02_CANAL/977-1177--------------------------------------------------------------------------------
A3LY27_PICST/921-1130--------------------------------------------------------------------------------
A6ZW14_YEAS7/881-1068--------------------------------------------------------------------------------
A7TK28_VANPO/900-1076--------------------------------------------------------------------------------
Q6FSF6_CANGA/864-1037--------------------------------------------------------------------------------
Q6CR01_KLULA/879-1073--------------------------------------------------------------------------------
A7RYQ9_NEMVE/151-314--------------------------------------------------------------------------------
Q1PQE2_DROMI/101-305--------------------------------------------------------------------------------
RME6_CAEEL/161-355--------------------------------------------------------------------------------
Q54F48_DICDI/1131-1337--------------------------------------------------------------------------------
Q869U6_DICDI/119-289--------------------------------------------------------------------------------
A2G1P2_TRIVA/157-304--------------------------------------------------------------------------------
Q9XVW6_CAEEL/11-201--------------------------------------------------------------------------------
Q6BG44_PARTE/169-435--------------------------------------------------------------------------------
RASL2_HUMAN/323-512--------------------------------------------------------------------------------
A2CE77_DANRE/319-508--------------------------------------------------------------------------------
Q66JF5_XENTR/327-516--------------------------------------------------------------------------------
Q4T1V0_TETNG/259-481--------------------------------------------------------------------------------
RASA3_RAT/351-524--------------------------------------------------------------------------------
RASA2_HUMAN/377-550--------------------------------------------------------------------------------
A7RYE3_NEMVE/344-517--------------------------------------------------------------------------------
Q0C7B1_AEDAE/426-599--------------------------------------------------------------------------------
NGAP_DICDI/596-769--------------------------------------------------------------------------------
A7SJB4_NEMVE/409-582--------------------------------------------------------------------------------
Q4RUN4_TETNG/812-985--------------------------------------------------------------------------------
Q17P86_AEDAE/660-835--------------------------------------------------------------------------------
Q4TC99_TETNG/266-437--------------------------------------------------------------------------------
Q4TB25_TETNG/371-543--------------------------------------------------------------------------------
Q4SJ24_TETNG/320-491--------------------------------------------------------------------------------
Q6KAS9_MOUSE/518-689--------------------------------------------------------------------------------
A6ZJ45_CAEEL/167-340--------------------------------------------------------------------------------
A8XP25_CAEBR/203-376--------------------------------------------------------------------------------
A7SKG2_NEMVE/244-412--------------------------------------------------------------------------------
Q0CSQ0_ASPTN/793-964--------------------------------------------------------------------------------
Q2GTK6_CHAGB/605-776--------------------------------------------------------------------------------
Q7RW81_NEUCR/919-1092--------------------------------------------------------------------------------
Q6C802_YARLI/650-829--------------------------------------------------------------------------------
A3LZE1_PICST/612-848--------------------------------------------------------------------------------
Q5A506_CANAL/642-872--------------------------------------------------------------------------------
A5E274_LODEL/753-994--------------------------------------------------------------------------------
Q6FNM9_CANGA/542-738--------------------------------------------------------------------------------
BUD2_YEAST/541-721--------------------------------------------------------------------------------
Q6CW67_KLULA/546-743--------------------------------------------------------------------------------
Q4P4C4_USTMA/677-887--------------------------------------------------------------------------------
Q8SSU4_DICDI/586-757--------------------------------------------------------------------------------
Q55CR5_DICDI/1772-1943--------------------------------------------------------------------------------
Q54RT3_DICDI/342-510--------------------------------------------------------------------------------
Q54Q13_DICDI/104-276--------------------------------------------------------------------------------
NF1_RAT/1258-1432--------------------------------------------------------------------------------
Q8IMS2_DROME/1300-1475--------------------------------------------------------------------------------
Q54T13_DICDI/179-351--------------------------------------------------------------------------------
NFAA_DICDI/68-259--------------------------------------------------------------------------------
Q6FJ13_CANGA/1767-1935--------------------------------------------------------------------------------
IRA1_YEAST/1730-1898--------------------------------------------------------------------------------
A7TN87_VANPO/1674-1842--------------------------------------------------------------------------------
Q6CMT2_KLULA/1529-1697--------------------------------------------------------------------------------
IRA2_YEAST/1722-1890--------------------------------------------------------------------------------
Q6FQA1_CANGA/1674-1842--------------------------------------------------------------------------------
A7TEG6_VANPO/1672-1840--------------------------------------------------------------------------------
A5E1X9_LODEL/1368-1531--------------------------------------------------------------------------------
Q5A3W3_CANAL/1300-1463--------------------------------------------------------------------------------
Q8WZX6_NEUCS/1323-1495--------------------------------------------------------------------------------
A6SKM1_BOTFB/602-772--------------------------------------------------------------------------------
Q4PF31_USTMA/1621-1793--------------------------------------------------------------------------------
Q5KFG6_CRYNJ/1321-1493--------------------------------------------------------------------------------
A2E9Q3_TRIVA/1023-1197--------------------------------------------------------------------------------
A2FFI6_TRIVA/1018-1191--------------------------------------------------------------------------------
A2GF60_TRIVA/1036-1210--------------------------------------------------------------------------------
A2DLG7_TRIVA/987-1164--------------------------------------------------------------------------------
A2FB27_TRIVA/1019-1186--------------------------------------------------------------------------------
Q4DY44_TRYCC/96-330--------------------------------------------------------------------------------
A2DU37_TRIVA/325-480--------------------------------------------------------------------------------
A2EAY4_TRIVA/330-471--------------------------------------------------------------------------------
A2G2R5_TRIVA/334-477--------------------------------------------------------------------------------
Q86JJ7_DICDI/392-554--------------------------------------------------------------------------------
A2R7H8_ASPNC/194-402--------------------------------------------------------------------------------
Q7S5G6_NEUCR/166-375--------------------------------------------------------------------------------
Q6DNA0_SCHCO/171-379--------------------------------------------------------------------------------
Q54I64_DICDI/185-392--------------------------------------------------------------------------------
A7S5U4_NEMVE/139-338--------------------------------------------------------------------------------
GAP1_SCHPO/175-379--------------------------------------------------------------------------------
GAPA_DICDI/274-481--------------------------------------------------------------------------------
Q7SFX8_NEUCR/1171-1379--------------------------------------------------------------------------------
A7F2A6_SCLS1/1177-1385--------------------------------------------------------------------------------
A2QP50_ASPNC/1125-1333--------------------------------------------------------------------------------
A6R4D6_AJECN/1034-1242--------------------------------------------------------------------------------
Q4P2J5_USTMA/1116-1323--------------------------------------------------------------------------------
Q5KM85_CRYNJ/1428-1635--------------------------------------------------------------------------------
Q4RUQ1_TETNG/412-624--------------------------------------------------------------------------------
Q8BPA6_MOUSE/45-257--------------------------------------------------------------------------------
A7SXE3_NEMVE/113-325--------------------------------------------------------------------------------
Q9XZE9_HYDVU/1010-1222--------------------------------------------------------------------------------
A2RRC9_HUMAN/1009-1221--------------------------------------------------------------------------------
Q4SWD5_TETNG/1049-1261--------------------------------------------------------------------------------
RNG2_SCHPO/875-1077--------------------------------------------------------------------------------
Q8SUA0_ENCCU/433-602--------------------------------------------------------------------------------
Q552W4_DICDI/717-964--------------------------------------------------------------------------------
A0DYI4_PARTE/179-497--------------------------------------------------------------------------------
A0BIL6_PARTE/179-498--------------------------------------------------------------------------------
Q23D35_TETTS/318-639--------------------------------------------------------------------------------

PF00620

RHG05_MOUSE/1274-1425-----------------------SI--CFWP--TL------MR-PDFE------------------------------..
SYDE_DROME/968-1123-----------------------AT--VMGP--PL------ML-HSA.------------------------------..
LRG1_YEAST/755-912-----------------------ST--VITP--NI------LY-LRHK------------------------------..
P85B_MOUSE/125-265-----------------------AS--AFGP--LL------LR-IPPS------------------------------G.
I5P2_MOUSE/830-972-----------------------AS--IFGS--LL------LR-NPAR------------------------------..
RHG07_HUMAN/1092-1238-----------------------AV--CLAP--SL------FH-....------------------------------..
RHG28_HUMAN/399-552-----------------------ST--VMAP--NL------FF-SRSK------------------------------..
ARAP2_HUMAN/1129-1281-----------------------AL--VFSS--CL------FQ-TKGQ------------------------------..
MYO9A_HUMAN/2076-2225-----------------------AI--VFAP--CI------LR-CPD.------------------------------..
Q20442_CAEEL/896-1053-----------------------SV--CFTP--SL------FQ-LGAS------------------------------..
RHG18_HUMAN/343-492-----------------------AM--VMAP--NL------FM-C...------------------------------..
ARAP1_HUMAN/971-1120-----------------------AI--VFGP--TL------FQ-T...------------------------------..
PAC1_CAEEL/963-1123-----------------------AL--MFGP--SI------VR-PSDD------------------------------..
Q9V4C2_DROME/875-1034-----------------------AT--VFAP--NI------LR-S...------------------------------..
HMHA1_HUMAN/775-947-----------------------GI--VFGP--TL------LR-PRPT------------------------------..
GMIP_HUMAN/565-728-----------------------GI--VFGP--TL------LR-PPDG------------------------------..
RHG32_HUMAN/386-538-----------------------AI--VWAP--NL------LR-SKQI------------------------------..
RG190_DROME/1364-1529-----------------------AI--CWWP--TL------IP-IDFT------------------------------..
RG92B_DROME/265-418-----------------------AI--VMSP--NM------LW-PRID------------------------------..
RGAP1_ARATH/155-296-----------------------AM--EMAP--VI------MW-R...------------------------------..
BCR_HUMAN/1068-1221-----------------------AT--VFGP--TL------LR-PSEK------------------------------..
RHG21_HUMAN/1161-1314-----------------------AI--VFGP--TL------VR-TSED------------------------------..
RHG24_MOUSE/151-304-----------------------AT--VFGP--NI------LR-PKVE------------------------------..
RHG17_RAT/266-415-----------------------AI--VLGP--NL------LW-AKQ.------------------------------..
RHG20_HUMAN/377-527-----------------------AV--CVAP--SI------LW-PPAS------------------------------..
RBP1_RAT/210-356-----------------------SI--VLSP--TV------QI-S...------------------------------..
CHIN_MOUSE/282-436-----------------------GI--VFGP--TL------MR-SPEL------------------------------..
RHG09_HUMAN/556-726-----------------------GI--VFGP--TL------FR-PEQE------------------------------..
FNBP2_HUMAN/505-657-----------------------AI--CFGP--SL------MS-VPEG------------------------------..
Q9VDE9_DROME/1154-1302-----------------------AM--VFAP--NC------LR-CTSE------------------------------..
RRC1_CAEEL/294-443-----------------------AI--VWSP--NL------FR-P...------------------------------..
RHG35_RAT/1262-1413-----------------------SI--CFWP--TL------MR-PDFS------------------------------..
RHG39_HUMAN/909-1055-----------------------AM--VMAP--NC------LR-CQSD------------------------------..
Q9W4A9_DROME/319-473-----------------------AT--VFAP--TL------IA-TPQH------------------------------..
Q8MSA6_DROME/346-502-----------------------AM--VFGP--TL------LR-PGQT------------------------------..
RGA3_SCHPO/794-942-----------------------ST--VFAP--TL------MR-DK..------------------------------..
RGA4_SCHPO/761-910-----------------------AV--VFSP--TL------IR-DPDN------------------------------..
MYO9B_RAT/1673-1822-----------------------AI--IFAP--CL------LR-CPD.------------------------------..
RGA1_YEAST/805-985-----------------------AL--VFAP--GL------IR-DFSG------------------------------..
Q9P8F2_ZYGRO/832-1008-----------------------SL--VFAP--GL------IR-DYNG------------------------------..
RGA2_YEAST/802-985-----------------------SL--VFAP--SL------IH-DFDG------------------------------..
Q8R1F4_MOUSE/140-291-----------------------AI--VFGP--TL------LK-PERE------------------------------..
TG325_CAEEL/624-775-----------------------AI--VFGP--TL------FH-NGDG------------------------------..
Q9VWL9_DROME/292-441-----------------------AI--VWGP--CL------LS-ANQI------------------------------..
CDGAP_DROME/438-593-----------------------AI--VWAP--NL------LR-SPAL------------------------------..
O13384_COCHE/545-692-----------------------AI--CWAP--SI------MG-PHKG------------------------------N.
RGA7_SCHPO/520-671-----------------------AI--IWGP--TI------IK-Q...------------------------------..
Q95TR0_DROME/586-741-----------------------AI--IFGP--SI------IR-TPND------------------------------..
RGD1_YEAST/486-644-----------------------CI--IWGP--TI------AP-ANPD------------------------------..
BEM2_YEAST/1981-2141-----------------------AI--VFSM--SF------IN-QED.------------------------------..
ARAP3_HUMAN/920-1071-----------------------AL--LFAP--SV------FQ-TDG.------------------------------..
Q8T3K2_DROME/784-935-----------------------TM--IWGP--TL------LA-KKSD------------------------------..
O60432_HUMAN/255-431-----------------------AV--CFGP--VL------LP-ARQ.------------------------------..
Q9N9Z9_DROME/395-545-----------------------SL--IFGP--TI------VG-YSTP------------------------------..
Q9BZ74_HUMAN/363-512-----------------------AE--VFGS--TI------VA-HAVP------------------------------..
Q95VR1_9HYME/3-152-----------------------AK--VFGP--TL------VG-HSTG------------------------------..
Q9XUS9_CAEEL/437-588-----------------------AR--MVAP--AV------MG-HPVK------------------------------..
O00886_DICDI/28-181-----------------------AT--VFAP--NI------LR-PQKE------------------------------..
RHG01_HUMAN/260-408-----------------------AV--VFGP--NL------LW-AKD.------------------------------..
RHG08_MOUSE/210-360-----------------------AC--VFGL--NL------IW-PSQG------------------------------..
RG68F_DROME/292-439-----------------------AI--VFGP--NF------LW-S...------------------------------..
Q23130_CAEEL/263-421-----------------------SV--VFGP--NL------TW-PTDQ------------------------------..
FA13B_MOUSE/39-190-----------------------AA--VFGP--DV------FH-IYTD------------------------------..
Q8VHL8_MOUSE/532-684-----------------------AV--CFGP--TL------LP-VPAG------------------------------..
Q19370_CAEEL/541-693-----------------------AI--CFGP--TL------LP-IPEG------------------------------..
O82458_LOTJA/159-296-----------------------AM--VFAP--NM------TH-....------------------------------..
O01443_CAEEL/529-695-----------------------AT--IFAP--SI------LR-VDHD------------------------------..
RHG06_HUMAN/411-572-----------------------AT--IFGP--NL------LH-KQKS------------------------------..
Q8SY28_DROME/579-731-----------------------GV--CLAQ--SI------FH-SS..------------------------------..
Q8T0G4_DROME/380-537-----------------------AT--IMAP--SM------FP-PRYI------------------------------H.
RGA1_SCHPO/862-1019-----------------------AT--VITP--NI------LY-SKSN------------------------------D.
TAGAP_HUMAN/101-250-----------------------AI--CIGP--NM------LT-LEND------------------------------..
Q9DAP3_MOUSE/308-455-----------------------SV--RIAP--SM------LW-NPS.------------------------------..
Q9XW53_CAEEL/264-412-----------------------SV--CLAP--SF------LE-SPD.------------------------------..
BEM3_YEAST/927-1096-----------------------CI--VFSP--TL------NI-PI..------------------------------..
RGA2_SCHPO/1083-1234-----------------------CI--VFSP--TL------NI-P...------------------------------..
Q8RWQ4_ARATH/176-325-----------------------AA--CMAP--LL------LR-PLL.------------------------------..
YIL2_SCHPO/178-325-----------------------AL--CIGP--SF------SK-ADN.------------------------------..
RGA6_SCHPO/332-510-----------------------GI--IFGP--LL------LG-NSST------------------------------..
RGA5_SCHPO/68-226-----------------------AA--IFQP--GI------LS-HPDH------------------------------EV
BAG7_YEAST/76-235-----------------------AA--IVQP--SL------LS-HPKD------------------------------..
P85AA_XENLA/128-280-----------------------AE--IFSP--LL------FR-IQVS------------------------------..
OCRL_HUMAN/735-875-----------------------AT--LFTS--LL------LR-PP..------------------------------..
Q8STW6_ENCCU/162-313-----------------------LG--LFSL--VL------HP-QAAF------------------------------T.
Q8SRX9_ENCCU/91-256-----------------------ST--IMMP--NL------VI-KPHS------------------------------..
O96601_PLAFA/109-259-----------------------SK--IFAP--TF------FR-SKTP------------------------------..
Q9VUR5_DROME/55-207-----------------------GV--SVAP--SF------FQ-SCVS------------------------------..

PF08101

Q0TZ65_PHANO/41-476FDLDETFWWVWMISLASEETTDRKA--AFGR--CA------LI-ETRI...--------------------PG.AKWLVM
A5DN67_PICGU/33-435VTIQDYYIWTWLSSLGSDQHSIVKR--NFGR--SL------IA-EVEV...--------------------LDQRKWIVV
Q7SG59_NEUCR/43-514FDLDDAFWWVWMSSLAPEETLERKA--AFGR--CA------VI-ETLI...--------------------RA.GRWLVM
Q0CXG4_ASPTN/42-520LDLDDSFWWVWISSLAGEEPVSRKA--VFGR--CA------LL-ETVI...--------------------KN.TKWLVL
Q2HFE8_CHAGB/40-505FDLDDAFWWVWMSSLAPEETAERKS--AFGR--CA------VI-ETLI...--------------------RT.GRWLVM
Q6FSL9_CANGA/50-452LDIDDYFIWTWLSTLSYEETSDKRK--IFGR--SL------IL-EFEF...--------------------DGFKKWVVF
A6ZP33_YEAS7/67-473LDIDDYFIWTWLSSLSFEQTSEKKK--IFGR--SI------IL-EFEF...--------------------DGFKKWVVF
A7ELT0_SCLS1/44-518FDLDDSFWWVWISSLAGEETVDRKA--SFGR--CA------LI-ETTI...--------------------PG.GRWLLM
A7TPE0_VANPO/50-442IDIADYFPLVWESSLSYEQTIEKRS--LFGK--IL------LL-EFKF...--------------------DQFTKWVAF
A7TL24_VANPO/23-432VDIDDYFIWTWLSSLSNEQTSEKKR--LFGR--SL------II-EFEF...--------------------DGLKKWVVF
Q59KA9_CANAL/47-455VSIHDYYIWTWLASISSDQPSVTKQ--IFGR--SI------VV-EAEV...--------------------LGFQKWIVV
A3LX57_PICST/32-439VTLQDFYIWTWLSTLGSDQSTEFKK--IFGR--SL------VM-ESDL...--------------------KGFQKWIII
A6R3W6_AJECN/42-521MDLDASFWWVWISSLSGEEPTQRKA--VFGR--CA------LI-ETSV...--------------------SG.GKWFVL
Q75ED0_ASHGO/35-426TEISDYFIWTWMSTLSHEQISSKKK--IFGR--SF------IA-EFEL...--------------------DGFKKCIIV
A5DVE6_LODEL/31-437VMIQDYYIWTWLSSLASDQPEVQKR--TFGR--SI------VV-EADV...--------------------LGFKKWIVI
Q6CUF4_KLULA/45-447VDIDDYFIWAWLSTLSYEQTSQKRK--MFGR--SL------IL-EFEF...--------------------DGFKKWLIL
MUG8_SCHPO/44-440VTTNTNIWWVWAESRCTEIPESKRT--VFPN--CT------ML-...I...--------------------DKTGRLIIL
Q6C001_YARLI/164-665VAIDDFFVWVWMSSLSIEQPEMNKA--LFGR--SL------VV-EVEIAPG--------------------PGGRRWVVV
Q75EK6_ASHGO/152-598MGVSEWFISSWKYEMFL......GK--IYNT--LV------IK-LTKR...--------------------VGDCDWIVI

PF00616

RASL1_MOUSE/321-510-----------------------LR..FFAP..AI......LT.PKLFDLR...DQ....HA.DPQTSRSLLLLAKAV.Q
Q75DK0_ASHGO/576-771-----------------------LR..FFCP..VL......LN.PKLFHIV...ED....HP.DEQKRRLFTLLTKVL.M
Q757I8_ASHGO/1558-1726-----------------------LR..FFCP..AL......VS.PDSEGIT.........DPLYPKARRSFMILAKVI.Q
RGAA_DICDI/239-445-----------------------YR..FIQV..AM......VS.PEEYDLV....G....REIHPTARKNLINVSKVL.Q
A5DN39_PICGU/903-1097-----------------------YK..HYVG..SI......IQNPENFGIS...VR....DPFNPS..............
GAPD1_MOUSE/152-353-----------------------AC..FICP..AV......VN.PEQYGII...SD....APINEVARFNLMQVGRLL.Q
GAP2_DROME/495-668-----------------------LR..FLCP..AI......LS.PSLFNIT...SE....LP.SARATRNLTLVAKTL.Q
Q0URT8_PHANO/796-948-----------------------LR..FFVP..AV......LN.PKLFGLL............................K
A5DR10_PICGU/619-844-----------------------LR..FFCP..AI......LN.PKLFYLT...KD....HQ.TGDSQRTLTLLAKVL.L
Q6BPM2_DEBHA/608-836-----------------------LR..FFCP..AI......LN.PKLFYLT...KD....HQ.TGKTQRTLTLIAKIL.L
A3GHY3_PICST/1310-1472-----------------------LR..FLCP..AI......IS.PEAFFGI....N....VT.NPKVKRTLMQLVKVL.Q
Q0V6E4_PHANO/854-1062-----------------------KA..YIQP..AL......IQ.PQHWGVV....D....RGLSPVMNRNLGAVNKVL.G
Q6CFR5_YARLI/832-1039-----------------------SL..FVIP..PI......VA.PDDYGVC....E....SAIGPAQRRNLGEVAKML.A
IQGA2_MOUSE/938-1150-----------------------YR..YMNP..AI......VA.PDGFDII....DMTAGGQINSNQRRNLGSVAKVL.Q
A5E5Z0_LODEL/955-1161-----------------------FK..HYIG..SI......FNTPENYGIR.........LKQDSKEKINLHQMYRVL.L
Q5AH02_CANAL/977-1177-----------------------VK..HYLG..SI......LQVPENYGIL.........TGNNDT.............Q
A3LY27_PICST/921-1130-----------------------IK..HYIA..PI......LQFPENFGFQN..K.....DFYNPKARDNLKHLSRVM.L
A6ZW14_YEAS7/881-1068-----------------------NV..FVSE..YL......VN.REYYGYK............DSNVQKNNQKIDILM.K
A7TK28_VANPO/900-1076-----------------------GT..LVKE..YL......VN.RRYYGFV............DNN...........Y.S
Q6FSF6_CANGA/864-1037-----------------------ES..FIEH..FM......VN.FQKFGFDQ.YN........................D
Q6CR01_KLULA/879-1073-----------------------DN..FIFV..AL......MKRSDFSSST....V....GLNYDEKARVLTETLKVI.F
A7RYQ9_NEMVE/151-314-----------------------NY..LVCP..AI......IN.PEPYGINS..D.....MQVSKVARLNLQQISSLLCK
Q1PQE2_DROMI/101-305-----------------------TH..FISP..AI......VS.ADLVGII...D.....VNVSERMRHNLNQIVQLL.Q
RME6_CAEEL/161-355-----------------------SN..LICP..AI......IS.PQKFGVVD.ND.....VRVGTIVNHNLVQIAMII.Q
Q54F48_DICDI/1131-1337-----------------------EN..FFIP..AI......IR.PDHYGVL...SG....LTISQKSRHNLIQIAKMVLD
Q869U6_DICDI/119-289-----------------------NK..LFVP..AL......IS.PQLYDLIP.PQI....HL.NSRSTSNLSILARYL.S
A2G1P2_TRIVA/157-304-----------------------DL..LLQP..AL......IN.PKLFALI.............................
Q9XVW6_CAEEL/11-201-----------------------TLNIFILPAAAFVVLRSIVR.PRNFWIL.........VLSTALLVSMYSGYSKKY.Q
Q6BG44_PARTE/169-435-----------------------NK..WILP..EF......TA.MFLNQQQ.........LESSQYQTSNIAAISKIL.L
RASL2_HUMAN/323-512-----------------------LR..FFSP..AI......MS.PKLFHLR...ER....HA.DARTSRTLLLLAKAV.Q
A2CE77_DANRE/319-508-----------------------LR..FISP..AI......MS.PKLFHLR...EK....HA.DARTSRTLLLLAKAV.Q
Q66JF5_XENTR/327-516-----------------------LR..FFAP..AI......LT.PKLFHLR...EH....HA.DPRTARTLLLIAKAV.Q
Q4T1V0_TETNG/259-481-----------------------LR..FFAP..AI......LT.PKLFQLR...EQ....HA.DTRTSRTLLLLAKAL.Q
RASA3_RAT/351-524-----------------------LR..FFAP..AI......LS.PNLFQLT...PH....HT.DPQTSRTLTLISKTI.Q
RASA2_HUMAN/377-550-----------------------LR..FFAV..AV......VS.PHTFHLR...PH....HP.DAQTIRTLTLISKTI.Q
A7RYE3_NEMVE/344-517-----------------------LR..FFAP..AI......LN.PKLFQMR...NE....HP.DPLVARTLTLASKAI.Q
Q0C7B1_AEDAE/426-599-----------------------LR..FFAP..AI......LG.PKLFDLT...TE....PV.DEQTTRTLTLISKTI.Q
NGAP_DICDI/596-769-----------------------LR..FFCP..AI......LA.PKLFDLM...PD....HP.GIKTTRSLILIAKTL.Q
A7SJB4_NEMVE/409-582-----------------------LR..LFCP..AI......MN.PKTCNLM...SE....LP.SATAARTLTLVAKCL.Q
Q4RUN4_TETNG/812-985-----------------------LR..LICP..AI......LN.PRMFNII...TD....PP.SSAAGRTLTLVAKSV.Q
Q17P86_AEDAE/660-835-----------------------LR..LLCP..AL......LN.PRQFGLV...SE....TP.HQMATRTLIMVAKCL.Q
Q4TC99_TETNG/266-437-----------------------LR..FLCP..AV......MS.PSLFDLM...QE....YP.DERSARTLTLIAKVI.Q
Q4TB25_TETNG/371-543-----------------------LR..FLCP..AI......MS.PSLFSLM...QE....YP.DERTSRTLTLIAKVI.Q
Q4SJ24_TETNG/320-491-----------------------LR..FMCP..AI......MS.PSLFNLM...QE....YP.AEPTSRTLTLIAKVM.Q
Q6KAS9_MOUSE/518-689-----------------------LR..LLCP..AI......LA.PSLFGLA...PE....HP.APGPARTLTLIAKVI.Q
A6ZJ45_CAEEL/167-340-----------------------LR..FLCP..AI......LS.PSLFNLV...SE....YP.SPTNARNLTLIAKTL.Q
A8XP25_CAEBR/203-376-----------------------LR..FLCP..AI......LS.PSLFNLV...AE....FP.SINNARNLTLIAKTL.Q
A7SKG2_NEMVE/244-412-----------------------LR..FLCP..AI......MS.PSLFHLV...QE....YP.NERILRTLTLIAKVI.Q
Q0CSQ0_ASPTN/793-964-----------------------LR..FFCP..AI......LN.PKLFGLL...KD....HP.RPRAQRTLTLIAKAL.Q
Q2GTK6_CHAGB/605-776-----------------------LR..FLCP..AI......LN.PKLFGLL...RD....HP.QPRAQRTLTLIAKSL.Q
Q7RW81_NEUCR/919-1092-----------------------LR..FLCP..AI......LN.PKLFGLL...RD....HP.KPRAQRTLTLIAKTI.Q
Q6C802_YARLI/650-829-----------------------LR..FICP..AL......LS.PKLFGLV...HN....SP.QPEVQRTLTLLAKLM.Q
A3LZE1_PICST/612-848-----------------------LR..FFCP..AI......LN.PKLF..YL.TKN....HQ.SGTTQRTLTLIAKIL.L
Q5A506_CANAL/642-872-----------------------LR..FFCP..AI......LN.PKLF..YL.AKN....HQ.TGSTQRTLTLIAKIL.L
A5E274_LODEL/753-994-----------------------LR..FFCP..AI......LN.PKLF..YL.TKN....HQ.TGSTQRTLTLIAKIL.L
Q6FNM9_CANGA/542-738-----------------------LR..FFCP..LI......LN.PKLF.KFT..ES....HL.TMKQTRNMLLITKVL.Q
BUD2_YEAST/541-721-----------------------LR..FFCP..VI......LN.PKLFKYV....S....QNLNETARRNLTLISKVL.L
Q6CW67_KLULA/546-743-----------------------LR..FFCP..VI......LN.PKIF.NFV..EH....HP.GENARRSLTLLAKVV.M
Q4P4C4_USTMA/677-887-----------------------LR..LFCA..AL......NS.PQLYGLA....P....CQPSRSASRKLLLLSKVL.L
Q8SSU4_DICDI/586-757-----------------------LR..LFCP..AC......VS.PEGQAII...SP....GRVGITERRSLILVAKCL.Q
Q55CR5_DICDI/1772-1943-----------------------LR..FLCP..SI......LA.PHTSGLV...EE....QP.GPEATRALVLIGKVL.Q
Q54RT3_DICDI/342-510-----------------------LR..FFCP..CI......LS.PDTCGVS...DS....ASLTMEARRALILVSKTL.Q
Q54Q13_DICDI/104-276-----------------------LR..FICP..AI......VA.PEAFGLIP.REE....EP.TSETRRGLVLVSKLL.Q
NF1_RAT/1258-1432-----------------------LR..FINP..AI......VS.PYEAGIL...DK....KP.PPRIERGLKLMSKVL.Q
Q8IMS2_DROME/1300-1475-----------------------LR..FINP..AI......VS.PQELGIV...DK....QV.HSSAKRGLMLMSKIL.Q
Q54T13_DICDI/179-351-----------------------LR..FVNP..AI......FS.PEALGLI....S....VAPNSNVRRTLTLVSKIL.Q
NFAA_DICDI/68-259-----------------------LR..FFSP..AI......VT.PEYSKLLS.SEV....AP.SKRAKRNLVLLAKVL.Q
Q6FJ13_CANGA/1767-1935-----------------------LR..FLGP..AI......VS.PDAENII.........LISQTRDKRPLITLAKVL.Q
IRA1_YEAST/1730-1898-----------------------LR..FIGP..AL......VS.PDSENII.........IVTHAHDRKPFITLAKVI.Q
A7TN87_VANPO/1674-1842-----------------------LR..FICP..AL......VS.PETENII.........GVTPLKEKRSLIQMAKVI.Q
Q6CMT2_KLULA/1529-1697-----------------------LR..FFCP..AL......VS.PDSEEIV.........DSLTPKARKSSMSLAKVI.Q
IRA2_YEAST/1722-1890-----------------------LR..FFCP..AL......VS.PDSENII.........DISHLSEKRTFISLAKVI.Q
Q6FQA1_CANGA/1674-1842-----------------------LR..FICP..AL......VS.PESENLV.........NTISIKEKKSFISLAKVI.Q
A7TEG6_VANPO/1672-1840-----------------------LR..FLCP..AV......VS.PESENII.........PIVELKFRKSLIALAKVI.Q
A5E1X9_LODEL/1368-1531-----------------------LR..FICP..AV......IS.PEQFFKI.........PVENPKTKRSLMQIVKVL.Q
Q5A3W3_CANAL/1300-1463-----------------------LR..FLCP..AI......IS.PEQHFKL.........PINNPKVKRSLMQLVKVL.Q
Q8WZX6_NEUCS/1323-1495-----------------------LR..FFCP..AI......VA.PEVEGLV...AT....AP.SKEMRRGLLLIAKVI.Q
A6SKM1_BOTFB/602-772-----------------------LR..FFCP..AI......VA.PDAEGLI...AS....PP.SKEMRRGLLLIAKVV.Q
Q4PF31_USTMA/1621-1793-----------------------LR..FISP..AV......VS.PHMIDIN...LT....GP.SRDLRRGLVLISKIL.I
Q5KFG6_CRYNJ/1321-1493-----------------------LR..FFCP..AI......VS.PESIDLD....V....NPDTRETRRALLLITKVI.Q
A2E9Q3_TRIVA/1023-1197-----------------------LR..FILP..AF......SV.TALVGLP.........PMLPEEPRACLLTISVIL.M
A2FFI6_TRIVA/1018-1191-----------------------LR..FIFP..AF......SV.MSVLGLP.........GNLSEEARSCLMTISAIL.M
A2GF60_TRIVA/1036-1210-----------------------LR..FIIP..SF......SN.VSMVGIT.........SPVGDQPRDVLMQTSNVI.M
A2DLG7_TRIVA/987-1164-----------------------LR..LIIP..NL......TA.PPNEEEE...DK....FDISEEERQVLVSVCIAL.M
A2FB27_TRIVA/1019-1186-----------------------LR..FICP..TL......IE.PTRAGYT.........EAIPEQTRTCLVHLSSLL..
Q4DY44_TRYCC/96-330-----------------------LR..AVVP..ALLNTVPRLL.PGVSCFD..........THYILVQKRCTLLAKLS.Q
A2DU37_TRIVA/325-480-----------------------LR..FFIA..FF......SS.PSEMPIS................TVDSVRYKKVI.I
A2EAY4_TRIVA/330-471-----------------------LR..FISS..II......SN.PR.................................E
A2G2R5_TRIVA/334-477-----------------------LR..FFTP..AI......VT.P...................................
Q86JJ7_DICDI/392-554-----------------------SR..VFAP..VV......AR.PHQHQLF....H....VIPSDQALEVLAFLSTMF.V
A2R7H8_ASPNC/194-402-----------------------LR..FINP..AI......VT.PRSYMLI....E....STPTEKPRRTLTLIAKML.Q
Q7S5G6_NEUCR/166-375-----------------------LR..FINP..AI......VT.PKSYMLI....D....GTPADKPRKTLTYVAKML.Q
Q6DNA0_SCHCO/171-379-----------------------LR..FINP..AI......VT.PQAYMLV....E....GVPAKHPRRTLTLIAKML.Q
Q54I64_DICDI/185-392-----------------------LR..YINP..AV......VT.PQAFMLV....D....AKLSNNTKRNLTFPAKML.Q
A7S5U4_NEMVE/139-338-----------------------LR..FINP..AI......VT.PTAYMLV....N....KQPTYTMRRNLTLIAKIL.Q
GAP1_SCHPO/175-379-----------------------LR..FVNP..AI......IS.PQTSMLL....D....SCPSDNVRKTLATIAKII.Q
GAPA_DICDI/274-481-----------------------YR..FINL..AI......VT.PDAFEIL....D....KELSITSRKNLVNIAKVL.Q
Q7SFX8_NEUCR/1171-1379-----------------------RF..YLQP..AL......LG.PESYGVT....E....KQMSPLQKRNLGEVAKVL.G
A7F2A6_SCLS1/1177-1385-----------------------RF..YLYP..AL......TT.PESMGVV....E....RQLTPLQKRNLGEVAKVL.G
A2QP50_ASPNC/1125-1333-----------------------RN..YFHP..AM......VE.PEKYGVI....D....RGLTQEQKRNLSEISKVI.A
A6R4D6_AJECN/1034-1242-----------------------KN..YLYP..AV......LE.PERCSVV....D....RGLTQEQKRNLGEISKVI.A
Q4P2J5_USTMA/1116-1323-----------------------YR..YLNP..AI......VA.PEGFDVV....E....TLVGPVQRKNLAEVSKML.T
Q5KM85_CRYNJ/1428-1635-----------------------LP..FLLP..AI......IA.PEQFGMA....P....DGVGAVERRNLSELANLL.T
Q4RUQ1_TETNG/412-624-----------------------YR..YMNP..AI......VA.PDGFDII....ELSAGGQLPLDQRRNLGSVAKML.Q
Q8BPA6_MOUSE/45-257-----------------------YR..YMNP..AI......VA.PDAFDII....DLSAGGQLTTDQRRNLGSIAKML.Q
A7SXE3_NEMVE/113-325-----------------------YR..YMNP..AI......VA.PDAFDIV....SISVERGLQPEQRRNLGTIAKLL.Q
Q9XZE9_HYDVU/1010-1222-----------------------YR..YMNP..AI......VA.PDAFDIV....DLSYGEQLSSQIRGVLGSDAKVL.Q
A2RRC9_HUMAN/1009-1221-----------------------YR..FLNP..AV......VA.PDAFDIV....AMAAGGALAAPQRHALGAVAQLL.Q
Q4SWD5_TETNG/1049-1261-----------------------YR..YMNP..AI......VA.PDGFDVL....DCSAASALQPEQRRMLGSVSRML.Q
RNG2_SCHPO/875-1077-----------------------WA..YVAP..VL......VS.PDNFKLV....D....GSITALQRKNLYTLSSIL.S
Q8SUA0_ENCCU/433-602-----------------------SE..FVMP..FI......LA.PDAFIES.........FEVSKSLRSKCFIISKVL.G
Q552W4_DICDI/717-964-----------------------IY.RFIIP..II......SS.PDLLNELVLLQH....PYITKQSRFNLSQLSRLI.Q
A0DYI4_PARTE/179-497-----------------------NV..WLIP..QL......VF.PKQYSSF.........KYIREDHENTI........Q
A0BIL6_PARTE/179-498-----------------------NV..WLIP..QL......VF.PKQYSSF.........KYIREDHENTV........Q
Q23D35_TETTS/318-639-----------------------DC..YLIP..QF......MF.SHHLRQV.........NLIKDEHEDNLFEIKKLM.K

PF00620

RHG05_MOUSE/1274-1425.NRE
SYDE_DROME/968-1123.SAQ
LRG1_YEAST/755-912EISN
P85B_MOUSE/125-265GEGD
I5P2_MOUSE/830-972.HQK
RHG07_HUMAN/1092-1238.LNT
RHG28_HUMAN/399-552.HSD
ARAP2_HUMAN/1129-1281.TSE
MYO9A_HUMAN/2076-2225.TTD
Q20442_CAEEL/896-1053.RLD
RHG18_HUMAN/343-492.HAL
ARAP1_HUMAN/971-1120.DGQ
PAC1_CAEEL/963-1123NMAT
Q9V4C2_DROME/875-1034.THL
HMHA1_HUMAN/775-947.EAT
GMIP_HUMAN/565-728PRAA
RHG32_HUMAN/386-538.ESA
RG190_DROME/1364-1529DMGH
RG92B_DROME/265-418KSSN
RGAP1_ARATH/155-296.EDN
BCR_HUMAN/1068-1221ESKL
RHG21_HUMAN/1161-1314.NMT
RHG24_MOUSE/151-304DPLT
RHG17_RAT/266-415.EGT
RHG20_HUMAN/377-527SSPE
RBP1_RAT/210-356.NRV
CHIN_MOUSE/282-436DPMA
RHG09_HUMAN/556-726.TSD
FNBP2_HUMAN/505-657.HDQ
Q9VDE9_DROME/1154-1302DPKV
RRC1_CAEEL/294-443.PPT
RHG35_RAT/1262-1413.SMD
RHG39_HUMAN/909-1055DPRV
Q9W4A9_DROME/319-473MTNL
Q8MSA6_DROME/346-502QVKQ
RGA3_SCHPO/794-942.VNR
RGA4_SCHPO/761-910.SRD
MYO9B_RAT/1673-1822.NSD
RGA1_YEAST/805-985EKDI
Q9P8F2_ZYGRO/832-1008DKDI
RGA2_YEAST/802-985EKDI
Q8R1F4_MOUSE/140-291.TGN
TG325_CAEEL/624-775AVNL
Q9VWL9_DROME/292-441QLDI
CDGAP_DROME/438-593ESGG
O13384_COCHE/545-692NMAD
RGA7_SCHPO/520-671.ATI
Q95TR0_DROME/586-741TLET
RGD1_YEAST/486-644DAND
BEM2_YEAST/1981-2141.LAN
ARAP3_HUMAN/920-1071.RGE
Q8T3K2_DROME/784-935.ELI
O60432_HUMAN/255-431.APT
Q9N9Z9_DROME/395-545DPDQ
Q9BZ74_HUMAN/363-512.NPE
Q95VR1_9HYME/3-152.NLT
Q9XUS9_CAEEL/437-588.QSQ
O00886_DICDI/28-181TLNQ
RHG01_HUMAN/260-408.AAI
RHG08_MOUSE/210-360VASL
RG68F_DROME/292-439.RST
Q23130_CAEEL/263-421EVPI
FA13B_MOUSE/39-190.VED
Q8VHL8_MOUSE/532-684.QDP
Q19370_CAEEL/541-693.KDQ
O82458_LOTJA/159-296.MAD
O01443_CAEEL/529-695KLHE
RHG06_HUMAN/411-572SDKE
Q8SY28_DROME/579-731.IST
Q8T0G4_DROME/380-537PSDN
RGA1_SCHPO/862-1019PVDE
TAGAP_HUMAN/101-250.QSL
Q9DAP3_MOUSE/308-455.LSN
Q9XW53_CAEEL/264-412.PME
BEM3_YEAST/927-1096.SML
RGA2_SCHPO/1083-1234.SDI
Q8RWQ4_ARATH/176-325.AGE
YIL2_SCHPO/178-325.IAE
RGA6_SCHPO/332-510DLSK
RGA5_SCHPO/68-226YSKD
BAG7_YEAST/76-235.EMC
P85AA_XENLA/128-280.SSD
OCRL_HUMAN/735-875.PNL
Q8STW6_ENCCU/162-313TLDD
Q8SRX9_ENCCU/91-256.ELD
O96601_PLAFA/109-259.NAI
Q9VUR5_DROME/55-207DGKT

PF08101

Q0TZ65_PHANO/41-476EEQV
A5DN67_PICGU/33-435SEQI
Q7SG59_NEUCR/43-514EEIV
Q0CXG4_ASPTN/42-520EEQV
Q2HFE8_CHAGB/40-505EEIV
Q6FSL9_CANGA/50-452QESD
A6ZP33_YEAS7/67-473QECD
A7ELT0_SCLS1/44-518EEMV
A7TPE0_VANPO/50-442QAVD
A7TL24_VANPO/23-432QECD
Q59KA9_CANAL/47-455TEKT
A3LX57_PICST/32-439SEQT
A6R3W6_AJECN/42-521EEQV
Q75ED0_ASHGO/35-426EESD
A5DVE6_LODEL/31-437TEKL
Q6CUF4_KLULA/45-447EECD
MUG8_SCHPO/44-440QQTV
Q6C001_YARLI/164-665EEIL
Q75EK6_ASHGO/152-598STDD

PF00616

RASL1_MOUSE/321-510SIGN
Q75DK0_ASHGO/576-771NLST
Q757I8_ASHGO/1558-1726NIAN
RGAA_DICDI/239-445ALFN
A5DN39_PICGU/903-1097.LTN
GAPD1_MOUSE/152-353QLAM
GAP2_DROME/495-668TLAN
Q0URT8_PHANO/796-948GLAN
A5DR10_PICGU/619-844NLAN
Q6BPM2_DEBHA/608-836NLAN
A3GHY3_PICST/1310-1472NTAN
Q0V6E4_PHANO/854-1062QVAA
Q6CFR5_YARLI/832-1039QIAS
IQGA2_MOUSE/938-1150HAAS
A5E5Z0_LODEL/955-1161QLFS
Q5AH02_CANAL/977-1177KAKS
A3LY27_PICST/921-1130QVFS
A6ZW14_YEAS7/881-1068SLAT
A7TK28_VANPO/900-1076NIEE
Q6FSF6_CANGA/864-1037ENIN
Q6CR01_KLULA/879-1073ALKT
A7RYQ9_NEMVE/151-314KCAS
Q1PQE2_DROMI/101-305RLAL
RME6_CAEEL/161-355MISL
Q54F48_DICDI/1131-1337FLRN
Q869U6_DICDI/119-289TCIT
A2G1P2_TRIVA/157-304PETS
Q9XVW6_CAEEL/11-201EAES
Q6BG44_PARTE/169-435SVWK
RASL2_HUMAN/323-512NVGN
A2CE77_DANRE/319-508TIGN
Q66JF5_XENTR/327-516SIGN
Q4T1V0_TETNG/259-481SVGN
RASA3_RAT/351-524TLGS
RASA2_HUMAN/377-550TLGS
A7RYE3_NEMVE/344-517SLGN
Q0C7B1_AEDAE/426-599SLGN
NGAP_DICDI/596-769NLAN
A7SJB4_NEMVE/409-582KLAN
Q4RUN4_TETNG/812-985NLAN
Q17P86_AEDAE/660-835NLAN
Q4TC99_TETNG/266-437TLAN
Q4TB25_TETNG/371-543NLAN
Q4SJ24_TETNG/320-491NLAS
Q6KAS9_MOUSE/518-689NLAN
A6ZJ45_CAEEL/167-340NLAN
A8XP25_CAEBR/203-376NLAN
A7SKG2_NEMVE/244-412NLAN
Q0CSQ0_ASPTN/793-964GLAN
Q2GTK6_CHAGB/605-776ALAN
Q7RW81_NEUCR/919-1092ALAN
Q6C802_YARLI/650-829SFAN
A3LZE1_PICST/612-848NFAN
Q5A506_CANAL/642-872NFAN
A5E274_LODEL/753-994NLAN
Q6FNM9_CANGA/542-738NIST
BUD2_YEAST/541-721NLST
Q6CW67_KLULA/546-743NLST
Q4P4C4_USTMA/677-887ALAS
Q8SSU4_DICDI/586-757NLSN
Q55CR5_DICDI/1772-1943NLAN
Q54RT3_DICDI/342-510NVAN
Q54Q13_DICDI/104-276NLAN
NF1_RAT/1258-1432SIAN
Q8IMS2_DROME/1300-1475NIAN
Q54T13_DICDI/179-351NISN
NFAA_DICDI/68-259NASN
Q6FJ13_CANGA/1767-1935NMAN
IRA1_YEAST/1730-1898SLAN
A7TN87_VANPO/1674-1842NMAN
Q6CMT2_KLULA/1529-1697NIAN
IRA2_YEAST/1722-1890NIAN
Q6FQA1_CANGA/1674-1842NIAN
A7TEG6_VANPO/1672-1840SLAN
A5E1X9_LODEL/1368-1531NIAN
Q5A3W3_CANAL/1300-1463NMAN
Q8WZX6_NEUCS/1323-1495NLAN
A6SKM1_BOTFB/602-772NLAN
Q4PF31_USTMA/1621-1793TLAS
Q5KFG6_CRYNJ/1321-1493NLAN
A2E9Q3_TRIVA/1023-1197ASAT
A2FFI6_TRIVA/1018-1191ATIT
A2GF60_TRIVA/1036-1210SSIL
A2DLG7_TRIVA/987-1164AASL
A2FB27_TRIVA/1019-1186MVAA
Q4DY44_TRYCC/96-330KAAH
A2DU37_TRIVA/325-480PFGA
A2EAY4_TRIVA/330-471TDPN
A2G2R5_TRIVA/334-477..GN
Q86JJ7_DICDI/392-554NFGT
A2R7H8_ASPNC/194-402NLAN
Q7S5G6_NEUCR/166-375NLAN
Q6DNA0_SCHCO/171-379NLAN
Q54I64_DICDI/185-392NLAN
A7S5U4_NEMVE/139-338SMAN
GAP1_SCHPO/175-379SVAN
GAPA_DICDI/274-481NLFT
Q7SFX8_NEUCR/1171-1379QIAS
A7F2A6_SCLS1/1177-1385QIST
A2QP50_ASPNC/1125-1333QVAS
A6R4D6_AJECN/1034-1242QVAS
Q4P2J5_USTMA/1116-1323QIAV
Q5KM85_CRYNJ/1428-1635HVAG
Q4RUQ1_TETNG/412-624HAAA
Q8BPA6_MOUSE/45-257HAAS
A7SXE3_NEMVE/113-325FAAS
Q9XZE9_HYDVU/1010-1222YAAS
A2RRC9_HUMAN/1009-1221HAAA
Q4SWD5_TETNG/1049-1261HAAA
RNG2_SCHPO/875-1077EIFS
Q8SUA0_ENCCU/433-602YITD
Q552W4_DICDI/717-964SVFS
A0DYI4_PARTE/179-497QIHT
A0BIL6_PARTE/179-498QIHT
Q23D35_TETTS/318-639NIYR

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window