Sequence alignment for CL0425

PF00361

NUON_ECOLI/122-402ANHLASLFLGIE..LISLPLFG.LVGYAFRQKRSLEASIKYTILSAAASSFLLFGMA..LVYAQS.GDLSFVALGK....
NU5M_TRYBB/130-400SYDFLTAYCGWE..LLGLFSFF.LISYFWYRFFALKFGFKAFFIGKIGDVLLIFAFS..IIFLSN.GFCMTTFYFL....
NU2M_PICCA/154-453SNNLISIFISIE..LQSYSLYI.LTGIIPKSQKSGHNSLFYYLIGGIGSIIILYGIS..LLYYIT.SNIFINNINL....
NQO14_PARDE/123-398AGDLLTLYMGLE..LQSLALYV.VAAMRRDSVRSSEAGLKYFVLGSLSSGLLLYGAS..LVYGFA.GTTGFEGIIS....
NQO12_PARDE/135-420ADNLLQMFFGWE..GVGVASYL.LIGFYYKKASANAAAMKAFIVNRVGDFGFLLGIF..GIYWLT.GSVQFDEIFRQVPQ
NUOL_ECOLI/133-406ADNLLLMYLGWE..GVGLCSYL.LIGFYYTDPKNGAAAMKAFVVTRVGDVFLAFALF..ILYNEL.GTLNFREMVE....
NU5M_CHLRE/132-391ADNLLVMLVGWE..GIGVCSYL.LIGYWSHRLSAVKSAQKAILVNRVSDGLLMWGVL..WVWYHL.GSLEYDLLNV....
NU2M_BALMU/23-270SSHWLLAWIGFE...MNMMAFI.PIMMKNPSPRATEASTKYLLTQATASALLMMAVI..INLMYS.GQWTITKLFN....
NDHF_BACSU/122-391SGDLRLMVLFWGATLVGLTLLIRLNSAWQVASEAAKISGRLFLLSWFS...LFFAMM..WLFHAT.GQWQLSLVVT....
NU4M_ANOGA/106-374SMSVFMFYLFFE..ASLIPTLF.LILGWGYQPERLQAGVYLLFYTLLASLPLLIGIF..YILNSK.NTLSFTLLLN....
NU4M_ASCSU/87-346PSNVILMYMYFE..LSMFPILV.MILGYGSQIEKINSSYYLIFYAALCSFPFLFVYF..KSFFFI.SLVYFDFNLS....
NU4M_ASPAM/130-401VLDVLLFYIFFE..SILPPLFL.LIGLFGSS.NKVRASFYLFLYTLLGSLFMLLSIV..AMSSIM.GTTDFDALSK....
NU5M_ALBCO/96-355SGSIFTLLLGWD..GLGLTSFA.LIAYYDNY.NASSSAFLTLMTNRLGDVLIIATFS..VILVTG.LTVHFPPYTL....
NU2M_CHOCR/131-415SYDLLTMYLSIE..FQSLIFYI.LASFKRTSEFSTEAGLKYFVLGAFSSGLLLFGSS..LIYGLT.GLTNFLDLAK....
NU5M_BALMU/134-399ANNLFQLFIGWE..GVGIMSFL.LIGWWFGRTDANTAALQAILYNRIGDIGLLASMA..WFLSNM.NTWDLQQIFM....
NU5C_MAIZE/141-424SSNLIQIYFFWE..LVGMCSYL.LIGFWFTRPIAASACQKAFVTNRVGDFGLLLGIL..GFFWIT.GSLEFRDLFK....
NU4C_MAIZE/131-404SRDLLLFFIMWE..LELIPVYL.LLSMWGGK.RRLYSATKFILYTAGGSIFFLIGVLGMGLYGSNEPGLDLERLIN....
NU5M_ASCSU/96-353SSGCFSMLVSWD..LLGISSFF.LVLFYNNW.DSCSGAMNTVLTNRLGDFFLFVFFS..STIF...SSYYFLSLSF....
NQO13_PARDE/130-412ALDLVLFYLFFE..AGLIPMFL.IIGIWGGK.DRIYASFKFFLYTFLGSVLMLVAMI..AMYRMA.GTTDIPTLLTFDFP
NU2M_PARLI/23-270AENWFVIWLGLE...LSTLALI.PILWFCFTPRNIEATIKYFLVQAFSAALLLNSAL..IQAWFS.GSWSALIPME....
NU4M_APILI/111-379SMNLLLFYLFYE..FGLLLIFY.LVVKWGYSENRWLSGFYLMFYTMIFSLPMLYIIY..YIYLID.YSLNFMLMEM....
NU4M_ARBLI/111-383SLELILFYIAFE..TTLVPTLI.LITRWGALMERFQAGLYFIFYTLFGSLPLLISLI..ALYFSS.NSLSIPNVEL....
NU4M_CHICK/112-385ATELMLFYISFE..ATLIPTLI.LITRWGNQPERLSAGIYLLFYTLISSLPLLVSIL..YLHTNT.GTLHLPIIKL....
NU5M_ANOGA/108-372SPNLISILLGWD..GLGLVSYC.LVIYFQNV.KSYNAGMLTALSNRIGDVALLLAIA..WMLNY..GSWNYIFYLD....
NU2M_MARPO/130-407AYDLIAMYLAIE..LQSLCFYV.IAASKRDSEFSTEAGLKYFILGAFSSGILLFGCS..MIYGFT.GVTNFEELAK...I
NU2M_APILI/25-259SNNIFIQWMLME.....FGTII.SISLINIKSTNKTPSLIYYSVSVISSIFLFFMII..VYL....SSISFTKTDT....
NU2M_ANOGA/23-266SNSWLGAWMGLE..INLLSFIP.LMNDNKKNLLTSESSLKYFLTQAFASSILLFAII..MLMFLYNNNLSLYNSFN....
NU4M_ALBCO/97-367VCDFLTFYVMFE..VSLIPTLL.LILLWGYQPERMQAGFYLMLYTVTASLPLLLLLL..YLYYTV.GSLNFYIIMV....
NU2M_PISOC/23-270SHSWFSVCDGLE...LNTLSVL.PILCGQFSPRGVESTIKYFLVQAFSAAMILNVAL..VQLWLC.SSWSVSCPLN....
NU2M_ALBCO/22-245SSNWIIIWIGLEISLLGFVSYY.ML...MKKIMSGEGIMMYFLIQSVSSTVMLLNGL..YIFVNHASSYIYL........
NU4M_PARTE/134-402CSDLIAFFFFYE..VLMLGSVL.VVFFGSYSKKSIHAVIYFVAWTQLGSLFVLLACL..YIYSLT.NSTNFFVIKT....
NU5M_CANPA/86-356SDNYIMMFIGWE..FVGVISYL.LISFWSTRIAAMKAALSAILLNRMGDTFFMLALG..IFLSYF.HAVDFDTLSL....
NU2C2_MAIZE/146-424ANDLITIFVALE..CFSLCSYL.LSGYTKRDLRSNEATMKYLLMGGASSSILVYGFS..WLYGLSGGEIELQEIVN....

PF10125

A3CUQ9_METMJ/1-222MFDLPTANIGGP--DLFVLEFGDIVAYFSPYTAALFVFALIFTVLVIVSRPERQVDIAFGGDAYYTKVVDPDLLRF----
A6UTX9_META3/1-218ML..ES..IAGS--LYGYIPFGDIVFYMTDFSMIAFVVALFFTIIVALTKPEKQIEAQIGELGDKFNTVSLKEMKA----
Q2FMA7_METHJ/1-218MFNLP...IEGE--ELFVLEFGDIVNYFSLYTTTLFLFATAFIIIAIIARPERQTDIVFGTDAIYTKEINPDNLRF----
A6UQA0_METVS/1-219ML.FES..IAGN--FYGIIPLGDIIFYLTDFSLIGFVVAMFFTCVVYLTKPEKQLEAQMYEFGDKFNHVTAEELRV----
Y522_METJA/1-218MI..ES..ITGY--LFGIVPFGDIVFGFSEFSIIGFITAVIFTIIVYLTKPEKQLEAQKFKIEDKLEVVTLNELKI----
A2SQY5_METLZ/1-213MM........ES--ILVTIPFGDMIHYLSGYTGVLFGFAAIFVLLAVISLPEKPVEIVFGTDGYSLKETPVDLARF----
O26491_METTH/1-222MMDIAS..LGGE--LLGQIPFGDIVLYLTPFNLFMFAAVLIFTFLIAISRTETQVETEFGTLGNRRVEVDTAEFRI----
Q8TY36_METKA/1-222MY......PSGK--VLFIIPLGDIVPYLSTINMIILAVLLAVLALPILSNTDVYVEIDHRRPRIKAKIVSPREDKI----

PF00361

NUON_ECOLI/122-402....NLGDGMLNEPLLLAGFGLMIVGLGFKLSLVPFHLW..........TPDVYQGAPAPVST---FLATASKIAIF-GV
NU5M_TRYBB/130-400......NFFCMDYYYIEFSICLLVGCAFTKSTQFGLHIW..........LPDAMEGPIPVSAL---IHAATLVVCGI-IL
NU2M_PICCA/154-453...IYSLDIYNINNNILIGWLFIIIGLLIKIGAAPMYNWSILLYSNSNTIITSYISLIPKISI---LSYILLIILNL-YN
NQO14_PARDE/123-398.....TIEAGHLSLGVLFGLVFMLVGLSFKVSAVPFHMW..........TPDVYEGSPTPVTA---FFATAPKVAAM-AL
NQO12_PARDE/135-420LAQTEIDFLWRDWNAANLLGFLLFVGAMGKSAQLLLHTW..........LPDAMEGPTPVSAL---IHAATMVTAGV-FL
NUOL_ECOLI/133-406...LAPAHFADGNNMLMWATLMLLGGAVGKSAQLPLQTW..........LADAMAGPTPVSAL---IHAATMVTAGV-YL
NU5M_CHLRE/132-391............YSASGFVGLSILIGAMGKSAQILFHVW..........LADAMEGPTPVSAL---IHAATLVTAGV-YL
NU2M_BALMU/23-270................PTASTLMTVALAIKLGLAPFHFW..........VPEVTQGIPLTTGL---ILLTWQKLAPL-SI
NDHF_BACSU/122-391....NESLAGLGEWERTGIQLLIVLAVIIPAAQWPFQRW..........LVESIVAPTPVSAI---MHAG.LVNAGG-II
NU4M_ANOGA/106-374..........YSFSNFNLLYLSLVFAFLVKMPMFLVHLW..........LPKAHVEAPVSGSM---ILAGILLKLGG-YG
NU4M_ASCSU/87-346................WEMVFVLSLSFMMKFPVYFLHLW..........LPKAHVEAPTTASM---LLAGLLLKLGT-AG
NU4M_ASPAM/130-401........SNFNYVTQLFLFYGIFIAFAVKTPVSFLNTW..........LLKAHVESPLSGSI---ILAGIVLKLSL-YG
NU5M_ALBCO/96-355...............VWLSSILFTIASFTKSAQYPFSAW..........LPAAMAAPTPVSAL---VHSSTLVTAGI-YL
NU2M_CHOCR/131-415FFTGMPMLELSSWIGLTTGFTLILVSLLFKLSAAPFHMW..........APDVYEGSPTSITL---FFSIMPKLAIL-SL
NU5M_BALMU/134-399..........LNQNPLNFPLMGLVLAAAGKSAQFGLHPW..........LPSAMEGPTPVSAL---LHSSTMVVAGI-FL
NU5C_MAIZE/141-424IANNWIPNNGINSLLTTLCAFLLFLGAVAKSAQFPLHVW..........LPDAMEGPTPISAL---IHAATMVAAGI-FL
NU4C_MAIZE/131-404........QSYPTTWEILLYFGFLIAYAVKLPIIPLHTW..........LPYTHGEAHYSTCM---LLAGILLKMGA-YG
NU5M_ASCSU/96-353..............FCWLSSLMLLLASFTKSAQFPFSGW..........LPKAMSAPTPISSL---VHSSTLVTAGL-VL
NQO13_PARDE/130-412SENFRLLGMTVVGGMQMLLFLAFFASFAVKMPMWPVHTW..........LPDAHVQAPTAGSV---LLAAVLLKMGG-YG
NU2M_PARLI/23-270................SFPSLCLSVALAFNLGLAACHFW..........LPDVLQGLPFIQGL---IIATWQKIAPL-FL
NU4M_APILI/111-379..........LNLNLNMMLFIYLLMSFLVKIPIYLFHGW..........LLKAHVEAPYYGSM---ILASIMLKLGG-YG
NU4M_ARBLI/111-383.....VWLTTNSSTSLTVWWLLSILAFLVKMPIYGFHLW..........LPKAHVEAPVAGSM---ILAAILLKLGG-YG
NU4M_CHICK/112-385.....THPNLPASWTSLLSSLALLMAFMVKAPLYGLHLW..........LPKAHVEAPIAGSM---LLAALLLKLGG-YG
NU5M_ANOGA/108-372........MMKNNIEMMIIGGLVMLAAMTKSAQIPFSSW..........LPAAMAAPTPVSAL---VHSSTLVTAGV-YL
NU2M_MARPO/130-407FTGYEITLFGAQSSGIFMGILFIAVGFLFKITAVPFHMW..........APDVYEGSPTIVTA---FFSIAPKISIL-AN
NU2M_APILI/25-259..................FNFMVQMMFFLKIGTFPFHFW..........MIYSYEMMNWKQIF---LMSTLIKFIPI-YM
NU2M_ANOGA/23-266...................EILILSTLLLKSGAAPFHFW..........FPEVMEGLSWVNGL---ILMTWQKIAPL-ML
NU4M_ALBCO/97-367.........YYSFNNNPLMLVGLMMAFLVKLPIYTCHLW..........LPKAHVEAPLGGSM---VLAGVLLKLGG-YG
NU2M_PISOC/23-270................SFSSIVLTLALCLKLGLFPCHFW..........FPDVLQGLSFLQGL---LLSTWQKVAPF-II
NU2M_ALBCO/22-245....................FIFITMLMLKIGMFPLHFW..........IIPVYSKLSYLNIG---IVGLLLKIVPM-WI
NU4M_PARTE/134-402........FVFSKTQAMTIYSLLFVGFGIKFPIWPLHYW..........LTKTHVEASTGFSI---YLSGFLVKTAL-FG
NU5M_CANPA/86-356......AAPYTNTLILNILSLLLLLAATAKSAQLGLHAW..........LLQAMEGPTPVSAL---LHAATMVCAGV-YV
NU2C2_MAIZE/146-424...GLINTQMYNSPGISIALIFITVGLGFKLSLAPFHQW..........TPDVYEGSPTPVVA---FLSVTSKVAAL-AL

PF10125

A3CUQ9_METMJ/1-222------------QRFMAIACGLATLGAVVTGDVFNFTLF------------ASMVGITNIGIV.AAYRNRHVLNAAFQYG
A6UTX9_META3/1-218------------RRLMAVICGITTAFAMLTGDVFNFALF------------LAVIGMANIGIV.SAVKKEWVLTAAFNYG
Q2FMA7_METHJ/1-218------------QRFMAIACGLATLGAVSSGDLFNFSLF------------TALIGITNIGIV.AGVNNRYVLNAAYNYG
A6UQA0_METVS/1-219------------RKFMSIVCGVATAFSMLTGDLFNFALF------------LAVIGISNIGIV.SAVKKEWVLNAAFHYG
Y522_METJA/1-218------------RRMMAIVCGIATAGAMLTYDLFDYALF------------LTLVGIANIGIV.SAVKREWVLNASYQYG
A2SQY5_METLZ/1-213------------QRFMAIACGIATIGAIVTGDIFNFTLF------------AAFIGVLNIGIV.AAVKNKHVLSAAFSYG
O26491_METTH/1-222------------RRFLAIVCGLATAGAMVTGDLFNFTLF------------VALIGIVNIGIV.SAVRQVEVLDAAFQYG
Q8TY36_METKA/1-222------------KAALALVSTLAATGVVTTGDVFNFTLF------------LSLLGISNMGLIGTTVEDEFALECAFNYG

PF00361

NUON_ECOLI/122-402VMRLFLYAPVGDSEAIRVVLAIIAFASIIFGNLMALSQTNIKRLLGYSSISHLGYLLVALIALQ.TGEMSMEAVGVYLAG
NU5M_TRYBB/130-400LSFVYWCFD..FWFSYFYNLIGWSTLILILMTLCVFYNFDVKRYVAFSTICQISFSMFCCLCI...DIY...IGSLFFCY
NU2M_PICCA/154-453LNNLNNLFNNNNNNNLIYILSIIIILSLIIGSIGGLTQIKIKNILAYSGLLNIGYFLLIILSLINNNNINSILAYIIYIT
NQO14_PARDE/123-398IARLVFDAFGHVIGDWSQIVAALAVMSMFLGSIAGIGQTNIKRLMAYSSIAHMGFALVGLAAG...TAIGVQNMLLYMTI
NQO12_PARDE/135-420VCRMSPLYE..FAPDAKNFIVIIGATTAFFAATVGLVQNDIKRVIAYSTCSQLGY.MFVAAGV...GVY..SAAMFHLLT
NUOL_ECOLI/133-406IARTHGLFL..MTPEVLHLVGIVGAVTLLLAGFAALVQTDIKRVLAYSTMSQIGY.MFLALGV...QAW..DAAIFHLMT
NU5M_CHLRE/132-391LVRLHIHDE........MFVIIVGSLTAFMAGVFGATQSDLKRVIAYSTCSQLGY.MMVSLGL...GETGGEASMGHLMT
NU2M_BALMU/23-270LYQISPSIN.......LYLMLTMSLLSILVGGWGGLNQTQLRKIMAYSSIAHMGW.MTTILPY...NPT...LTLLNLLI
NDHF_BACSU/122-391LTRFSPLFH...GGIASIILLLLASISVLIGTGISLVQVDYKRQLVGSTIGQMGF.MLIQCAL...GAY..IAAIIHLIL
NU4M_ANOGA/106-374LLRMFSLLQ.ISGVKYNYWWISISLVGGVLISLVCLRQTDLKALIAYSSVAHMGIVLSGLLTM...TYWGLTGSYALMIA
NU4M_ASCSU/87-346FLRILGCLS....FVHNNVWIVLAFLGMILASFCCMFQSDAKALAAYSSITHMSFVLMALVFI...IMSGKTGGVILMLA
NU4M_ASPAM/130-401IFRLILPLLPKASLNYTYIIYVIGVITIIYASFSTLRTIDIKELIAYSSVSHAAVYSIGAFSN...TIQGIEGSIALGLA
NU5M_ALBCO/96-355MIRCFMVDG..APAEMYSLMGLVGSITCLLGGSVALFEYDLKKVIALSTLSQLGV.MMYSLSL...NLP..YLALLHLYG
NU2M_CHOCR/131-415LLKLLILSFHDFITFWRIIILICIIFSIMIGTLSAFSQIKWKRFIAYSSISHVGFFLLAILSG...NLEGISSSIFYVII
NU5M_BALMU/134-399LVRFYPLME..NNKLIQTVTLCLGAITTLFTAICALTQNDIKKIIAFSTSSQLGL.MMVTIGL...NQP..YLAFLHICT
NU5C_MAIZE/141-424LARLLPLFI..SLPWIMSFISLIGTITLFLGATLALAQRDIKRSLAYSTMSQLGY.MMLALGI...GSY..QAALFHLIT
NU4C_MAIZE/131-404LIRVNMELLPHAHYLFSPWLVIIGAVQIIYAASTSLGQRNFKKRIAYSSVSHMGFIIIGIGSI...TNIGLNGAILQILS
NU5M_ASCSU/96-353IMNFSEMIL...NKDVIMIIMVVGVFTMFFSSMAALVEEDLKKVVALSTLSQMGF.SMLTVGI...GLS..FVSFIHLLS
NQO13_PARDE/130-412FLRFSLPMFPVASGVAQPYVFWLSAIAIVYTSLVALAQSDMKKVIAYSSVAHMGYVTMGVFAA...NQIGVDGAIFQMLS
NU2M_PARLI/23-270LFYFNQLNF.......SYFIILAALISILVGGWGGLNQTQTRKILAFSSIGNMGW....IVVT...SAFSLGTAAMMLFI
NU4M_APILI/111-379MLRLMIIYK.NEFILIQKILVMINSFGVLILSLMCLSQFDMKSIIAISSIVHMGLMIMSMMTF...LKISLIGGYLMMIS
NU4M_ARBLI/111-383LMRLISLFSTTSLNFSSLPLVVFCCWGALVTSIICIRQTDLKALIAYSSVGHMSIVAAGVFSQ...TIWGINGALMLMIA
NU4M_CHICK/112-385IMRVTLLME.PVSNFLHYPFLTLALWGALMTSSICLRQTDLKSLIAYSSVSHMGLVIAASMIQ...TQWSFSGAMILMIS
NU5M_ANOGA/108-372LIRFNDVLM...NWWMAQFLLLVSGLTMFMAGLGANFEFDLKKIIALSTLSQLGL.MMSILSM...GFY..KLAFFHLLT
NU2M_MARPO/130-407MLRVFIYSF..YDPTWQQLFFFCSIASMILGALAAMAQNKVKRLLAYSSIGHVGYLLIGFSCG...TIEGIQSLLIGIFI
NU2M_APILI/25-259MVSMTKINS.........WTLYFLITNSLYISFYANKFYTLKKLLACSTIFN.SFYFIFILEL....NKNMFIAMIILYS
NU2M_ANOGA/23-266I..........SYNFIYNFFMISIILSMLIGSLGGLNQTSIRKLMAFSSINHLGWMLLAMMNN...EML..WMTYFLMYS
NU4M_ALBCO/97-367LYMLINFIISKSSSLVISVIITLSLWGAVIASIICIQQVDIKALVAYSSVAHMSLVSAGILMM...SNWSYTCAKMTMIA
NU2M_PISOC/23-270LVSVCNIIS.......INVLTTLGCLSVLVGGWGGLNQSQVRKIMAFSSISHLGW....ICSV...LSYSIYVGCIMFVV
NU2M_ALBCO/22-245LMHMGCITS.....EMLNLITMLSVTSMLFGALIGMNLSKMRMVLGASTITHNGWLGMSCISG.........SLFKYFIT
NU4M_PARTE/134-402FYRLTNLIQ...VELDTTFFLAVLVAGVIDSSLNMWSQTDLKKLVAYCTIQEMNLIAIFFLKG...DSSLIAYGFLFTIM
NU5M_CANPA/86-356LVRSYFILE..YAPSLLIGICWLGGVTTLVSGLIAIVTNDIKKVIALSTMSQLSI.MVLAIGI...SSY..DLAIYHLYC
NU2C2_MAIZE/146-424ATRILDIPFYFSSNEWHLLLEILAILSMILGNLLAITQTSMKRMLAYSSIGQIGYVIIGIIVG...DSNDGYASMITYML

PF10125

A3CUQ9_METMJ/1-222IVAMLATVP------------LFGGAAIVLAGTGTLSMWELFGG...AM-----------------A.VPLIAKAFLVLG
A6UTX9_META3/1-218IIAMISTLP------------LFGAASIILAKTGTLSIFELSRH...PY-----------------D..IFYQKILYAVG
Q2FMA7_METHJ/1-218IVAMVATTF------------LFGGAATALGTCGTLSIWELAGL...GM-----------------..VPLAAKMFLVLG
A6UQA0_METVS/1-219IIAMISSLP------------LFGAAALILGKTGTLSIFELSKM...SH-----------------D..LLYLKILYAIG
Y522_METJA/1-218LIAMIATLP------------LFGSAGMILAKTGTLSIFELPKI...QT-----------------S..LLFEKIIFAAG
A2SQY5_METLZ/1-213LVVMMGTVP------------LFAGAAIIAATTGTLSIWELAAT...GG-----------------..VPVIAKLLLLIG
O26491_METTH/1-222LIAMMASLP------------LFGGAALVLGSSGTLSLLELSGM...AG-----------------NPMIVFAALLLLMG
Q8TY36_METKA/1-222LMCLIASLP------------LFGGAALILASTGTLSVHELMKMPKGAG-----------------GWTLTYGKALLTAG

PF00361

NUON_ECOLI/122-402Y.LFSSLGAFGVV.SLMSSPYRGP......DADSLFSYR.GLFWHRPILAAVMTVMMLSLA..GIPMT....LGFIGKFY
NU5M_TRYBB/130-400H.MFYKATLFIVL.GIWIHIFFG........LQDLRCYFFMYFCGCVLARLLLIFAILNSC..SIWFL....CGFYCKDM
NU2M_PICCA/154-453QYCFNHISIFILLIIAIIYNNNYNNF..ITNKNLIYIYELNYIKNNRYLIFCLIIIIGSFI..GIPPL....FGFYGKYY
NQO14_PARDE/123-398Y.AVMNIGTFAFILSMERDGVP.........VTDLAALN.RFAWTDPVKALAMLVLMFSLA..GVPPT....LGFFAKFG
NQO12_PARDE/135-420H.AFFKAMLFLGA.GSVIHAMHH........EQDMRNYG.GLRKKIPLTFWAMMIGTFAITGVGIPLTHLGFAGFLSKDA
NUOL_ECOLI/133-406H.AFFKALLFLAS.GSVILACHH........EQNIFKMG.GLRKSIPLVYLCFLVGGAALS..ALPLV...TAGFFSKDE
NU5M_CHLRE/132-391H.ASFKAALFLAA.GMVISGNGG........NQHIARYG.GSAHSAMFTMLTLMVASLSLI..GWPEL....SGFYSKET
NU2M_BALMU/23-270Y.ITMTFTMFMLF....IQNS..........TTTTLSLS.QTWNKTPIITTLTMLTLLSMG..GLPPL....SGFMPKWM
NDHF_BACSU/122-391H.GLFKATLFLQA.GSAVGRHE.........VSTRTNERTSYLWVMAGRILSLVIGVAFWL..TAPGD....GYHLISAL
NU4M_ANOGA/106-374H.GLCSSGLFCLA.NISYERMG.........SRSLLINK.GLLNFMPTLSLWWFLLCSGNM..AAPPT....LNLLGEIS
NU4M_ASCSU/87-346H.GYTSTLMFYLV.GEFYHVSG.........SRMVYYMS.SFFGSGMIMALLFAVVFLSNM..GTPPS....LSFLSEFI
NU4M_ASPAM/130-401H.GFVSSGLFICAGGILYDRSS.........TRLITYYR.GMAQVMPIFSVLFFILSLGNS..GTPLT....LNFIGEFM
NU5M_ALBCO/96-355H.AMFKAMLFLGA.GLILMMSYG........TQDLRLLG.SLLYSSPIVISLLNISMLCLM..GFPFV....SSFYSKHL
NU2M_CHOCR/131-415Y.VITMLGIFSFILTLRFYNYSYH.....YQTRYLQDLI.SLSRFNPALAISLTLFLFSMA..GIPPL....GGFFAKLF
NU5M_BALMU/134-399H.AFFKAMLFLCS.GSIIHNLNN........EQDIRKMG.GLFKALPFTTTALIIGCLALT..GMPFL....TGFYSKDP
NU5C_MAIZE/141-424H.AYSKALLFLGS.GSVIHSMEPLVGYSPDKSQNMVLMG.GLRKYVPITRTTFLCGTLSLC..GIPPL....ACFWSKDE
NU4C_MAIZE/131-404H.GFIGATLFFLA.GTACDRMR.........LVYLEELG.GISIPMPKIFTMFSSFSMASL..ALPGM....SGFVAELV
NU5M_ASCSU/96-353H.ALFKSCLFMQV.GYLIHCSLG........QQDGRNYS.NLGNVPYFIQLQLLVTLFCLC..GLVFS....SGAVSKDY
NQO13_PARDE/130-412H.GFISGALFLCV.GVIYDRMH.........TREIDAYG.GLVNRMPAYAAVFMFFTMANV..GLPGT....SGFVGEFL
NU2M_PARLI/23-270Y.LVINTSIFLIL.DFLS.............IFTLGHLN.NTSQLSPISITLVILTILSLG..GLPPL....TGFILKFS
NU4M_APILI/111-379H.GLSSSGLFFLV.NVIYSQTN.........SRLMFINK.GMINFMPSMSLLWFMLCSSNM..GSPVS....LNLISEVM
NU4M_ARBLI/111-383H.GLVSSALFALA.NTMYERSG.........TRTLVITR.GMKLILPLSTFWWLIMCAANL..GFPY.....SNLIGEIL
NU4M_CHICK/112-385H.GLTSSLLFCLA.NTNYERTH.........SRILILTR.GLQPLLPLMSVWWLLANLTNM..ALPPT....TNLMAELT
NU5M_ANOGA/108-372H.ALFKALLFMCA.GSIIHNMKN........SQDIRMMG.SLSMSMPLTCSCFNVANLALC..GMPFL....AGFYSKDL
NU2M_MARPO/130-407Y.VLMTVNVFAIVLALRQNR...........FKYIADLG.ALAKTNPILAITLSITMFSYA..GIPPL....AGFCSKFY
NU2M_APILI/25-259F.NYFLLISFLN...................KFNIQNFN..FMFYNKYQMYTFLTLMFNYS..MYPIF....LSFVIKWN
NU2M_ANOGA/23-266LLSFSIVLMFNNF.KLFYFNQIF.................NLSMMNPIIKLLIFLNLLSLG..GLPPF....LGFLPKWL
NU4M_ALBCO/97-367H.GYTSSALFVLA.NLSYLKIK.........SRSLMFMK.GLLAIFPAMAFYWFLFSCMNM..AAPPT....LNFIGELL
NU2M_PISOC/23-270Y.IVLSSTVFLIN......NEGN........LYNLSSLA.RLVYCNNVMGNVLVLVILSLG..GLPPL....TGFLNKFI
NU2M_ALBCO/22-245Y.GFSLVILLVFL.......................YLG.........DKMSISLSLLSLS..GLPPF....MLFIGKIN
NU4M_PARTE/134-402H.ALMSTLMFFLV.ECIYSRYK.........SRSTLVVN.GVFFSFNNLALAIIFMVLFFS..GILGT....LKFVCEFF
NU5M_CANPA/86-356H.AFFKALLFMGA.GSVIHSYIS.......ETQDMRKYG.GLVNYLPFSYTAILIASLSLM..AIPGL....TGYYSKDI
NU2C2_MAIZE/146-424FYISMNLGTFACI.VLFGLRTG.........TDNIRDYA.GLYTKDPFLALSLALCLLSLG..GLPPL....AGFFGKLY

PF10125

A3CUQ9_METMJ/1-222VMGE.GMAPFYIA---------------------------KAEITRAQGAPFILMVHVSSL-----------LLFLRVTE
A6UTX9_META3/1-218MVGETGIAPFYAA---------------------------KAEMFRAPGAPYILMIHLSSL-----------LVIVRTAE
Q2FMA7_METHJ/1-218VMGE.GMAPFYIA---------------------------KAEITRAPGAPYVLMIHVSSL-----------LIFLRVIE
A6UQA0_METVS/1-219MIGETGVAPFYAA---------------------------KAEMFRAPGAPYILMIHLSSL-----------LVIVRTVE
Y522_METJA/1-218MAGETGIAPFYAA---------------------------KAEMFRAPGSPYILMIHLSSL-----------LLIVRTVE
A2SQY5_METLZ/1-213VLGE.GMAPFYIG---------------------------KAEITRASGAPYILMIHVSSL-----------LLFLRVVE
O26491_METTH/1-222VVGETGVAPFYAT---------------------------KAEMFRTPGSPFILIIHLSSL-----------LVIVRAIE
Q8TY36_METKA/1-222VIGEAGVGPFYAV---------------------------KVDSFRRIWGRYAFVIHLTTL-----------LTFSRYLE

PF00361

NUON_ECOLI/122-402VLAVG
NU5M_TRYBB/130-400LLALL
NU2M_PICCA/154-453LLISS
NQO14_PARDE/123-398VLTAA
NQO12_PARDE/135-420IIESA
NUOL_ECOLI/133-406ILAGA
NU5M_CHLRE/132-391ILNLA
NU2M_BALMU/23-270IIQEL
NDHF_BACSU/122-391ILGWS
NU4M_ANOGA/106-374LLNSI
NU4M_ASCSU/87-346VISSS
NU4M_ASPAM/130-401SLYGV
NU5M_ALBCO/96-355ILEKM
NU2M_CHOCR/131-415VLLSV
NU5M_BALMU/134-399IIEAA
NU5C_MAIZE/141-424ILSNS
NU4C_MAIZE/131-404VFFGL
NU5M_ASCSU/96-353ILEFF
NQO13_PARDE/130-412TLMGV
NU2M_PARLI/23-270SLYSL
NU4M_APILI/111-379LLIGM
NU4M_ARBLI/111-383YISW.
NU4M_CHICK/112-385IMVAL
NU5M_ANOGA/108-372ILEMV
NU2M_MARPO/130-407LFFAA
NU2M_APILI/25-259LIFMM
NU2M_ANOGA/23-266VIQNL
NU4M_ALBCO/97-367IIPSM
NU2M_PISOC/23-270ALECL
NU2M_ALBCO/22-245VLLMM
NU4M_PARTE/134-402VFNLT
NU5M_CANPA/86-356IIESL
NU2C2_MAIZE/146-424LFWCG

PF10125

A3CUQ9_METMJ/1-222IVISM
A6UTX9_META3/1-218ILLNI
Q2FMA7_METHJ/1-218IILTV
A6UQA0_METVS/1-219ILLTI
Y522_METJA/1-218ILLTI
A2SQY5_METLZ/1-213ILLTV
O26491_METTH/1-222VLLIV
Q8TY36_METKA/1-222LLAAL

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window