Sequence alignment for CL0438

PF08972

Q20YW9_RHOPB/22-74----LTIQVDY--DEEAGV----WVAECSEIS----.LV----TEADTFEILFRKLPDMIQDVLTDNADPRA--------
A3EPI3_9BACT/12-65----IEILAVR--DDEAGV----WVASSDGVP----GLI----TEAETTEVLLDKWRVLVPDLLELSGSPHG--------
Q73QJ0_TREDE/3-56----YIIKINW--DNEAGV----WIATSDDIR----GLV----LESGSIDALMERVRYAVPDLLQENNQIPH--------
A3IQF3_9CHRO/7-60----YNIQAFW--DSEAEV----WVATSQDVL----GLA----TEADTLENLNDKLRVMIPELLILNGMLEE--------
Q5SJJ5_THET8/4-57----LKVQALW--DGEAGV----WVAESDDVP----GLA----TEAATLEELLAKLAVMVPELLEENGVALE--------
A0ZK26_NODSP/7-60----IKVQAFW--DAEASV----WVADASNLP----GLV----TEAETIEQLTKKLEMMIPELMELNQASSF--------
Q21AP4_RHOPB/8-60----FTVSAVW--DADAGV----WSGHCDDIP----.AA----ADAPTLDELLAKVSAMTLDLLPDNHPGVD--------
Q6N1R0_RHOPA/4-56----LVIQVTY--DEEAGV----WVAQSDDIP----.LV----TEADTYEVLYRKMPDLIQDVLVENADPRA--------

PF03681

A5MUY3_STRPN/4-55---TYPALFYY...DDTDGTEATYFVHFPDFE....YSA....TQGEGISEALAMGSEWLGITVAD--------------
Q7N448_PHOLL/2-50---LYPIAIEI..GDENHA....YGVVVPDIS....GCF....SAGDSMEDAIKNSKEAITGHLEL--------------
Q637A2_BACCZ/9-55---IYPSIFDF....SNEQ....VTVTFPDFA....DCH....ANGNNYEDAFEMAKKTLATHLYE--------------
Q30VE9_DESDG/4-50---HYAALLPA....MEGG....YLVRFAECP....RAF....TYGEDLADALENAADVLALEAQV--------------
Q1Q7C7_9BACT/3-51---KYAIEIFY..SEEDEG....YIAVVPELS....ECS....AFGETEEEALEEVKTARYLWLET--------------
A7FJ46_YERP3/3-50---IYPAYVHV...DNDGS....ASGYFPDVK....GCI....FAINAGEDLFAEASSALDAHFEA--------------
Q3ASZ3_CHLCH/8-56---GYEIIIYW..STEDNA....FVVEVPELP....GCM....ADGKTYEEALNNVQVIIEEWVET--------------
Q8TKI0_METAC/3-50---EFVIIIGQ...DEDGV....YVASAPEFP....GCH....TRAITLDELNTRIKEAIELYLEV--------------
Q2FTT5_METHJ/4-51---KFNILIEP...GEDGW....FVVTVPGLP....GCI....TQGKTIEEATDNAKEAIEAYLEA--------------
Q24YU3_DESHY/6-54---LFPAIVER..NTLSGR....YIVVFPDLP....DLI....CQGETPEDAFHQAELSLGMHLYH--------------
A7C4Q7_9GAMM/9-55---IYGATIVP....DGEN....FLVTFRDLA....NVF....SEGETREEAIFNAVEALDGVLLE--------------
Q73QG2_TREDE/10-60---PYSIITKKIHDESGVY....YYAQVKELD....GCQ....SSGETLEEVYTNIYEAMEGWIEA--------------
Q74LL8_LACJO/7-54---TYPAIFKP...IEDNV....YFISFPDVK....GAI....TEGHGLKDAFEMAADAWGTILFD--------------
Q93R92_THETH/4-50---RYRVVVER...DEEGY....FVAHVPEL.....HAH....TQAQSFEELLRRLQEAIAVSLEE--------------
Q1C3Z4_YERPA/25-71---IYPIFIFK...TVEG.....FDGYFPDID....GCF....FAGNTFADISKNAEEAFAVHIEA--------------
A7B8J3_RUMGN/10-57---FYPALFHK...SEEGG....FWISFPDFP....ECF....TEGDDMKQAYEMAVEALGLALVN--------------
A5D043_PELTS/3-50---LFIVYLEP...AEEGG....YIASVPALS....ALH....TQGETKKEALAMTEDAIRRDIES--------------
Q2FTZ7_METHJ/4-49---QLTAIIER....EGDG....YVSLCPEL.....DIA....SQGDSVEDARNNLREAIELFFET--------------
A5N9B4_CLOK5/6-51---TFPAVFER....EENQ....YCVNFPDL.....GCA....TFGDNLDEAMYMAKDLLEGYLWG--------------
Q3A6G1_PELCD/11-57---PYATTIIP....DDGS....YFVKVNEFE....GCI....SVGETKAEALEMIEDAMREWLAT--------------
Q1GWH8_SPHAL/4-52---RYHINVFW..YPDDNC....WIADVPDLR....PCS....AHGETPIEAVAEAEIAIESWLEV--------------
Q2RTK7_RHORT/4-51---TYAVVIET...DDLGG....FSAFFPDLP....GCV....GAGDSVEACFQDALDALALHLAG--------------
HICB2_PHOLL/6-52---RYPVKFEH....DETG....WAVMFPDIP....EAL....TGGDTREEALAMAQDALVTAFDF--------------
Q3J7K2_NITOC/6-56---EYPFEFRPLADEEGGG....WLVSYPDLP....GCM....SDGETPEEAMANGKDALAAWLKA--------------
Q7N4R9_PHOLL/2-49---RYPIYLHQ...ADDGS....FSGFVPDVI....GCY....FAGDTIDDAISGAQNALDTYFEY--------------
Q1CQF5_STRPD/16-62---IYPATFTQ....DTDY....IMVTFPDVP....EAI....TQGEDFQEAYEMAVEVLGFALED--------------
Q1NSU6_9DELT/14-57---EYKRL.......DDGT....WFAEIPGFQ....GVW....ASGDSVESCRQELLEVLEEWLLL--------------
Q6J2J7_PSEYM/3-49---QYPLELHQ....EPTG....IWLSCPDIP....EMN....ASGDTLDEALAEALNGMESAFSL--------------
A5UQ87_ROSS1/4-51---QFKIIIEK...HSDG.....YVAYPLGLK....GVG...AGEGDTYEEALTDVKSAIAFHIET--------------
Q8TSN1_METAC/29-76---NYTVLIEQ...DEDGV....YVAKVPDIP....GCY....TQGKTVEQAMERIREAIQVCLGA--------------
A0YQX4_LYNSP/2-49---QIKAVIHT...AEEGG....YWAEVPALP....GCI....TEGDTMEEVLTNLQDGIEGWLEV--------------
Q2RM36_MOOTA/14-61---MKEAVIEQ...LEDGT....FFAEIPPYP....GVW....ADGKDEKECLATLQEVLEEWLLF--------------
Q73LA6_TREDE/4-50---TYPVIFEN....DDGK....IGVRVPDIS....GCF....TFGDTVTEAIEMAEDAIAMMLAH--------------
Q6AR86_DESPS/4-52---KFTKKIHW..SEEDGC....FVVTFPEFP....LLS....AFGETQKEALKDARIVLEMAINS--------------
Q5SH18_THET8/3-52---KYTALLYP.DPETPGV....WIAEFPAVP....QAH....SFGQSPEEALARAKEALELVLAY--------------
Q5SLR2_THET8/1-49---MREIIFLVEEAEEGGF....VARALGE......AIF....TEGETWEELKEMVRDAVRCHFGE--------------
Q5HXI2_GLUOX/2-50---RYPVVIER..GSETTA....FGVVFPDLP....GCF....SAGDTLDEALSCAEEAAAAWIDA--------------
Q3JTI1_BURP1/32-79---EFPIAVHK...DAGSV....FGVTVPDIP....GVH....SWGETMGEAIENTKVAIASHVET--------------
Y07A_ARCFU/13-56---IFLV.....EETDDGY....TARALGH......SIF....TQAGSLEELKEMVKDAVECHFEE--------------
A4J7L0_DESRM/24-72---GIRVQVHE..DTEDGG....FYAVTPDVP....GCA....SRGSTKEEAVENFKEAIRFFLIE--------------
A3IHV6_9CHRO/4-54---PYTIVILW..SDEDQC....YLVHLPEFPTQ..KFH....THGDTYEEALKNAQEVLELLIEE--------------
Q30SE1_SULDN/19-65---QYIAFMHK....EDDD....YVAVVPDLG....FTS....SYGETFAKAVEMIKEAAELYCED--------------
Q1PWB8_9BACT/2-48---KYPVVVHK....SEYG....YDVHCPIYH....GCH....SQGDTLEDALENIKDAIHTYLTM--------------
Q9ZXB8_BPPH1/7-53---IYPALFDY....DDDG....ITVTFPDLP....GCI....TFGNSGGEALTMAKEAMALHLYG--------------
Q0AWE6_SYNWW/5-51---TYFAVFEP....VATG....YSVYFPDIP....GCV....SYGEDFEEAQKQAADALGLHLYG--------------
Q04P72_LEPBJ/14-59---SFTASVWQ....EEKM....YVAQCLEV.....DVA....SQGETEQEALSNLQEALELHFEN--------------
Q7UUJ5_RHOBA/5-51---NYNAVIRQ....DGEW....WIGWIEEVP....GVN....SQGATRDELIDNLREALSEAIEL--------------
A0ZAF9_NODSP/5-55---KYQMIIQW..SEEDNC....FLVGFPDFP....GQEWR..THGETYQLAVANGIEALESLIIA--------------
Q0AQW5_MARMM/10-57---AYPVRLHK...DEDGR....SWVECRDLP....ELA....TDGADEGEALAEASDALDLVIRD--------------
Q886E4_PSESM/2-50---KYPICIEW..GDETTA....FGIQIPDIP....GAI....TAGDTFEEAHAAAVEIAHIMLQE--------------
Q72FI9_DESVH/2-49---RYPLLVSK...DAGSS....YGGILPDFP....GCY....PMGETLDELLDNVQDAVETWMLG--------------
A0YNA8_LYNSP/3-51---TFTAIVEK..DPDTQL....YVGYVPGFP....GAH....SQGKTLDELQDNLTEVIKMLLEE--------------
A5VL27_LACRD/5-51---SYPAIFTP....KDNE....IQVDFPDLP....EAF....TQGKTMDEAMDFAKLGLAITLND--------------
A4BRL6_9GAMM/2-49---IYPATLSA...DTNNT....VLVIFPDFP....EAA....TFGEDGVDALTRAVDALEEVMAC--------------
Q6DW50_HELPX/15-61---LINAVIEK....DENG....YFAFVPFLK....GCV....SQGKSYEEALRNIKEAIELYLGD--------------
A7BW29_9GAMM/2-49---KYTVFLTQ...ENQGN....FHVMVPNLP....NCH....AYAPTRQEALKTIHETITQVINR--------------
Q5F6D2_NEIG1/2-49---FIPAALHK...DEHSA....YGVTIPDLP....GCF....SCGDTVEEAVANARSAAYMHIDG--------------
A4XG14_CALS8/2-52---DYKVEIIKLSEEDGGG....YLAIVPKLP....GCM....SDGSTPHEALENVQDAIKCWIET--------------
Q6G4J1_BARHE/3-50---RFFALVHK...DEDSA....FGVQFPDFE....GLF....SAADEEENLIINATEALQLYCED--------------
A7BLL2_9GAMM/6-50---RFEYWI......EDNW....YVGHLKDVP....GVF....SQGETLQELEENIKDAYYMMRAS--------------
Q4C8E0_CROWT/3-49---QYAVIYEK....GETN....WGAIVPDLP....GCV....SIGDSLEEVQENVKEAIALYLEV--------------
A3CUX6_METMJ/2-49---RLRVVLEP...SEEGG....YTVYVPSLP....GCI....SEGDTRDEALENIREAIELYLET--------------
Q4BWE3_CROWT/1-48---MSKVQLYK...DEDNY....WIVECPSLK....GCV....SQGNTKEEALANIKEAITGYIAA--------------
Q47BN9_DECAR/10-53---KYE..VYP....EGDL....FIARCLDI.....DVA....SDGATDAEALANLREAIELYFER--------------
A3IQC1_9CHRO/4-56---HYSMVIQW..SETDQL....FLVTIPEFS....EQVIMPCTHGKTREEAIRGGEEVIEMYLEA--------------
A7BMI1_9GAMM/7-54---KLPLILEP...QPEGG....YTITCPVLP....NFV....TEADTPDEVIPNVTDALAALIEA--------------
Q8DTE7_STRMU/4-49---SYPVIFHK....EEEG....YWVEFPEF.....GGG....TQGEDLEEAMKNARQMLESVLAS--------------
A5CZ20_PELTS/4-52---RFKVVLTW..DKEDKV....YVATVPAIP....GCS....TFGDTKEEALAMAEDAIKVTLEG--------------
Q1Q1U0_9BACT/2-49---KLQLIIEV..WKKGSW....FLARAPEM.....DFI....SQGKTPEEARKNLLEVINIQFEE--------------
A7BYG0_9GAMM/7-57---QYPFEISPLSQEDGGG....FLITFPDFS....ECI....SDGDTIDEAIQNGLDALRETIVT--------------
Q3MBS6_ANAVT/4-50---SFTAVFEK....VGDW....YIGYAQELP....GAN....IQERTLEEARESLLEAIELILIS--------------
A3UKH8_9RHOB/8-56---PFVMIVHT..DEAESG....FSAFFPDAP....GCV....AAGETLGQLKADAASALRSHIDV--------------
Q20ZC7_RHOPB/5-53---AYAAEFEP..GDTPGV....IVVSFPDVP....EAI....TEGNGMADARLQAEEALGLALLS--------------
Q5N4B0_SYNP6/20-65---SFTAIVYK....EDDV....YIAECPEI.....GTV....DQGETIEQAIAGLKEATRLYLEE--------------
A3IMN1_9CHRO/5-48---TYELL.......EDGT....FYGEIPECE....GVW....SNANTLEACREDLQDALEGWIIL--------------
Q8DXL5_STRA5/4-52---TYLALFEV..DKENGG....YNISFPDFH....GAF....SEADSLNEAIFNAREVLEIYTIM--------------
A3IR84_9CHRO/2-48---RYAVIIEK....GRFH....YGAYVPDIP....ECS....AVGKTVEEVKKSIYASISNHLSS--------------
Q4C4V1_CROWT/6-53---DYTIVIRP...DDNNT....FVAYVPAIK....GCH....AWGETSEAARAELDNVFAMILEE--------------
A3IPE0_9CHRO/23-70---ELTAIIEA...AEEGR....YWAICREIP....GAN....GQGETIEEAKKSLKSAIQLIFED--------------
Q2FL34_METHJ/5-50---QFTTLIWE....EEGV....YVSKCVEI.....EVA....SCGDTPKEALDNLREAIDLWLKN--------------
Q30UU3_DESDG/4-51---LYYGVFIP...AIEGG....YVVTFLECP....AIG....TQGETLQEAYRNALDVLNIEAEE--------------
A5N2E2_CLOK5/7-53---IYPSIITQ....YKDN....VGITFPDLP....GCV....SNARTIDEAIKNAKEVLALHLFG--------------
A7ZGG9_CAMC1/11-64---PYKIELKKIPQNQGGG....WGAFMPELN....SIA.FFYGDGESKEEALAELEEAFKFTIET--------------
A7C0M1_9GAMM/3-50---HFPIVIHK...DSDSD....YGVTVPDLP....GCF....SAGATLDEVLAYAQESILCHLEG--------------
B3EM09_CHLPB/4-51---IINIHIEK...LPEGV....YLATSEDIQ....GLV....AQGRTISETLEIARDVAKKLIEA--------------
A7AF54_9PORP/3-48---TVEVIVEH....AGKN....LSAYIEDAP.....VI....TVGNDMKELEDNMKEAIELYLED--------------
Q8TNZ1_METAC/3-49---RFLVVIEK....ANNN....YSAYSPDLP....GCV....ATGSTREEAEKNIYEAIEMHVQG--------------
A7A518_BIFAD/4-53---VYPIILYP.MEEHEGG....YTVEVPDLP....GCV....TEGHDLADALDMARDAASGWILD--------------
A7BNP3_9GAMM/2-48---RYVVIIEE....GENS....FGAYVPDLL....GCV....AVAETKTDVLKLIQEAIEFHLEG--------------
Q0AZE9_SYNWW/13-63---EYPALVKRIPDEEGGG....WIAEIIDLP....GCI....ADGETPDEAILNLNEAKKCWIDV--------------
A6TVZ4_ALKMQ/4-49---KVTVLVQK....EDNW....YIAKCIEN.....GVA....SQDKTIEESISNLREALELYYED--------------
Q0AWN2_SYNWW/4-51---VYPAVFEQ...NSDGS....ITITYPDLP....GCI....SEGKTLGNAIYMAQNALTQWIEF--------------
A5KP98_9FIRM/14-60---AYPVVISK...EDDGF....FYVEIPDF.....DIA....TQGMDIADAMEMARDAIGLMGID--------------
Q4C5S4_CROWT/2-50---NQTIVFEVSQEEDAGF....FAECLTE......EIF....TQGDNWEELKTNVKEAVKGYYFD--------------
Q2IR97_RHOP2/6-53---SYSVILEP...QEGGG....FTVLVPALP....EVV....TEGDTEQEALANVEEAIRAILAY--------------
A4BN76_9GAMM/6-54---RYIKIVEW..SDEDES....FVGQCPGVI....GPC....CHGDDEAQVYAELCNIVDEWIEL--------------
O26421_METTH/3-52---MYKLELPISIEREGNW....FIAICEPF.....NVV....SRGKSEESAVENLKEALELFLND--------------
Q0SPM6_CLOPS/6-52---SYPSILTK....ENDG....ITVTFPNFK....GCI....SCGYTFEEAIKNGKQALGLHING--------------
Q3KGN1_PSEPF/18-66---LYPIAISP..SEGDST....WGVEVPDLP....GCF....SAGNDQDHALEMAKEAIEIHIEI--------------
Q8YUB5_NOSS1/4-51---EFNVVMER...DSDGY....FVASVSSLA....GCH....TQAKSLDELMERMKETIELCVKV--------------
A8FLY6_CAMJ8/11-61---PYEIIIKKLDEKDGGG....YFARYKDFP....YIM....GDGENEIEALKDLKEAFKGALEV--------------
Q0RB88_FRAAA/18-66---VYTIRIET..AEIDGG....YIAEVLELP....GCV....SQGDSLDETVDNIIDAMILVLEV--------------
Q3J2T1_RHOS4/3-50---LITAVVHK...EPDSS....YGLTFPDMP....GCF....AAADDWSDISAKAVEALDLWFED--------------
Q4BWE0_CROWT/17-64---TYIATIHK...DEDSD....YGVQFYDFP....GCI....SAGESIEEVKIMAKEALIGHINL--------------
Q211W4_RHOPB/3-50---HYIALIHK...DPDSC....YGVSFPDIA....GVI....TAGDTLDEAMQQATEVLSFAAED--------------
Q1AYH0_RUBXD/66-113---QLTAIYER...TDDGW....WIVEVPEIP....GAV....SQGRTLEEARFMIRDAVRLLLEA--------------
Q5JJE6_PYRKO/2-47---NLHAVIWE....EEGV....YVVKEVFT.....GVT....TQGETIEEALENLREAVELYLEE--------------
Y1258_SYNY3/5-52---EFYVLIER...DEDGI....YIGEVPQLK....ACY....SQGETIDELMQNIREVIELCLEE--------------
A5UU74_ROSS1/2-49---HVTIEVEQ...EEDGR....WIAEAPDLP....GVL....AYGQTREEAIARVKVLALRVLAD--------------
Q4BXD4_CROWT/13-61---SYGAKLTP..DEVDGG....WVVTVRDIP....EAI....TQGDDVESALREASDCLEEAIAA--------------
A0ZE25_NODSP/5-51---SITAIIHT...GDDFG....YVAECIEI.....SVV....TQGDSLDEVVKNCTDAVFLHLEG--------------
Q8DLV1_THEEB/12-59---ERAVYHFN...AEDGL....IYGEIPDLE....GLK....TNGKTVLECRERLSELLEDWIYF--------------
Q24QR2_DESHY/5-52---LFPAVFKQ...EANGI....YSINFPDIE....GCY....TQGDDVQDAYEMAEDVLCLRLYD--------------
Q2FRQ9_METHJ/4-49---AYTGIIKK....SGDF....YIGLCLEL.....NVA....SQGDNIEEATRMLQEACQEYLSF--------------
Q03RX0_LACBA/8-55---TYPAVFHD...NEVGG....YTVTFPDIE....DAT....TSGQTLGESLVNAAIVLGQTLHD--------------
Q1NJ14_9DELT/2-49---KLKIIIHK...AEEGG....YWAEVPAIP....GCV....TQGENLPELIENVYEAVEGCMSI--------------
Q2IX27_RHOP2/6-53---GYLALVYK...DRDTS....YGVAFPDVP....GCI....SAGDTFEQAIDNAAEALGGHLAL--------------
B3XQ22_LACRE/7-56---VYPAVLSD.EYNENGE....YTVTFPDVP....AAI....SQGFGLADALINGGEALGLALYD--------------
A1UTM8_BARBK/15-62---FIYAKLEA...DPDGG....FVITFPDIP....EAI....TAGASQAEALEHASETLGLALQS--------------
Q1Q743_9BACT/3-49---TFTVTIAK....GEKF....YIAQCKEHS....NCF....TQGKTIEEAIHNIKEVIELILEI--------------
A7JW75_PASHA/3-50---RYPVEITP...DDNGT....YLVTCPDIP....EMA....SVGEDLEEALLEAQDGLATALEF--------------
Q027V3_SOLUE/18-66---TYPANFLR..EKNRKG....FHVRFPDLP....EAL....TGGVDLDDTREEAVDCLAEALAG--------------
A7I6F9_METB6/3-49---SYTVIIET....GKHN....CSAYCPDLP....GVI....ATGRTQEETFENMKSAITFHLEG--------------
Q2FTZ2_METHJ/13-57---KFEGI......EEKEP....YYGEIPSLP....GFW....STGDSLKECKKVLLSVVKEWIAL--------------
Q8PY16_METMA/6-51---PFSATIRK....EENT....YISICPEA.....DIV....CRGESIEEAVTNLKKEVEQFLEE--------------
A0YIV7_LYNSP/18-65---PYPITLYP...EPEGG....YVAEIKDLS....GCL....TQGETIEEIMENIADAKRLWIET--------------
Q1NMQ5_9DELT/23-70---HYPIIIEQ...DMNGV....FIVSCPSFR....GCH....SYGDTIDEAMVNISEAITVCMEE--------------
A3CSY0_METMJ/14-58---RYEII......EDDEP....YYGEIPELS....GVF....ATGRTLEECRRNLAGVIDEWLII--------------
A7C3W1_9GAMM/4-51---QYKAIITK...EQKGE....FFVQFSALN....EAF....TEGRTLSEALLNAAEVLNLSLEG--------------
Q7Y3V7_9CAUD/3-51---NYAVKLER..DDDSGT....FIVSCRDLP....LLN....SVGDSKEEALLEAVDGIVTALSI--------------
A5ZVE7_9FIRM/4-51---IYPAVFRK...TDRGT....YKGFFPDLA....ECY....GEGETLDEAIEEANEAAYNWISL--------------
Q07PQ6_RHOP5/3-49---LYIAVIRE....QAGH....FNVSFPDVP....GLV....TAGDSFDEAVEEAIEALEDAGEE--------------
Q3JBY5_NITOC/2-50---LYPVYIHA..GDENHY....HGVTFPDFP....GCF....SGAGTWEDLPVNIQEAVEVHFEG--------------
Q1GBU5_LACDA/11-59---PYRLELVP..DPDEGG....YVASYPELP....GCI....TIGESLEAAAKNAEDAKKAWLEA--------------
Q9F560_ECOLX/2-55---FFSVGVET.PKDDHTA....YGITVPVFDCFDFGCV....SAADSQAEIPAMAREAILAIVEE--------------
A7BN15_9GAMM/3-51---IFPVELST..DEEEGG....FVVIFPDVP....EAI....TQGENRTEALLYAQEALETALTM--------------
A5UUG0_ROSS1/36-82---SFTVVIEP...DEQG.....FHAYVPALP....GCH....TFADTVDEARTNILEALELHLHS--------------
Q73KG5_TREDE/8-54---FYPAIFTY...NGKKE....IAVVFPDL.....GCA....TSGKDEADALLSARELLGCVLCG--------------
A3ILC1_9CHRO/24-70---KVKVIIWQ....EDDI....WCGSVPALP....GCH....TWGETYDHLIEMLKEAIEAWLDV--------------
A1V9P2_DESVV/2-49---LYPALLSP...EGEDA....YTVVFPDFP....DCE....ATADTLCEVYGLAEEVLAEHVRG--------------
Q2FQ26_METHJ/41-88---KLTILCEK...DEEGH....FVMECPELP....GCL....TEGETLEEAMESINEAIAGCITS--------------
A3ITF1_9CHRO/2-49---NYPMVVYP...CEEGG....FVAEIPALK....GCL....AQGETLEDTLQELMIVRELWLET--------------
A1VDI4_DESVV/2-50---KYPLIVHT..DPGMDG....FSAELPDFA....GCF....TAGATVEELASNAQEAVELWFDG--------------
Q4C5M2_CROWT/2-50---IIRAVLEW..DDEVKA....FSATCPELN....YIS....SCGDTKEEAIANLKEAIQLLLEP--------------

PF12909

A4J2N2_DESRM/50-137L.IGYKIEAHYIEEKDGTV----.TATFANFD.---.LV----VNAPTQEAARRALAEELIEYAKEYFNEFQLYYN.SPN
A5CZB0_PELTS/51-143C.ETKTFSYEWLDQPGSES----ENYSLYNVET---GVY----GVGPTRQDAVEDFIDNILDYAQVYFADLPYYLSPSGG
A5CZB2_PELTS/54-143LDRAYTFNPVWEYDEENKL----WSVTLPEIR.---.VY----TDAPTKEEAAEQLVDLVLDYCEDYFNRLDLFTA.LPD
A5D516_PELTS/50-137L.EKYRLKPEVIREEDGSV----.TLALDELE.---.LY----ANGRTVEEAAQELVHDLKFYAQDYLERSQLFIN.APN
B0K692_THEPX/50-137L.KVYTFTANIFKEENGSV----.TISLNEID.---.IV----ANGKNEEEALNRLVNDLIEYAEDFYNDFQYWYS.APN
B1INK7_CLOBK/2-106IYKGIRYDKHI..ENDKSV----.TVFLKDFD.---.II----VNKPTEEDAVAAAIIELREYVHDFLSDFKFWSE.DKE
B8FQ08_DESHD/52-139L.EDYKLNPEIIQEDDGSI----.TLALDALE.---.VY----VNNSTLDLAAADLIEDLKLYAQDYLKRSQLFLH.SPN
D2B388_STRRD/50-133LTTVTPSRAEVVPEDGGW.----.SVFIPGLP.---.VA----ADGPTFDAAIDEMVDALRDYAEDWQDRL...LD.APN
Q0AX75_SYNWW/52-141LDRGYKFNPTIEEDLDGQG----YTISIDELL.---.IH----GEGSTLISALKDLAENLMDYTEDYLNRVDFFRQ.IEN
Q0AZ30_SYNWW/47-133L.QDLKIHAEL.SKEDGII----.IGTIDGFD.---.LV----VSGESEQEVIQKLAEDLLEYAQDYMNDFKLFYN.APN
Q1PWI1_9BACT/14-102FVQGMPLLNIYIIKDNGKY----.MVKCPELD.---.IV----TEMDTAEQALDAILEIIREYSEDYRNREEIFIK.SPN
YL591_MIMIV/54-161IPQGTRVLGNWVAESSPSI----.AVQLQLTKI---FLY----GSGQNI.SADSDLVETLVDYNSDEIDCAPYLYKIHHF

PF08972

Q20YW9_RHOPB/22-74------------------------------------------
A3EPI3_9BACT/12-65------------------------------------------
Q73QJ0_TREDE/3-56------------------------------------------
A3IQF3_9CHRO/7-60------------------------------------------
Q5SJJ5_THET8/4-57------------------------------------------
A0ZK26_NODSP/7-60------------------------------------------
Q21AP4_RHOPB/8-60------------------------------------------
Q6N1R0_RHOPA/4-56------------------------------------------

PF03681

A5MUY3_STRPN/4-55------------------------------------------
Q7N448_PHOLL/2-50------------------------------------------
Q637A2_BACCZ/9-55------------------------------------------
Q30VE9_DESDG/4-50------------------------------------------
Q1Q7C7_9BACT/3-51------------------------------------------
A7FJ46_YERP3/3-50------------------------------------------
Q3ASZ3_CHLCH/8-56------------------------------------------
Q8TKI0_METAC/3-50------------------------------------------
Q2FTT5_METHJ/4-51------------------------------------------
Q24YU3_DESHY/6-54------------------------------------------
A7C4Q7_9GAMM/9-55------------------------------------------
Q73QG2_TREDE/10-60------------------------------------------
Q74LL8_LACJO/7-54------------------------------------------
Q93R92_THETH/4-50------------------------------------------
Q1C3Z4_YERPA/25-71------------------------------------------
A7B8J3_RUMGN/10-57------------------------------------------
A5D043_PELTS/3-50------------------------------------------
Q2FTZ7_METHJ/4-49------------------------------------------
A5N9B4_CLOK5/6-51------------------------------------------
Q3A6G1_PELCD/11-57------------------------------------------
Q1GWH8_SPHAL/4-52------------------------------------------
Q2RTK7_RHORT/4-51------------------------------------------
HICB2_PHOLL/6-52------------------------------------------
Q3J7K2_NITOC/6-56------------------------------------------
Q7N4R9_PHOLL/2-49------------------------------------------
Q1CQF5_STRPD/16-62------------------------------------------
Q1NSU6_9DELT/14-57------------------------------------------
Q6J2J7_PSEYM/3-49------------------------------------------
A5UQ87_ROSS1/4-51------------------------------------------
Q8TSN1_METAC/29-76------------------------------------------
A0YQX4_LYNSP/2-49------------------------------------------
Q2RM36_MOOTA/14-61------------------------------------------
Q73LA6_TREDE/4-50------------------------------------------
Q6AR86_DESPS/4-52------------------------------------------
Q5SH18_THET8/3-52------------------------------------------
Q5SLR2_THET8/1-49------------------------------------------
Q5HXI2_GLUOX/2-50------------------------------------------
Q3JTI1_BURP1/32-79------------------------------------------
Y07A_ARCFU/13-56------------------------------------------
A4J7L0_DESRM/24-72------------------------------------------
A3IHV6_9CHRO/4-54------------------------------------------
Q30SE1_SULDN/19-65------------------------------------------
Q1PWB8_9BACT/2-48------------------------------------------
Q9ZXB8_BPPH1/7-53------------------------------------------
Q0AWE6_SYNWW/5-51------------------------------------------
Q04P72_LEPBJ/14-59------------------------------------------
Q7UUJ5_RHOBA/5-51------------------------------------------
A0ZAF9_NODSP/5-55------------------------------------------
Q0AQW5_MARMM/10-57------------------------------------------
Q886E4_PSESM/2-50------------------------------------------
Q72FI9_DESVH/2-49------------------------------------------
A0YNA8_LYNSP/3-51------------------------------------------
A5VL27_LACRD/5-51------------------------------------------
A4BRL6_9GAMM/2-49------------------------------------------
Q6DW50_HELPX/15-61------------------------------------------
A7BW29_9GAMM/2-49------------------------------------------
Q5F6D2_NEIG1/2-49------------------------------------------
A4XG14_CALS8/2-52------------------------------------------
Q6G4J1_BARHE/3-50------------------------------------------
A7BLL2_9GAMM/6-50------------------------------------------
Q4C8E0_CROWT/3-49------------------------------------------
A3CUX6_METMJ/2-49------------------------------------------
Q4BWE3_CROWT/1-48------------------------------------------
Q47BN9_DECAR/10-53------------------------------------------
A3IQC1_9CHRO/4-56------------------------------------------
A7BMI1_9GAMM/7-54------------------------------------------
Q8DTE7_STRMU/4-49------------------------------------------
A5CZ20_PELTS/4-52------------------------------------------
Q1Q1U0_9BACT/2-49------------------------------------------
A7BYG0_9GAMM/7-57------------------------------------------
Q3MBS6_ANAVT/4-50------------------------------------------
A3UKH8_9RHOB/8-56------------------------------------------
Q20ZC7_RHOPB/5-53------------------------------------------
Q5N4B0_SYNP6/20-65------------------------------------------
A3IMN1_9CHRO/5-48------------------------------------------
Q8DXL5_STRA5/4-52------------------------------------------
A3IR84_9CHRO/2-48------------------------------------------
Q4C4V1_CROWT/6-53------------------------------------------
A3IPE0_9CHRO/23-70------------------------------------------
Q2FL34_METHJ/5-50------------------------------------------
Q30UU3_DESDG/4-51------------------------------------------
A5N2E2_CLOK5/7-53------------------------------------------
A7ZGG9_CAMC1/11-64------------------------------------------
A7C0M1_9GAMM/3-50------------------------------------------
B3EM09_CHLPB/4-51------------------------------------------
A7AF54_9PORP/3-48------------------------------------------
Q8TNZ1_METAC/3-49------------------------------------------
A7A518_BIFAD/4-53------------------------------------------
A7BNP3_9GAMM/2-48------------------------------------------
Q0AZE9_SYNWW/13-63------------------------------------------
A6TVZ4_ALKMQ/4-49------------------------------------------
Q0AWN2_SYNWW/4-51------------------------------------------
A5KP98_9FIRM/14-60------------------------------------------
Q4C5S4_CROWT/2-50------------------------------------------
Q2IR97_RHOP2/6-53------------------------------------------
A4BN76_9GAMM/6-54------------------------------------------
O26421_METTH/3-52------------------------------------------
Q0SPM6_CLOPS/6-52------------------------------------------
Q3KGN1_PSEPF/18-66------------------------------------------
Q8YUB5_NOSS1/4-51------------------------------------------
A8FLY6_CAMJ8/11-61------------------------------------------
Q0RB88_FRAAA/18-66------------------------------------------
Q3J2T1_RHOS4/3-50------------------------------------------
Q4BWE0_CROWT/17-64------------------------------------------
Q211W4_RHOPB/3-50------------------------------------------
Q1AYH0_RUBXD/66-113------------------------------------------
Q5JJE6_PYRKO/2-47------------------------------------------
Y1258_SYNY3/5-52------------------------------------------
A5UU74_ROSS1/2-49------------------------------------------
Q4BXD4_CROWT/13-61------------------------------------------
A0ZE25_NODSP/5-51------------------------------------------
Q8DLV1_THEEB/12-59------------------------------------------
Q24QR2_DESHY/5-52------------------------------------------
Q2FRQ9_METHJ/4-49------------------------------------------
Q03RX0_LACBA/8-55------------------------------------------
Q1NJ14_9DELT/2-49------------------------------------------
Q2IX27_RHOP2/6-53------------------------------------------
B3XQ22_LACRE/7-56------------------------------------------
A1UTM8_BARBK/15-62------------------------------------------
Q1Q743_9BACT/3-49------------------------------------------
A7JW75_PASHA/3-50------------------------------------------
Q027V3_SOLUE/18-66------------------------------------------
A7I6F9_METB6/3-49------------------------------------------
Q2FTZ2_METHJ/13-57------------------------------------------
Q8PY16_METMA/6-51------------------------------------------
A0YIV7_LYNSP/18-65------------------------------------------
Q1NMQ5_9DELT/23-70------------------------------------------
A3CSY0_METMJ/14-58------------------------------------------
A7C3W1_9GAMM/4-51------------------------------------------
Q7Y3V7_9CAUD/3-51------------------------------------------
A5ZVE7_9FIRM/4-51------------------------------------------
Q07PQ6_RHOP5/3-49------------------------------------------
Q3JBY5_NITOC/2-50------------------------------------------
Q1GBU5_LACDA/11-59------------------------------------------
Q9F560_ECOLX/2-55------------------------------------------
A7BN15_9GAMM/3-51------------------------------------------
A5UUG0_ROSS1/36-82------------------------------------------
Q73KG5_TREDE/8-54------------------------------------------
A3ILC1_9CHRO/24-70------------------------------------------
A1V9P2_DESVV/2-49------------------------------------------
Q2FQ26_METHJ/41-88------------------------------------------
A3ITF1_9CHRO/2-49------------------------------------------
A1VDI4_DESVV/2-50------------------------------------------
Q4C5M2_CROWT/2-50------------------------------------------

PF12909

A4J2N2_DESRM/50-137RQPHFPYIM.................AVLLQD.DLEGVIKLI
A5CZB0_PELTS/51-143RRAHYWYLR.................RVLRCAGDREKLFRVL
A5CZB2_PELTS/54-143RRGHYPYLR.................RIARCR.DAAQVKEVL
A5D516_PELTS/50-137RRTHFPYIL.................RVLLCD.SDEEIRSLL
B0K692_THEPX/50-137RKKHLPYIL.................NVLLQD.SHEGVKKLI
B1INK7_CLOBK/2-106RTKQIQNLLEQDIICDWDAISDIFQEAIKRKDLNKEDVQNIM
B8FQ08_DESHD/52-139RTHHFPYIL.................RIMLCE.NDDEIRALA
D2B388_STRRD/50-133HRENWGLVL.................LISLS..DDDELRRWL
Q0AX75_SYNWW/52-141RKHHYPYLR.................RIARLT.DIDQVMEVI
Q0AZ30_SYNWW/47-133RKTHYPYIL.................KVLLSS.NIDEVKGYI
Q1PWI1_9BACT/14-102RFHHKPYVD.................KVLECK.DKWELCELI
YL591_MIMIV/54-161KSPAGIYRRIVNTKCRSKILTDNNRNSIYLEV.NTKEISVVL

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window