Sequence alignment for CL0441

PF12328

A7RKV5_NEMVE/12-107KKKNDVYVNR-RSDFAGQLERCQKLLDSSH..................................................
Q5XJ22_DANRE/46-142KRRNDVYVNM-KTDFKAQLARCQKLLDAH...................................................
POP7_MOUSE/32-133RRPNDIYVNM-KTDFKAQLARCQKLLDGGTRGQNAC............................................
B3RMM4_TRIAD/26-122KRKNDVYVTR-KTNFAAQIKKCSKLLESEF..................................................
A8QG95_BRUMA/21-116KEKNDIYITR-HTSIAAQKGRIIKLLDEKM..................................................
B6AF38_CRYMR/20-140LNRFDIFVTR-KKPLIVYYRRALDLLLLSEN..........................ANTIYK...NRIG..........
Q5CI92_CRYHO/31-151IKENDIYVTR-KRPLIVYFRRAMNLLTVSEA..........................HNSIYE...ERLG..........
A1CF93_ASPCL/46-241SVPKIVYVST-KSPFMSAVKRVQKLLRQAEK..........................RATASV...NLAS..........
A1CYT9_NEOFI/46-237SVPKIVYVST-KSPFMSAVKRVQKLLRQAEK..........................RATAAV...NLSS..........
Q0CHA2_ASPTN/67-251SVPKIVYVST-SSPFMSAVKRVQKLLRQAEK..........................RAAASV...ELSN..........
B8NAY1_ASPFN/47-209SVPKVVYISS-NTPFMSAVKRVQKFLQQAEK..........................RATASV...NLSS..........
A2QNN0_ASPNC/46-221SSPKTIYVSS-SSPTMGVVKRVQKYLRAAEN..........................RATAKLLSGNNKG..........
Q5B499_EMENI/57-312SIPKTIYVSS-STPYMSAVKRVQKLLLQAEK..........................RATTSLANKNNKNKYGGKSAPQK
B6GZ05_PENCW/46-216SVPKTVYVSK-STPFMSAVKRVQKLLLQAEK..........................RATANI...NLED..........
A6R6X8_AJECN/46-235KVPKVVYVST-KTPFMSAAKRVQKLLKHAER..........................RATAKI...DLSE..........
C5GXI1_AJEDR/46-235KIPKVVYVST-NTPFMSAAKRVQKLLRQAER..........................RAISKI...DLSD..........
C1H9K2_PARBA/46-237KVPKVVYVST-NTPFMSAAKRVQKLLKQAER..........................RATSKI...DLSS..........
C5FLI6_ARTOC/46-222NVPKVVYVST-KSPFISIAKRVQKLLREAEK..........................RATQSV...CLGD..........
B6QQW8_PENMQ/84-301TVPKIVYVSS-KTPFMSAVKRVQKLLRLAER..........................RAMMPLIGKRRHS..........
B8M6X4_TALSN/63-260RVPKIVYVGT-KTPFMSAVKRVEKLLRLAER..........................RAMGPVIGSRRSY..........
A7EVU2_SCLS1/43-177SSEKVIYVSH-NSQFIAIVKRVRKYLDGAEF..........................RAGPTVLPSTDRE..........
B2WA80_PYRTR/92-255ASPKTIYITA-TTPYIPCVKRVRKLLADITKREKQSAASLDSRAGGAARGGQHGAKVLEANGR...LEAK..........
Q0V560_PHANO/112-248ASPKVLYITS-STPFVPALKRIRKLLAEIQQRGKQS...........QRKKHSG............LKSR..........
A3LSX7_PICST/29-144DKETTFLVKT-KTPYVSAVKQIQRILDKFNK..........................KVNK......KRK..........
Q6BH32_DEBHA/33-151EHETTFLVKS-STPYISALKRIQKILAKFDK..........................SVLP......NKK..........
A5DGW1_PICGU/44-158QQETEFLVKS-STPFIAAVKRISKKLEKFDK..........................SNVS......HKK..........
C5M1Y6_CANTT/23-152QASSIFLIKS-RTPYISSLKKITKTLDKFNK..........................TKSN......VKK..........
Q59SK4_CANAL/35-161QNASNFLIKS-STPYVSAIKQITKKLNKFSK..........................SKNSHT....INK..........
A5E3S4_LODEL/26-170EFNLTILIKS-LTPFISALKRIQKQLNKFSK..........................SAATST...SSKK..........
C4R085_PICPG/23-119EEKNTFFVKS-STLYVSAIKQISKKVEKLNA..........................TQAK......NKV..........
C4Y0Q0_CLAL4/19-137ERESTFLVKS-KTPFISAIKRIDIILDKFDR..........................DSID......HKK..........
Q6CI32_YARLI/27-139ASQDCFYVSS-KMAFVSALKKVTKLLKPSRK.................................................
A7TTC1_VANPO/22-139EIKTTIYVKS-ITPYVSALKRITKCLETLDK..........................H......................
B3LMZ1_YEAS1/28-137QIHTTIFVKS-TTPYVSALKRINKFLDSVHK..........................H......................
C5DIM7_LACTC/19-131QIKTTFYLKT-QTPYVSALKRINKLMSQLQR..........................H......................
C5DQC8_ZYGRC/18-119QVHSTLYLKS-KTPYVSALKRINKFLANVNR..........................T......................
Q6CLX6_KLULA/24-132KIKTTIYVKS-SSPYISVVKRTNRFLSNLHR..........................R......................
Q6FJI5_CANGA/19-118KIKSTMYVKS-GTPFKSATKRIDKLLNQCQR.................................................
Q74ZI6_ASHGO/21-120RATHVLYVKS-GMPYVSGIKRVARWLEALDS..........................RRSGGE.................
A7UX77_NEUCR/68-215PHTLIIKVTS-NAPFMSLVKRVRKGLESRSS........................LSRQQSTKGLPLTAR.........I
B2ANL2_PODAN/74-205NRTQIIKVAS-SASHMSLVKRVRKALESARN.........................NQQGTTKGLPLAAR.........V
Q2H3L4_CHAGB/83-220AHTVVIKVAS-GASFMSLVRRARKALEKAPG...........................RQNTTGLPLAAR.........V
YOR1_SCHPO/11-99AFRKGIIIRR-KTHLIAMIRRMRKKLDIDGS.................................................
Q9U1X8_CAEEL/29-124SNPNHIYITR-KTNVESQSKSTEEMLNNAF..................................................

PF01918

Q5TTP9_ANOGA/71-135---NDVYVTY.KSDFTYQLKSCLDIL.....--------------------------.......................
A0BUC6_PARTE/21-90---NEIRVSA.KRLDGSYIKRAIELLLG...--------------------------.......................
A0BZB2_PARTE/14-78---NAYNLSG.KTHPKTSVFVAKIYL.....--------------------------.......................
A0CAN3_PARTE/20-92---NVIRVTN.RVQSSNYVRRALWLFQGT..--------------------------......................R
A0CRB6_PARTE/21-85---NKLHISS.KKNARDFIFISKIFL.....--------------------------.......................
A0D0Y5_PARTE/26-89---NVISVNQ...GIHKLIDKAIRLL.....--------------------------.......................
A0DRJ2_PARTE/7-77---TDIKIKS.KSSQDQIAQYLVKAVLF...--------------------------......................L
A0DXL8_PARTE/14-78---KVFQLRG.SAKPRTSFFVSKIFL.....--------------------------.......................
A0E244_PARTE/20-92---NVIRVAN.KAQLSTQVRKALWLLQGT..--------------------------......................R
A0RUC2_CENSY/8-71---GIFKVED..DPVMRVAIDVLERL.....--------------------------.......................
A0RUK3_CENSY/64-127---DTIYVGA..KSIMTYVMATLTQL.....--------------------------.......................
A1CYT9_NEOFI/49-144---KIVYVST.KSPFMSAVKRVQKLLRQAEK--------------------------RATA............AVNLSSS
A1RWP1_THEPD/5-68---GTVFVGN..KPVSSYVLAAVTQF.....--------------------------.......................
A1RXL1_THEPD/6-70---GSVLVGN..KSVMNYVLAAVIQF.....--------------------------.......................
A1RZM9_THEPD/4-67---EVLLVGE..KPESAYTLELMTML.....--------------------------.......................
A2BLG4_HYPBU/6-69---NVVVIGK..KPVTDYVLAAILLF.....--------------------------.......................
A2E5Q2_TRIVA/19-82---TDIYITK.SMALMPMVEEIIKKL.....--------------------------.......................
A2GED7_TRIVA/2-66---EVVNVKQ.HTQMKTLIEYCEKRI.....--------------------------.......................
A2QNN0_ASPNC/49-147---KTIYVSS.SSPTMGVVKRVQKYLRAAEN--------------------------RATA...........KLLSGNNK
A2SRC9_METLZ/4-67---NTVLIGT..KPLMSYVLAVVTQF.....--------------------------.......................
A3DN55_STAMF/10-74---NTVLVGK..KPVMNYVIAVLTLI.....--------------------------.......................
A3DN57_STAMF/7-70---KIIDIGK..RPIDDYVFEAIISF.....--------------------------.......................
A3LRK8_PICST/32-99---TVVPITK.NDNMNKKVDKILESL.....--------------------------.......................
A3LSX7_PICST/32-109---TTFLVKT.KTPYVSAVKQIQRILDKFNK--------------------------....................KVN
A4G0V8_METM5/3-67---NTVYVGN..KGVMNYVLAVITQF.....--------------------------.......................
A4H734_LEIBR/9-71---AVVRVSS.NKRKFGYVDYTKHRL.....--------------------------.......................
A4HAX5_LEIBR/28-97---NEVRVTA.THGQHSYISYVIAVLNG...--------------------------.......................
A4RUB1_OSTLU/15-80---VDVEVVA.DSDARERAQQAVKAL.....--------------------------.......................
A4YHK2_METS5/36-100---NQFVVSR.NKPIEEQVLDIISSF.....--------------------------.......................
A5DGW1_PICGU/47-126---TEFLVKS.STPFIAAVKRISKKLEKFDK--------------------------....................SNV
A5E3S4_LODEL/29-110---LTILIKS.LTPFISALKRIQKQLNKFSK--------------------------S..................AATS
A5E5S3_LODEL/41-127---EFMEISR.NDSMKSTVSKIQSSTKLLPF--------------------------D..................AKKE
A5UMM2_METS3/4-67---NVIFIGS..KPVMNYVLAVVTQF.....--------------------------.......................
A6R6X8_AJECN/49-142---KVVYVST.KTPFMSAAKRVQKLLKHAER--------------------------RAT.............AKIDLSE
A6UQQ5_METVS/3-67---NIVYVGS..KGVMNYVLAVITQF.....--------------------------.......................
A6UWM9_META3/3-69---GIIYIGN..KGVMNYVLAVITQI.....--------------------------.......................
A6XPV1_BOTFB/46-145---KVVYVSD.KSQFIAIVKRVRKYLDGAEF--------------------------RAGPT..........VLPSTDRE
A6ZLB0_YEAS7/31-97---TTIFVKS.TTPYVSALKRINKFLDS...--------------------------.......................
A7AMG5_BABBO/18-82---GEIRVTS.VGLVYGYVNYARKLI.....--------------------------.......................
A7EEF9_SCLS1/113-187---TQMSILS.SSQIQKKASRILSILST...--------------------------......................F
A7I857_METB6/11-74---NTVFVGN..KPVMNYVLAVVTQF.....--------------------------.......................
A7RKV5_NEMVE/15-79---NDVYVNR.RSDFAGQLERCQKLL.....--------------------------.......................
A7S043_NEMVE/20-85---HEVFIKS.GSKIRTCVSHALNLL.....--------------------------.......................
A7TP16_VANPO/45-116---KSIKITK.NDNIKKSIDRLLKLF.....--------------------------.......................
A7TTC1_VANPO/25-91---TTIYVKS.ITPYVSALKRITKCLET...--------------------------.......................
A7UX77_NEUCR/71-176---LIIKVTS.NAPFMSLVKRVRKGLESRSS--------------------------LSRQQS.......TKGLPLTARI
ALBA_IGNH4/9-73---NEVRVGK..KPVMNYVLATLTLL.....--------------------------.......................
A8A9J8_IGNH4/4-67---EVIVVRD..KPVSEYVLNAVVAF.....--------------------------.......................
A8ME47_CALMQ/7-71---ATILVGK..KPTTNYVIATVMQF.....--------------------------.......................
A9A2B8_NITMS/21-84---SIVYIGN..DPVMQSALEVLSIL.....--------------------------.......................
ALBA_NITMS/7-70---DTIFIGK..KPLMAYVTSTLIQL.....--------------------------.......................
ALBA_METTH/5-68---NVVYIGN..KPVMNYVLAVVTQM.....--------------------------.......................
ALBA1_ARCFU/4-67---NSVFVGN..KPVMNYVLAVLTQF.....--------------------------.......................
POP6_YEAST/45-119---QYHGISK.NDNIKKSVNKLDKQINM...--------------------------......................A
ALBA1_SULSH/10-74---NVVLIGK..KPVMNYVLAALTLL.....--------------------------.......................
ALBA_NANEQ/2-66---PEVFIGK..KPLTNYVMAVVMQF.....--------------------------.......................
Q019H7_OSTTA/25-86---LVVSNSN.ARPFSYYLHEARAML.....--------------------------.......................
Q01CS1_OSTTA/23-88---KTVDVGN.AGDVQECANEALKAL.....--------------------------.......................
Q0V560_PHANO/115-213---KVLYITS.STPFVPALKRIRKLLAEIQQ--------------------------RGKQS..........QRKKHSGL
ALBA_UNCMA/5-68---NVIFVGN..KPVMNYVLAAVTQF.....--------------------------.......................
Q17F94_AEDAE/52-116---LWMHVKG.GSAIFNLVNYAKKAL.....--------------------------.......................
Q17HU6_AEDAE/72-136---NDIYVTV.KSDFTFQYKRCLDIL.....--------------------------.......................
Q2FNQ6_METHJ/8-71---NIVFVGN..KPVMNYVLAVVTQF.....--------------------------.......................
Q2GTN6_CHAGB/76-152---KTMSVLP.STSIRKHVDRALGHLGRF..--------------------------......................S
Q2H3L4_CHAGB/86-190---VVIKVAS.GASFMSLVRRARKALEKAPG--------------------------RQNTTG.......LPLAARVAAL
RP25L_BOVIN/26-91---LEMRVRA.GSKIRNLLGLALERLEG...--------------------------.......................
Q2MGL3_DROME/40-104---HNIYITS.KTDFKAQQRRCEELI.....--------------------------.......................
Q2QQM2_ORYSJ/59-122---NRIQVSTNKKPLYFYVNLAKRYM.....--------------------------.......................
Q2U097_ASPOR/50-145---KVVYISS.NTPFMSAVKRVQKFLQQAEK--------------------------RATA............SVNLSSS
Q385X2_TRYB2/12-74---SQVRVSV.KRRNFSYVDSIKVRL.....--------------------------.......................
Q3KPY2_XENLA/25-90---NDIYVTT.KTDFRAQLARCRQLL.....--------------------------.......................
Q4CW22_TRYCC/12-74---IQVRVGV.DRRNFAYVDFTKHRL.....--------------------------.......................
Q4DE55_TRYCC/11-73---NAVRVGF.HGSKFLYVDITKHLL.....--------------------------.......................
Q4DPV6_TRYCC/28-97---NEIRVTA.KHGQRSYITYAIALLRG...--------------------------.......................
Q4J974_SULAC/7-71---NEIVITK.SKRIEDYVLDTIILF.....--------------------------.......................
Q4MZ36_THEPA/18-82---GEIRVTT.LGRVSNYVTYAKKLL.....--------------------------.......................
Q4N0P6_THEPA/19-89---NSLIVSL.SKNSSFYANIGIKLLNG...--------------------------.......................
Q4RBZ3_TETNG/26-112---PQVQVKD.GSKIRNLLRFALGRMEQEGT--------------------------P.................GPAQD
Q4RGZ2_TETNG/106-177---LEMRVKE.GSKIRNLMGFAMARIQGE..--------------------------.....................KG
Q4RS91_TETNG/13-83---VHMRVKE.GSKIRNLLQFATARMDAG..--------------------------......................E
Q4UCZ5_THEAN/19-90---NSLIVSL.SKNSSFYANIGNKLLNG...--------------------------.......................
Q4XNA6_PLACH/13-76---NGIRISY.KSDALDYVYKAIVLF.....--------------------------.......................
Q4Z4H5_PLABA/11-76---DEMRITS.TGRMTNYVNYGAKIL.....--------------------------.......................
Q54HY6_DICDI/58-122---NEIYLSN.NGKFLYYVKRAKNLL.....--------------------------.......................
Q54U04_DICDI/18-84---NEVRIGGVHSQVSSSIEYGLNLF.....--------------------------.......................
ALBA_METJA/3-65---NVVLIGK..KPVMNYVVAVLTQL.....--------------------------.......................
Q583J0_TRYB2/27-96---NEIRVTA.RPGSRGYITYALALLRG...--------------------------.......................
Q59R03_CANAL/32-102---KVVKIPK.NDSIKNKVEAIFKSI.....--------------------------.......................
Q59SK4_CANAL/38-117---SNFLIKS.STPYVSAIKQITKKLNKFSK--------------------------...................SKNS
Q5B499_EMENI/60-177---KTIYVSS.STPYMSAVKRVQKLLLQAEK--------------------------RATTSLANKNNKNKYGGKSAPQK
Q5CNA2_CRYHO/16-91---NIKEVSTKCVEFLKSVSFLPQQILET..--------------------------.....................NL
Q5CXW7_CRYPI/34-123---NDIYVTR.KRPLIVYFRRAMNLLTVSEA--------------------------HN................SIYEE
Q66GV3_XENLA/26-91---NDIYVNT.KSDFRAQLARCRQLV.....--------------------------.......................
Q68EX3_XENLA/26-91---IEMKVQE.GSKMRNLLGFAIGKMEG...--------------------------.......................
Q6BH32_DEBHA/36-115---TTFLVKS.STPYISALKRIQKILAKFDK--------------------------....................SVL
Q6CI32_YARLI/30-96---DCFYVSS.KMAFVSALKKVTKLLKP...--------------------------.......................
Q6CLX6_KLULA/27-93---TTIYVKS.SSPYISVVKRTNRFLSN...--------------------------.......................
Q6CW86_KLULA/52-115---AIISYSK.NSNIKQCVDQLAAIT.....--------------------------.......................
Q6DGS1_DANRE/26-110---PEVRVKD.GSKIRNLMRFALSRMEEETA--------------------------A..................SADH
Q6FJI5_CANGA/22-83---STMYVKS.GTPFKSATKRIDKLL.....--------------------------.......................
Q6FMZ5_CANGA/45-111---ITTKVSK.NDKIKDKVSSLEKNV.....--------------------------.......................
Q6NNC7_DROME/33-97---LWMHVKG.GTKVSNVIEFAQEAL.....--------------------------.......................
Q6W390_9CREN/16-80---SEKFVIT.DKPVMELVMDVLPIL.....--------------------------.......................
Q6ZZY6_METVO/3-67---NSIYVGD..KGVMNYVTAVMTLF.....--------------------------.......................
Q74ZI6_ASHGO/24-91---HVLYVKS.GMPYVSGIKRVARWLEA...--------------------------......................L
Q7PTH5_ANOGA/29-93---LWMHVKG.GSEVKNLVDYAKKAL.....--------------------------.......................
Q7RXG6_NEUCR/164-240---KTMSVMP.STSIAKHVDKALQHLDRF..--------------------------......................S
Q7XUT4_ORYSJ/19-84---NEIRITA.QGRTRNYITYALALL.....--------------------------.......................
Q7YWL9_CAEEL/28-96---KIMLVSK.SSKFTKINGHVRDYFT....--------------------------.......................
Q8I617_PLAF7/15-80---ILISIKS.RDSIHKYVEECLHKL.....--------------------------.......................
Q8IJX8_PLAF7/14-84---NSIQVSM.TKKPTFYARIGKRMFTG...--------------------------.......................
Q8ISG7_STYLE/100-163---NLIKIYE.DSSMRKQLSYAIYQL.....--------------------------.......................
ALBA2_METKA/5-68---NVIYVGN..KPVTNYVLAVMTQF.....--------------------------.......................
ALBA1_METKA/6-69---NVVYVGS..KPVMNYVLACITQF.....--------------------------.......................
ALBA_PYRAE/5-69---QTILVGK..KPTTNYVIATVMAF.....--------------------------.......................
RPP25_MOUSE/36-101---VHMRVKE.GSKIRNLLAFATASMAQ...--------------------------.......................
Q94E63_ORYSJ/43-106---NRIQVSNTKKPLFFYVNLAKRYM.....--------------------------.......................
ALBA2_SULTO/7-71---NEILISR.TKRVEDYVLDVIVMF.....--------------------------.......................
ALBA2_SULSO/6-70---NEIVVRK.TKNVEDHVLDVIVLF.....--------------------------.......................
POP7_MOUSE/35-105---NDIYVNM.KTDFKAQLARCQKLLDG...--------------------------......................G
ALBA_THEAC/5-68---NIIFVGK..KPTMNYVLAVVTQF.....--------------------------.......................
Q9LNU5_ARATH/242-307---NEIRITS.MGRARNYITYAMALL.....--------------------------.......................
Q9M8Z6_ARATH/19-84---NEIRITS.KGLIRNYISYATSLL.....--------------------------.......................
Q9U1X8_CAEEL/32-96---NHIYITR.KTNVESQSKSTEEML.....--------------------------.......................
ALBA1_AERPE/9-73---NTILVGR..KPTINYVMAALKLL.....--------------------------.......................
ALBA2_AERPE/7-71---PEVRIGR..KPVMNYVLAILTTL.....--------------------------.......................

PF12328

A7RKV5_NEMVE/12-107...........................---.QEVWIHGLG-AAINRAINLSLQL...KQRGMG...SVEVSPKTSSVQLV
Q5XJ22_DANRE/46-142...........................---.REICIHGLG-LAINRAINIALQL...QTSSQG...ALQLAANTSTVELI
POP7_MOUSE/32-133...........................---.TEIYIHGLG-LAINRAINIALQL...QAGSFG...SLQVAANTSTVELV
B3RMM4_TRIAD/26-122...........................---.TEIHIHGLG-AAVNRAINLALQL...KLTSSG...GLEVSTTTSTVELF
A8QG95_BRUMA/21-116...........................---.DEVVLHGLG-AAVSRTINVALQI...QRKLVD...TVKIDVRTGTVKVT
B6AF38_CRYMR/20-140.....YRRNKNKLDISNEI........---.PKVVIHGMG-ACINTAIWLVQDL...KTNFGD...NIKETIETKTIEVI
Q5CI92_CRYHO/31-151.....CRRNKKLFKSGKNE........---.QFVVIHGMG-ACIMTAIWLVQDL...KSNLGD...KINIEVTTNTIKVT
A1CF93_ASPCL/46-241.....SKRTEQQKLAQLARGQ..EQLS---KEEVFVKATG-RAIEKALSVGRWF..EEREA.....EYAVRVKTGSVLVV
A1CYT9_NEOFI/46-237.....SKRTDRQKLAEVARGQ..EQLT---EEEVFVKATG-RAIEKALSVGRWF..EERGN.....EYAVRVKTGSVLVV
Q0CHA2_ASPTN/67-251.....PKKRDQQKLAQIARGQ..DELR---TEEVFVKATG-RAIEKALGVGRWF..EQRGD.....EYAVRVKTGSVLVV
B8NAY1_ASPFN/47-209.....SKKRDRERLAEIARGN..ESLK---KEEVFVKATG-RAIEKALRVGKWF..EERES.....EYVVRVETGSVLVV
A2QNN0_ASPNC/46-221.....KKGDRRNQFAQLARSN..EALK---KEEVFVKATG-RAMERALKVGKWF..EARGE.....EYTVSVKTGSVLVV
Q5B499_EMENI/57-312KLGEQTQTQQEQLIAAMARGEDRELLD---KEEVFVKATG-KAMQTALKVGRWFGSHGREE.....EYKVRVSTGAVLVV
B6GZ05_PENCW/46-216.....TRKNEKQILDELSK....VSER---REEVFVKATG-RAIEKALNVAKWF..EEKET.....EYKVRVNTGSVIVV
A6R6X8_AJECN/46-235......KISEKQKLTQLTESA..EDLK---KEEVFIKATG-RAIEKAMSIGNWF...AAKE.....EYAIKVNTGAVMVV
C5GXI1_AJEDR/46-235......KVSEKQKLSQLTEST..ENLK---KEEVFIKATG-RAIEKAMSVGKWF...AEKE.....EYAIRVNTGAVMVV
C1H9K2_PARBA/46-237......KASEKQKLANLTEST..EELK---KEEVFIKATG-RAIEKAVSIGKWF...EGKE.....EYAIRVNTGAVMVV
C5FLI6_ARTOC/46-222.....KGKTGKDKLAQLKGAS..EALR---KEPVFIKATG-RAIDKAMKVGKWF...DEKD.....GFTIKVKTGAVLVV
B6QQW8_PENMQ/84-301..HHHQQYGAKGGGGDVLEKCQ.KKLR---EDKVLVKATG-RAIEKALSVGRWF...EEGKGGSGEEFEVVIRTGSVCVV
B8M6X4_TALSN/63-260...NNNQTAGRGKGGEVLEKCQ.RRLG---EDKVLVKATG-RAIERALSVGRWF..EEGKGGGGGIEYEVVVRTGSVCVV
A7EVU2_SCLS1/43-177.....LMEEIEEGIKHSRMGKKAGGGK---SEEVVMKGTG-KAIEKTLMLANWW...QQQE.....GVRVVVRTKSIAAV
B2WA80_PYRTR/92-255.....DVERNVAEE.ASKKGE..ARKV---GGMVYLKATG-RAIPRALEIGLHF...QEDE.....SCRVRVELGNVKAV
Q0V560_PHANO/112-248.....EVEKGIVDELARKKGG..AE..---GEKVYVKATG-RAIPKALGLGVEF...QGEE.....GCVVRVEMGSVRAV
A3LSX7_PICST/29-144.....FQGGEYKKL.............---.NYITVKGMG-KAIEKTLSLGTHF...QS.......NYPVEVLTGSVEVL
Q6BH32_DEBHA/33-151.....YQNVEYKKV.............---.KYITVKGMG-KAIENTLSIALKF...QDE..L...NYKVDILTGSVEVL
A5DGW1_PICGU/44-158.....YQRGEYLKV.............---.KYICVKGMG-RAIEKTISIGLMF...KND..M...NYHVEITTGGTSVL
C5M1Y6_CANTT/23-152.....YQNEQFKNV.............---.KYITVKGMN-KTIEKVLSLALHF...QDK......NYKVDILTGSVEVL
Q59SK4_CANAL/35-161.....FQNEQYKTI.............---.KYITVKGMG-KTIEKVASIGTHF...QK.......DYKVDVLTGSTTVL
A5E3S4_LODEL/26-170.....YQNDQYKKL.............---.QYIKVRGMG-KCLEKTLKLALKF...QEL......NYRVDIVTGSIEVI
C4R085_PICPG/23-119.....F.....................---....IVKGMG-KSIPKVLSIGVYF...QLK......NYRVEVFTGSVKVL
C4Y0Q0_CLAL4/19-137.....FRRGNYKKI.............---.KYIRVKGMG-KAIEKVASLAAHY...TTK..K...AYKVDVYTGTVDVV
Q6CI32_YARLI/27-139........................QPR---RQYIRMMGMG-KCVDKTISLGLRF...QKE......GYKVDIFTGQTTLF
A7TTC1_VANPO/22-139............GA.............---.TYVKVLGMG-KAIEKTLSLGCHF...QEN..K...NRKVDIFTKSIPVL
B3LMZ1_YEAS1/28-137............GS.............---.SYVAVLGMG-KAVEKTLALGCHF...QDQ..K...NKKIEVYTKTIEVL
C5DIM7_LACTC/19-131............GS.............---.KYVTVLGMG-KASEKTLAVACYF...QEE..K...GKKVEVLTQSIDVL
C5DQC8_ZYGRC/18-119............GS.............---.TYVIVLGMG-KAVEKALSLACHF...QDQ..L...QKRVEILTKSVDVM
Q6CLX6_KLULA/24-132............KS.............---.EYITLLGMG-KAVFKTLSVAAHF...NTM..G...DYKVDILTKTLDVL
Q6FJI5_CANGA/19-118...........................---..YVTVLGMG-HSVTKTLAIATTY...QEK......LHKVQVMTKTIEVL
Q74ZI6_ASHGO/21-120...........................---.RHVTLLGLG-RAAERTLSVACHF...QG.......ARRVEVRTLSTEVL
A7UX77_NEUCR/68-215AAL..DTTSGGSKEGGSGNGLGPVEDA---LDDVVLVATG-RAIQKAVEVGCFF...TRER.....DLMVLLRTRTVKGV
B2ANL2_PODAN/74-205AAL..GAKNGGSDQTGP......ISDA---LDDVVLIATG-RAIQKAVEVGASF...TRER.....DLIVIARTRTVQAV
Q2H3L4_CHAGB/83-220AALRVGGSNSGGGGVGSGGTGRVFSDA---LDDVVFVATG-KAIAKAVEVAGLF...TREK.....DLRVLMRTRSLKAV
YOR1_SCHPO/11-99...........................---...ILYQATG-MAIPHLVELSDKY...KRQ......GYNISMDTATVEFM
Q9U1X8_CAEEL/29-124...........................---.DEVFIHGMG-ASINKALVFAMEV...ERRFGG...SVKSDIQTSTVQCT

PF01918

Q5TTP9_ANOGA/71-135........................NSP...LGEVFLHCTG.RAINRGINLALRV---KAE------F.P.....EAFE.Y
A0BUC6_PARTE/21-90.....................TEEIPK...QEFVVIKGIE.NAIPKVLVISEIV---RRR------V.A.....GLAQ.I
A0BZB2_PARTE/14-78.........................KR...FDVVEVHALG.DTISKAVRMAEQL---QRQ------NYV.....TIEK.I
A0CAN3_PARTE/20-92.K...................ENQPPA...FDTVIITAID.NAITKAIIISEVV---RRR------I.A.....GLYQ.I
A0CRB6_PARTE/21-85.........................KK...FQNVELHALG.EATKISVRVAENL---QRQ------GLV.....TITK.I
A0D0Y5_PARTE/26-89.......................KDEK...FSSIHLVAYE.KTAANAIMMAKIL---KEK------FP......KLHE.I
A0DRJ2_PARTE/7-77.....................RDRDNK...SESVRLFGAG.SAIPNAILVAEIV---RAR------F.K.....GLSS.I
A0DXL8_PARTE/14-78.........................KK...FDEVEIHALG.DAISGAVRCAETL---QRQ------GLA.....TIQK.I
A0E244_PARTE/20-92.K...................EEQPPI...LDTIYITAIE.NAISKAVIIAEVV---RRR------V.A.....GLYQ.I
A0RUC2_CENSY/8-71.........................GS...LGRITLKASG.ENIPNAVAIANII---TDK------MMK.....GTSS.V
A0RUK3_CENSY/64-127.........................SN...LPRVTIKARG.RRITQAVDVSQTI---VKR------MSS.....VGYS.V
A1CYT9_NEOFI/49-144.KRTDRQK.......LAEVARGQEQLT...EEEVFVKATG.RAIEKALSVGRWF---EER------G.......NEYA.V
A1RWP1_THEPD/5-68........................TSG...SKRVVLKARG.RAISRAVDAAELV---R.R------FLG.....GKVD.Y
A1RXL1_THEPD/6-70........................NQG...AKKVSIKARG.RAISRAVDVAEIV---RSR------FLK.....DEVD.V
A1RZM9_THEPD/4-67........................GKG...APRVVVRAVG.RNISKAVYVTEGV---RRL------TGD.....K.IA.Y
A2BLG4_HYPBU/6-69........................NEG...YDEVIIKGQG.NNVSKAVDVYNAL---ANR------LQD.....G.IE.L
A2E5Q2_TRIVA/19-82.........................HN...HNEITLHATG.AANYKALKIATVV---KSM------QK......GLVE.A
A2GED7_TRIVA/2-66.......................DSDN...SPGITIVGEE.KAVNKAISIAEIL---KNK------Y.......SLIE.T
A2QNN0_ASPNC/49-147.GKKGDRRN.....QFAQLARSNEALK...KEEVFVKATG.RAMERALKVGKWF---EAR------G.......EEYT.V
A2SRC9_METLZ/4-67........................NNG...KSEVVIKARG.KAIVRAVDTAEVS---TRQ------FLT.....G.VV.K
A3DN55_STAMF/10-74........................HQG...VKEIVVKARG.RAISKAVDTVEIV---RNR------FLP.....GKVD.I
A3DN57_STAMF/7-70........................QEG...VDNIILKGRG.DFISRAIDVYWAL---KDR------LGN.....S.IE.L
A3LRK8_PICST/32-99.........................QQ...EKPVVIASIS.NGIPKAISIVEIV---KQQ------MKNR..SLNIAQ.F
A3LSX7_PICST/32-109.KKR..............KFQGGEYKK...LNYITVKGMG.KAIEKTLSLGTHF---QS.------.........NYP.V
A4G0V8_METM5/3-67........................NSE..NADEVIIKARG.KAISRAVDVEEMV---RKR------FMS.....E.IK.I
A4H734_LEIBR/9-71........................HEG...YPEVTISALG.TAIADAVSVVELL---KNQ------........GVVT.V
A4HAX5_LEIBR/28-97.....................EDGKAR...NDTVKISGMG.GAIYNAVNIAEIV---KRR------I.V.....GLYQ.V
A4RUB1_OSTLU/15-80.......................EEGT...AEVVALVGVG.LQVSKTVAAAELV---KRS------M.L.....GVHQ.C
A4YHK2_METS5/36-100........................NQG...IKDVELKGYG.REIDRTVDVYNVL---KEK------LGD.....G.VV.L
A5DGW1_PICGU/47-126.SHK..............KYQRGEYLK...VKYICVKGMG.RAIEKTISIGLMF---KND------........MNYH.V
A5E3S4_LODEL/29-110.TSSK.............KYQNDQYKK...LQYIKVRGMG.KCLEKTLKLALKF---QE.------........LNYR.V
A5E5S3_LODEL/41-127.LTTS............NVDSKESLSK...DGVILLKGFS.RDIQKLVSIVEIV---KSQ------GNK.....KLYQ.Y
A5UMM2_METS3/4-67........................NGG...ADHVSLKARG.KAISRAVDTAEIV---RNG------FIP.....N.AD.V
A6R6X8_AJECN/49-142.KISEKQK.......LTQLTESAEDLK...KEEVFIKATG.RAIEKAMSIGNWF---AAK------........EEYA.I
A6UQQ5_METVS/3-67........................KSG..DVSEVSIKARG.KAISRAVDVEEMV---RNR------FMP.....E.VD.I
A6UWM9_META3/3-69........................NNEDIDTNEIRLKARG.RAISKAVDVEEML---KNK------FMP.....E.LK.L
A6XPV1_BOTFB/46-145.LMREIEEG....IKTSRMERKSGSGN...GEEVVMKGTG.KAIEKTLMLAHWW---QQQ------........EGVR.V
A6ZLB0_YEAS7/31-97......................VHKHG...SSYVAVLGMG.KAVEKTLALGCHF---QDQ------........KNKK.I
A7AMG5_BABBO/18-82........................DGG...EPVVTLRGTG.RAMSNVVETAEIL---RRA------YK......GMHQ.L
A7EEF9_SCLS1/113-187.....................SFSDPT...PHVVLLSAKA.PVACKLISIAEIV---KRE------LANN..GAKWFQ.Y
A7I857_METB6/11-74........................NNG...AGEVSIKARG.KAISRAVDTAEIA---LNR------FLD.....G.IS.K
A7RKV5_NEMVE/15-79........................DSS...HQEVWIHGLG.AAINRAINLSLQL---KQR------GM......GSVE.V
A7S043_NEMVE/20-85.......................QQEK...KELIIITGSG.PAVTKAITTAEIV---KRK------N.K.....GLHQ.H
A7TP16_VANPO/45-116.......................SNDTDGGKRTICLYSLG.NNLQKLLTILQIF---KKI------QKNT...VKIIQ.Y
A7TTC1_VANPO/25-91......................LDKHG...ATYVKVLGMG.KAIEKTLSLGCHF---QEN------........KNRK.V
A7UX77_NEUCR/71-176.AALDTTSGGS.KEGGSGNGLGPVEDA...LDDVVLVATG.RAIQKAVEVGCFF---TRE------........RDLM.V
ALBA_IGNH4/9-73........................NQG...VDRIEIKARG.RAISKAVDTVEIV---RNR------FLP.....GQVR.V
A8A9J8_IGNH4/4-67........................NSG...AEEVEIVGRG.RYISKAVVVFNRL---RER------LEE.....T.LK.V
A8ME47_CALMQ/7-71........................NQG...SKRVILKARG.SAIARAVAAATMV---RDR------FLA.....GQVD.I
A9A2B8_NITMS/21-84.........................GN...KKKITIKSKG.NSIPNAVAVANII---TEK------MLN.....GNSK.V
ALBA_NITMS/7-70.........................AN...IPSVNIKARG.LSIGRAVDVAQII---ARK------TEN.....AGYS.I
ALBA_METTH/5-68........................NGG...TSEVILKARG.IAISRAVDVAEIV---RNR------FIP.....D.IQ.I
ALBA1_ARCFU/4-67........................NSG...ATEVSIKARG.RAISRAVDVAEIV---RKR------FLP.....D.VD.V
POP6_YEAST/45-119.....................DRSLGL...QQVVCIFSYG.PHIQKMLSILEIF---KKG------YIKN..NKKIYQ.W
ALBA1_SULSH/10-74........................NQG...VSEIVIKARG.RAISKAVDTVEIV---RNR------FLP.....DKIE.I
ALBA_NANEQ/2-66........................MQG...ANEVVIKARG.RNISRAVDVAERV---RKR------FLA.....GQVD.V
Q019H7_OSTTA/25-86.........................RE...HGSVKLEGVG.AATQHALVVSEVL---SQR------........GIGK.V
Q01CS1_OSTTA/23-88.......................SSGA...RTVVVVRGIG.TQVSKTVAVAELV---KSS------L.T.....GIHQ.C
Q0V560_PHANO/115-213.KSREVEKG.....IVDELARKKGGAE...GEKVYVKATG.RAIPKALGLGVEF---QGE------........EGCV.V
ALBA_UNCMA/5-68........................NEG...AKEVTIKARG.RAISRAVDTAEVV---RHR------FLT.....D.VE.I
Q17F94_AEDAE/52-116.......................EAGE...HRAVVWSGTG.GGITKTISCAEIM---KKD------F.......ELHQ.V
Q17HU6_AEDAE/72-136........................NSA...LGEAFLHCTG.RAINQGINLALKI---KAK------YP......EAFD.Y
Q2FNQ6_METHJ/8-71........................NNG...AGEVIIKARG.KAISRAVDTTEIA---LNR------FLQ.....D.VE.K
Q2GTN6_CHAGB/76-152.I...................WDKSVL...PGVVLLCAKS.SASTKLITIAEII---RRR------IGES..EQKWFQ.Y
Q2H3L4_CHAGB/86-190.RVGGSNSGG..GGVGSGGTGRVFSDA...LDDVVFVATG.KAIAKAVEVAGLF---TRE------........KDLR.V
RP25L_BOVIN/26-91......................GS......ARHVVFSGSG.RAAGKAVSCAEIV---KRR------V.P.....GLYQ.L
Q2MGL3_DROME/40-104........................NSG...AHEIFLHCMG.FSVTRGLNIALRL---VQN------SD......GALS.Y
Q2QQM2_ORYSJ/59-122.........................QN...YDEVELSALG.MAIGTVVTVAEIL---KNN------GLA.......TE.K
Q2U097_ASPOR/50-145.KKRDRER.......LAEIARGNESLK...KEEVFVKATG.RAIEKALRVGKWF---EGR------E.......SEYV.V
Q385X2_TRYB2/12-74........................SGG...KPEVTISALG.KAISDAVAVAEIL---KNQ------........GLID.V
Q3KPY2_XENLA/25-90.......................STGD...FRELRVHGLG.LAIGRAINLALQL---QLS------YP......GTLH.I
Q4CW22_TRYCC/12-74........................HEG...KPEVIITGLG.RAISDAVAVVEIL---KNQ------........GLVT.V
Q4DE55_TRYCC/11-73........................HDG...EKEVSISALG.KAINEAVSVVEML---KDQ------........QMVL.V
Q4DPV6_TRYCC/28-97.....................EDGKVQ...NDTIKISAMG.AAIHNAVNIAEIV---KRR------V.V.....GLHQ.T
Q4J974_SULAC/7-71........................NQG...YEEVEIRGSG.QEINKAIEVYNQL---VDR------LKE.....G.VR.L
Q4MZ36_THEPA/18-82........................SNG...IPVITIRGTG.RAMSNVVETAEIL---RHM------IN......GLHQ.V
Q4N0P6_THEPA/19-89.....................ANDHLS...YDEIFVTGLG.TAIKVAIETAMLL---SNR------KVG.....VIKK.I
Q4RBZ3_TETNG/26-112.RGAP............PPQLGRQLLP...CGHIVFTATG.KGVSKAITCAEIV---KRR------V.K.....GLHQ.V
Q4RGZ2_TETNG/106-177.A..................SCGG......LRQVVFTGSG.RAVTKTITCAEIM---KRK------V.G.....SLHQ.L
Q4RS91_TETNG/13-83.G..................NETS......MRQMVFSGSG.GGVTKTITCVEIL---KRR------V.E.....GLHQ.L
Q4UCZ5_THEAN/19-90.....................ANDHLS...YDEIFVTGLG.TAIKVAIETAMLL---SNR------KVG.....MLSSFI
Q4XNA6_PLACH/13-76.........................ET...HDEVILSGVG.KAISSVVNVAEMI---KRR------A.K.....GLHQ.F
Q4Z4H5_PLABA/11-76.......................GEED...KKSLKIKATG.NAIGKAVTLAEII---KRR------F.K.....GLHQ.I
Q54HY6_DICDI/58-122.......................FNQR...EKEIIIHGLG.AAISLAVELSLYL---QKD------I.......EGLT.L
Q54U04_DICDI/18-84........................NKP...HDSIIVKAIGSKMISKAIFTAEII---KLR------V.P.....GLHQ.I
ALBA_METJA/3-65........................TSN....DEVIIKARG.KAINKAVDVAEMI---RNR------FIK.....D.IK.I
Q583J0_TRYB2/27-96.....................EEGKPK...YDSVKISAMG.AAIRSAVGVAEVL---KRR------V.A.....GLHQ.T
Q59R03_CANAL/32-102.........................EQ...DKLILLTGLS.NSIAKLICITEIV---KQK------QNEQQQQQHEPSQK
Q59SK4_CANAL/38-117.HTIN.............KFQNEQYKT...IKYITVKGMG.KTIEKVASIGTHF---QK.------.........DYK.V
Q5B499_EMENI/60-177KLGEQTQTQQEQLIAAMARGEDRELLD...KEEVFVKATG.KAMQTALKVGRWF---GSH------GRE.....EEYK.V
Q5CNA2_CRYHO/16-91.T..................DLQFKGE...NRTVVLIAKS.SAIPKAISISEII---KME------VP......NVSQ.L
Q5CXW7_CRYPI/34-123.RLGCR..........RNKKLFKSGKN...EQFVVIHGMG.ACIMTAIWLVQDL---KSN------LG......DKIK.I
Q66GV3_XENLA/26-91.......................SSGD...FREVRVHGLG.LAIGRAVNLALQL---QLS------FP......GTLL.I
Q68EX3_XENLA/26-91......................ES......VRQMLFVGSG.RALGKTISCVEIM---KRR------L.Q.....QLHQ.V
Q6BH32_DEBHA/36-115.PNK..............KYQNVEYKK...VKYITVKGMG.KAIENTLSIALKF---QDE------L.......N.YK.V
Q6CI32_YARLI/30-96.....................SRKQPR...RQYIRMMGMG.KCVDKTISLGLRF---QK.------........EGYK.V
Q6CLX6_KLULA/27-93......................LHRRK...SEYITLLGMG.KAVFKTLSVAAHF---NTM------........GDYK.V
Q6CW86_KLULA/52-115..............................ADTFVLVAYG.VHVQKALSIIEIF---KTT------ENG....KALHQ.F
Q6DGS1_DANRE/26-110.EGSE.............VSVGTGDNL...CRQIVFTGVG.QSVAKAITCVEIM---KRR------I.H.....GLHQ.L
Q6FJI5_CANGA/22-83........................NQC...QRYVTVLGMG.HSVTKTLAIATTY---QE.------........KLHK.V
Q6FMZ5_CANGA/45-111.........................KD...NNFVIIASYG.DHIQKMVTIVEIL---KKN------FAKD...TKLHQ.W
Q6NNC7_DROME/33-97.......................NKGE...HRCVVWSGSG.GGVVKTICCAEVL---KRS------H.......PLYQ.V
Q6W390_9CREN/16-80.........................NK...IGKIIIEGSG.DSCPTTVSVANII---TQN------ILN.....GTTK.T
Q6ZZY6_METVO/3-67........................DKP..DINEVILKARG.KSIVKAVDVEEVL---KNR------VMK.....S.VN.I
Q74ZI6_ASHGO/24-91.D...................SRRSGG...ERHVTLLGLG.RAAERTLSVACHF---QG.------.........ARR.V
Q7PTH5_ANOGA/29-93.......................EEGT...HRSVVWSGSD.GGVGKTISCAEIM---KRH------F.......ELHQ.V
Q7RXG6_NEUCR/164-240.L...................WDQSVL...PGVVLLSAKP.VASSKLVTIAELV---RRR------IGEG..EQKWFQ.Y
Q7XUT4_ORYSJ/19-84.......................QDNA...TDEIVIKAMG.RAINKTVAIVELL---KRR------I.V.....GLHQ.N
Q7YWL9_CAEEL/28-96......................ESPDC...NRFVVFKSTN.GATEKAVSCVEVF---KQQ------FEE.....PLYQ.W
Q8I617_PLAF7/15-80..........................K...TGNVKIIGRQ.YAIMKAFSILEAL---KEK------NEHF...DYIIE.Y
Q8IJX8_PLAF7/14-84.....................NEEKNP...FDEVIITGLG.NATKIAIGAASIM---EKE------DIG.....QIVK.V
Q8ISG7_STYLE/100-163.........................RE...RQTITLQAFG.ENISRAVKMAEIL---KMR------L.G.....MLHQ.E
ALBA2_METKA/5-68........................SEG...ADEVKLVARG.RAISRAVDVAEFI---RNN------VMP.....E.VE.V
ALBA1_METKA/6-69........................NEG...ANEVRIKARG.RAISRAVDVAEIV---RNR------FMP.....E.VE.V
ALBA_PYRAE/5-69........................NAG...VKKVVLKARG.AAISKAVSTAVMV---RDR------FLP.....GKVQ.I
RPP25_MOUSE/36-101......................PA......TRAIVFSGCG.RATTKTVTCAEIL---KRR------L.A.....GLHQ.V
Q94E63_ORYSJ/43-106.........................QQ...HGDVELSALG.MAIATVVTVAEIL---KNN------GFA.......VE.K
ALBA2_SULTO/7-71........................NQG...YDEVELKGVG.NSIYKAVEVYNQL---KDR------LGD.....G.II.L
ALBA2_SULSO/6-70........................NQG...IDEVILKGTG.REISKAVDVYNSL---KDR------LGD.....G.VQ.L
POP7_MOUSE/35-105.....................TRGQNA...CTEIYIHGLG.LAINRAINIALQL---QAG------SF......GSLQ.V
ALBA_THEAC/5-68........................NNN...ANKIIIKARG.KTISKAVDVAEIT---RHK------FIP.....D.AK.Y
Q9LNU5_ARATH/242-307.......................QENK...SNEVIFKAMG.RAINKSVTIVELI---KRR------I.P.....GLHQ.I
Q9M8Z6_ARATH/19-84.......................QEKS...VKDIVLKAMG.QAISKTVAISEIL---KNK------I.P.....GLHQ.D
Q9U1X8_CAEEL/32-96........................NNA...FDEVFIHGMG.ASINKALVFAMEV---ERR------FG......GSVK.S
ALBA1_AERPE/9-73........................NEE..GAPEVVIKARG.RNICNAVDTVEML---KNL------FIK.....N.LV.I
ALBA2_AERPE/7-71.......................MEQG...TNQVVVKARG.RNINRAVDAVEIV---RKR------FAK.....N.IE.I

PF12328

A7RKV5_NEMVE/12-107DDLE............................................................................
Q5XJ22_DANRE/46-142DDLEPE..........................................................................
POP7_MOUSE/32-133DELE............................................................................
B3RMM4_TRIAD/26-122DDFES...........................................................................
A8QG95_BRUMA/21-116DNLF............................................................................
B6AF38_CRYMR/20-140DDYI............................................................................
Q5CI92_CRYHO/31-151DVHI............................................................................
A1CF93_ASPCL/46-241DDIVEDEEAKQKVIEEAERARE................QQEQALPESRDGEKPVA......................SAE
A1CYT9_NEOFI/46-237DDIEEDEEAKRKAIVEAERVL.................QQEQAQEKKEDGEK.........................DDG
Q0CHA2_ASPTN/67-251DDVEEDEDAKRKALEEAERSQ.................QQQQGVAGGTAGEDGAT......................ADS
B8NAY1_ASPFN/47-209DDVVEDEERKRK..........................LKEKVKGGASQGS.............................
A2QNN0_ASPNC/46-221DDVVEDEEEREKAVEESERMKK................EVEEAKLKGEYGE.............................
Q5B499_EMENI/57-312DDVEEDEMSKGGFLRSGEKNTKGEMIEAEAGAADVDVDMEAQGAASAHKGDDTTLLTTTTGTEADDTTIMTETEAGKSSE
B6GZ05_PENCW/46-216DDIVEDEEMKAKEEQKR.....................QQQKEQAQNDPGD.............................
A6R6X8_AJECN/46-235DDIVEDEKLKRKQEGIEKDEKEA...............VSGTPKETPGEAC...V......................NPK
C5GXI1_AJEDR/46-235DDIVEDEKLQRKQEKKREEENNA...............IPDALKEAPHELD..........................AIA
C1H9K2_PARBA/46-237DDIVEDESLKRNHENKEKRGEAGENET...........VPDVSKKTTEGGD............................E
C5FLI6_ARTOC/46-222DDIVQDEDVKDGLADSTERSTDEAQK............NEGQEQLVSKPGE.............................
B6QQW8_PENMQ/84-301DDIVEEDVEDHEEDEEDEEDGEEKEGSIDPDINMAKINTTDNTNEDLTTTT...........................QD
B8M6X4_TALSN/63-260DDIVEEELQDDEKKEEEKDVSMTNTDE...........NPEMSSEEKREGK.............................
A7EVU2_SCLS1/43-177DDIVGVDN........................................................................
B2WA80_PYRTR/92-255DDIEVKSGATEQEQQAE...............................................................
Q0V560_PHANO/112-248DDVGVVG......KEGD...............................................................
A3LSX7_PICST/29-144DEFRVNEASDS.....................................................................
Q6BH32_DEBHA/33-151DEF............QIGTNGDD..............SD.........................................
A5DGW1_PICGU/44-158DEF................RPQD..............SD.........................................
C5M1Y6_CANTT/23-152DEFILPDATSNDNSEGEEEEDDD..............DD.........................................
Q59SK4_CANAL/35-161DEF..APIESNQEPDNENKSDDD.........................................................
A5E3S4_LODEL/26-170DEF..EKLENEDEEEDEEEEKMDVDVDVDVGKETMQEDD.........................................
C4R085_PICPG/23-119DEF.............................................................................
C4Y0Q0_CLAL4/19-137DEV............QHKTNHSL..............KD.........................................
Q6CI32_YARLI/27-139DEIKVAHETSEKMEVDGDD.............................................................
A7TTC1_VANPO/22-139DEVEVEDEDEAKDKDKDENKDGN..............EE.........................................
B3LMZ1_YEAS1/28-137DEVITEG..QA...DIDMESDV................E.........................................
C5DIM7_LACTC/19-131DEIVKSDPVTE...DIDEQDDG................T.........................................
C5DQC8_ZYGRC/18-119DE...............LSNDD................D.........................................
Q6CLX6_KLULA/24-132DEVFADD.........GKDEDGN..............EV.........................................
Q6FJI5_CANGA/19-118DEVVEDTESID.....................................................................
Q74ZI6_ASHGO/21-120DELAA...........................................................................
A7UX77_NEUCR/68-215DDIVRAEEEDGGGED.................................................................
B2ANL2_PODAN/74-205DDIEMM..........................................................................
Q2H3L4_CHAGB/83-220DDVVAE..........................................................................
YOR1_SCHPO/11-99DEIV............................................................................
Q9U1X8_CAEEL/29-124DDIV............................................................................

PF01918

Q5TTP9_ANOGA/71-135EVNTSQI-------------------------------------------------------------------------
A0BUC6_PARTE/21-90NQIGATQ-------------------------------------------------------------------------
A0BZB2_PARTE/14-78NTFTQKF-------------------------------------------------------------------------
A0CAN3_PARTE/20-92NTIKQVE-------------------------------------------------------------------------
A0CRB6_PARTE/21-85NSITADI-------------------------------------------------------------------------
A0D0Y5_PARTE/26-89SLIDNIE-------------------------------------------------------------------------
A0DRJ2_PARTE/7-77ATFENMQ-------------------------------------------------------------------------
A0DXL8_PARTE/14-78ETLTQTL-------------------------------------------------------------------------
A0E244_PARTE/20-92NKIQSVQ-------------------------------------------------------------------------
A0RUC2_CENSY/8-71EKIHVDS-------------------------------------------------------------------------
A0RUK3_CENSY/64-127SEVRISS-------------------------------------------------------------------------
A1CYT9_NEOFI/49-144RVKTGSV-------------------------------------------------------------------------
A1RWP1_THEPD/5-68GNIKIGS-------------------------------------------------------------------------
A1RXL1_THEPD/6-70SSIKIGS-------------------------------------------------------------------------
A1RZM9_THEPD/4-67GKIRIYS-------------------------------------------------------------------------
A2BLG4_HYPBU/6-69VDVKIDS-------------------------------------------------------------------------
A2E5Q2_TRIVA/19-82TVTTHTV-------------------------------------------------------------------------
A2GED7_TRIVA/2-66TTLEESV-------------------------------------------------------------------------
A2QNN0_ASPNC/49-147SVKTGSV-------------------------------------------------------------------------
A2SRC9_METLZ/4-67KNISIST-------------------------------------------------------------------------
A3DN55_STAMF/10-74EDINIGS-------------------------------------------------------------------------
A3DN57_STAMF/7-70VDIEIGS-------------------------------------------------------------------------
A3LRK8_PICST/32-99NNLQSHS-------------------------------------------------------------------------
A3LSX7_PICST/32-109EVLTGSV-------------------------------------------------------------------------
A4G0V8_METM5/3-67KEINLGT-------------------------------------------------------------------------
A4H734_LEIBR/9-71KKICTAR-------------------------------------------------------------------------
A4HAX5_LEIBR/28-97TELGSEL-------------------------------------------------------------------------
A4RUB1_OSTLU/15-80TTYAPVT-------------------------------------------------------------------------
A4YHK2_METS5/36-100VDVSIGS-------------------------------------------------------------------------
A5DGW1_PICGU/47-126EITTGGT-------------------------------------------------------------------------
A5E3S4_LODEL/29-110DIVTGSI-------------------------------------------------------------------------
A5E5S3_LODEL/41-127NRLLKYL-------------------------------------------------------------------------
A5UMM2_METS3/4-67EDISIAT-------------------------------------------------------------------------
A6R6X8_AJECN/49-142KVNTGAV-------------------------------------------------------------------------
A6UQQ5_METVS/3-67KNIILGT-------------------------------------------------------------------------
A6UWM9_META3/3-69KEVIFGT-------------------------------------------------------------------------
A6XPV1_BOTFB/46-145VVRTKSV-------------------------------------------------------------------------
A6ZLB0_YEAS7/31-97EVYTKTI-------------------------------------------------------------------------
A7AMG5_BABBO/18-82TLLDTQD-------------------------------------------------------------------------
A7EEF9_SCLS1/113-187NVVGELS-------------------------------------------------------------------------
A7I857_METB6/11-74KEIITST-------------------------------------------------------------------------
A7RKV5_NEMVE/15-79SPKTSSV-------------------------------------------------------------------------
A7S043_NEMVE/20-85NHLFFSK-------------------------------------------------------------------------
A7TP16_VANPO/45-116NKLTSFN-------------------------------------------------------------------------
A7TTC1_VANPO/25-91DIFTKSI-------------------------------------------------------------------------
A7UX77_NEUCR/71-176LLRTRTV-------------------------------------------------------------------------
ALBA_IGNH4/9-73AEIRIGS-------------------------------------------------------------------------
A8A9J8_IGNH4/4-67VNVEIGS-------------------------------------------------------------------------
A8ME47_CALMQ/7-71REVKLLS-------------------------------------------------------------------------
A9A2B8_NITMS/21-84EKINLDT-------------------------------------------------------------------------
ALBA_NITMS/7-70GEIKIGS-------------------------------------------------------------------------
ALBA_METTH/5-68ENIDICT-------------------------------------------------------------------------
ALBA1_ARCFU/4-67KDIKIST-------------------------------------------------------------------------
POP6_YEAST/45-119NKLTSFD-------------------------------------------------------------------------
ALBA1_SULSH/10-74KEIRVGS-------------------------------------------------------------------------
ALBA_NANEQ/2-66GDIKIDS-------------------------------------------------------------------------
Q019H7_OSTTA/25-86TAVRTGT-------------------------------------------------------------------------
Q01CS1_OSTTA/23-88TTYAPVK-------------------------------------------------------------------------
Q0V560_PHANO/115-213RVEMGSV-------------------------------------------------------------------------
ALBA_UNCMA/5-68DRIQIST-------------------------------------------------------------------------
Q17F94_AEDAE/52-116TRVCYRK-------------------------------------------------------------------------
Q17HU6_AEDAE/72-136EVNTSTI-------------------------------------------------------------------------
Q2FNQ6_METHJ/8-71KSILTST-------------------------------------------------------------------------
Q2GTN6_CHAGB/76-152NVPKETV-------------------------------------------------------------------------
Q2H3L4_CHAGB/86-190LMRTRSL-------------------------------------------------------------------------
RP25L_BOVIN/26-91TKLRFLQ-------------------------------------------------------------------------
Q2MGL3_DROME/40-104AINTSTV-------------------------------------------------------------------------
Q2QQM2_ORYSJ/59-122KILTSTI-------------------------------------------------------------------------
Q2U097_ASPOR/50-145RVETGSV-------------------------------------------------------------------------
Q385X2_TRYB2/12-74KKITTSR-------------------------------------------------------------------------
Q3KPY2_XENLA/25-90SPNTSTV-------------------------------------------------------------------------
Q4CW22_TRYCC/12-74KKITTSR-------------------------------------------------------------------------
Q4DE55_TRYCC/11-73KKISTSR-------------------------------------------------------------------------
Q4DPV6_TRYCC/28-97TDVSSEI-------------------------------------------------------------------------
Q4J974_SULAC/7-71EKVDIGS-------------------------------------------------------------------------
Q4MZ36_THEPA/18-82TTVDTQD-------------------------------------------------------------------------
Q4N0P6_THEPA/19-89ETSYYNS-------------------------------------------------------------------------
Q4RBZ3_TETNG/26-112TRVRYAT-------------------------------------------------------------------------
Q4RGZ2_TETNG/106-177TKLQYKV-------------------------------------------------------------------------
Q4RS91_TETNG/13-83SKLYYKT-------------------------------------------------------------------------
Q4UCZ5_THEAN/19-90YLIYFFV-------------------------------------------------------------------------
Q4XNA6_PLACH/13-76TELYEKE-------------------------------------------------------------------------
Q4Z4H5_PLABA/11-76TKCGSTV-------------------------------------------------------------------------
Q54HY6_DICDI/58-122STTTSSE-------------------------------------------------------------------------
Q54U04_DICDI/18-84TEIGTTE-------------------------------------------------------------------------
ALBA_METJA/3-65KKIEIGT-------------------------------------------------------------------------
Q583J0_TRYB2/27-96TEISSEV-------------------------------------------------------------------------
Q59R03_CANAL/32-102LDQYNKL-------------------------------------------------------------------------
Q59SK4_CANAL/38-117DVLTGST-------------------------------------------------------------------------
Q5B499_EMENI/60-177RVSTGAV-------------------------------------------------------------------------
Q5CNA2_CRYHO/16-91NSLVNLE-------------------------------------------------------------------------
Q5CXW7_CRYPI/34-123EVTTNTI-------------------------------------------------------------------------
Q66GV3_XENLA/26-91SPSTSSV-------------------------------------------------------------------------
Q68EX3_XENLA/26-91TRICFRH-------------------------------------------------------------------------
Q6BH32_DEBHA/36-115DILTGSV-------------------------------------------------------------------------
Q6CI32_YARLI/30-96DIFTGQT-------------------------------------------------------------------------
Q6CLX6_KLULA/27-93DILTKTL-------------------------------------------------------------------------
Q6CW86_KLULA/52-115NKLDSFI-------------------------------------------------------------------------
Q6DGS1_DANRE/26-110TKLAYRT-------------------------------------------------------------------------
Q6FJI5_CANGA/22-83QVMTKTI-------------------------------------------------------------------------
Q6FMZ5_CANGA/45-111NRLHSFE-------------------------------------------------------------------------
Q6NNC7_DROME/33-97TRMAYTS-------------------------------------------------------------------------
Q6W390_9CREN/16-80ENISVNS-------------------------------------------------------------------------
Q6ZZY6_METVO/3-67KNIALGT-------------------------------------------------------------------------
Q74ZI6_ASHGO/24-91EVRTLST-------------------------------------------------------------------------
Q7PTH5_ANOGA/29-93TRICYRK-------------------------------------------------------------------------
Q7RXG6_NEUCR/164-240NVLTETE-------------------------------------------------------------------------
Q7XUT4_ORYSJ/19-84TSIESID-------------------------------------------------------------------------
Q7YWL9_CAEEL/28-96TRVVCSK-------------------------------------------------------------------------
Q8I617_PLAF7/15-80NNLTATT-------------------------------------------------------------------------
Q8IJX8_PLAF7/14-84QTAYFSS-------------------------------------------------------------------------
Q8ISG7_STYLE/100-163NMLLVKF-------------------------------------------------------------------------
ALBA2_METKA/5-68KDIEIGT-------------------------------------------------------------------------
ALBA1_METKA/6-69KDIKIGT-------------------------------------------------------------------------
ALBA_PYRAE/5-69KDIKLLS-------------------------------------------------------------------------
RPP25_MOUSE/36-101TRLRYRS-------------------------------------------------------------------------
Q94E63_ORYSJ/43-106KIRTSTV-------------------------------------------------------------------------
ALBA2_SULTO/7-71EKADIGS-------------------------------------------------------------------------
ALBA2_SULSO/6-70VNVQTGS-------------------------------------------------------------------------
POP7_MOUSE/35-105AANTSTV-------------------------------------------------------------------------
ALBA_THEAC/5-68EEIKLDT-------------------------------------------------------------------------
Q9LNU5_ARATH/242-307TSIGSTD-------------------------------------------------------------------------
Q9M8Z6_ARATH/19-84IAISSIS-------------------------------------------------------------------------
Q9U1X8_CAEEL/32-96DIQTSTV-------------------------------------------------------------------------
ALBA1_AERPE/9-73KKVNIYS-------------------------------------------------------------------------
ALBA2_AERPE/7-71KDIKIDS-------------------------------------------------------------------------

PF12328

A7RKV5_NEMVE/12-107...............................PENDEDERHTRTRTNSAIHIR
Q5XJ22_DANRE/46-142...............................DPDEAGEHLTRTRNNSAIHIK
POP7_MOUSE/32-133...............................PETDSREPLTRVRNNSAIHIR
B3RMM4_TRIAD/26-122...............................LDETLPSKKSQLRQNSAIHIK
A8QG95_BRUMA/21-116...............................PLYDEVDFKTRNRFISAVHVR
B6AF38_CRYMR/20-140...............................TEDFEWDMTSKKRGVSAISIT
Q5CI92_CRYHO/31-151...............................NEEREWESSKSTRNVSGISIK
A1CF93_ASPCL/46-241YTAQHASTPASAEKETQQQQQQKKRKRAANAPTEDEELPETRTRWVNMVEVA
A1CYT9_NEOFI/46-237QPAADQSVDAPAQPGSKSETKKRKRAANALASASGEELPETRTRWVNMVEIA
Q0CHA2_ASPTN/67-251QTEMTVS.........KSAAKKRKRAITA.AAATEAELPESRTRWVNMVEIA
B8NAY1_ASPFN/47-209................ESAAKKQRRAASALAVAEEEELPETRTRWVNKVEVS
A2QNN0_ASPNC/46-221..............LTKSAMRKRKRAVA..RLEGEQELPETRTRWVNMVEVA
Q5B499_EMENI/57-312PTDAATKPKAESKPLSKSALRKRKRAANMAASLAETELPETRTRWVNSVEVA
B6GZ05_PENCW/46-216.........APSKPESKSAAKKRKRQAA..AAEDDAELPESRTRWIKMVEVA
A6R6X8_AJECN/46-235SADDVDNCNVASLQKSKPSTKKRRRKNE..AVDSTGELLESRTRWVNMVEIA
C5GXI1_AJEDR/46-235QSTDGANHTAGPFQKSKPETKKRKRQRNE.AVDANGELLESRTRWVNMVEIA
C1H9K2_PARBA/46-237TLDSGQGKGRDRQEQLKPTTKKRKRRRNE.AVDSDGELLESRTRWVNMVEIA
C5FLI6_ARTOC/46-222...............NMDATGKKGNKIQISDGRPNSPLPDSRTRWVNMLNRA
B6QQW8_PENMQ/84-301HKDGDRGEESKNQRRRRRKRERIREQRLKAFVDEDGETPESRTRWVNMVEVA
B8M6X4_TALSN/63-260.......EESKHQRRRRRRRERIREQRLKAFRDEDGETPESRTRWVNMVEIA
A7EVU2_SCLS1/43-177...............................ADEDMGEGESRVRRVSVLEVA
B2WA80_PYRTR/92-255...............................GEADDDIPETRIRTLSSVTVS
Q0V560_PHANO/112-248...............................DGDEEDIPETRIRNVSSVTVS
A3LSX7_PICST/29-144...............................EDEDEEKTLYQKRMVSYVELR
Q6BH32_DEBHA/33-151...............................ND.YNDETLFKKRMVSYIETR
A5DGW1_PICGU/44-158...............................EE.NDDEITFQKRMVSYVEVR
C5M1Y6_CANTT/23-152...............................DD.ENNERIYKKRMVSSIEAR
Q59SK4_CANAL/35-161...............................DD.DDDETIYKKRTVSSIEIR
A5E3S4_LODEL/26-170...............................VF.DDEERIYRKRMVSTVEVR
C4R085_PICPG/23-119...............................EK.EDDDSILSKRTVSSVEVR
C4Y0Q0_CLAL4/19-137...............................DD.SDTESEYRERKVSYMEIK
Q6CI32_YARLI/27-139...............................ESDSDEEIVKQQRIISTIEVR
A7TTC1_VANPO/22-139...............................QD.SDRETIMKKRTVPGIELH
B3LMZ1_YEAS1/28-137...............................DD..DKETQLKKRAVSGVELR
C5DIM7_LACTC/19-131...............................QD.GDREVELQKRTISGVEVR
C5DQC8_ZYGRC/18-119...............................DDPPDVDTELRKRTISGVEIR
Q6CLX6_KLULA/24-132...............................ST.EDRETELTKRTLSGVEVR
Q6FJI5_CANGA/19-118...............................DSDSDIETKLKKRLLSGVEVR
Q74ZI6_ASHGO/21-120...............................ADAEDEPCELRARRVSGVEVR
A7UX77_NEUCR/68-215...............................GSEEEEGSGARVRAYSVRPYG
B2ANL2_PODAN/74-205...............................DEDAEEEDSARVRHVSCVEVG
Q2H3L4_CHAGB/83-220...............................DEEGDLEDEVRVRYLSCLEVG
YOR1_SCHPO/11-99..................................DEVSIQNKNRLGNVLLLR
Q9U1X8_CAEEL/29-124...............................SLLDLDQSETRHRSVSAVHVH

PF01918

Q5TTP9_ANOGA/71-135----------------------------------------------------
A0BUC6_PARTE/21-90----------------------------------------------------
A0BZB2_PARTE/14-78----------------------------------------------------
A0CAN3_PARTE/20-92----------------------------------------------------
A0CRB6_PARTE/21-85----------------------------------------------------
A0D0Y5_PARTE/26-89----------------------------------------------------
A0DRJ2_PARTE/7-77----------------------------------------------------
A0DXL8_PARTE/14-78----------------------------------------------------
A0E244_PARTE/20-92----------------------------------------------------
A0RUC2_CENSY/8-71----------------------------------------------------
A0RUK3_CENSY/64-127----------------------------------------------------
A1CYT9_NEOFI/49-144----------------------------------------------------
A1RWP1_THEPD/5-68----------------------------------------------------
A1RXL1_THEPD/6-70----------------------------------------------------
A1RZM9_THEPD/4-67----------------------------------------------------
A2BLG4_HYPBU/6-69----------------------------------------------------
A2E5Q2_TRIVA/19-82----------------------------------------------------
A2GED7_TRIVA/2-66----------------------------------------------------
A2QNN0_ASPNC/49-147----------------------------------------------------
A2SRC9_METLZ/4-67----------------------------------------------------
A3DN55_STAMF/10-74----------------------------------------------------
A3DN57_STAMF/7-70----------------------------------------------------
A3LRK8_PICST/32-99----------------------------------------------------
A3LSX7_PICST/32-109----------------------------------------------------
A4G0V8_METM5/3-67----------------------------------------------------
A4H734_LEIBR/9-71----------------------------------------------------
A4HAX5_LEIBR/28-97----------------------------------------------------
A4RUB1_OSTLU/15-80----------------------------------------------------
A4YHK2_METS5/36-100----------------------------------------------------
A5DGW1_PICGU/47-126----------------------------------------------------
A5E3S4_LODEL/29-110----------------------------------------------------
A5E5S3_LODEL/41-127----------------------------------------------------
A5UMM2_METS3/4-67----------------------------------------------------
A6R6X8_AJECN/49-142----------------------------------------------------
A6UQQ5_METVS/3-67----------------------------------------------------
A6UWM9_META3/3-69----------------------------------------------------
A6XPV1_BOTFB/46-145----------------------------------------------------
A6ZLB0_YEAS7/31-97----------------------------------------------------
A7AMG5_BABBO/18-82----------------------------------------------------
A7EEF9_SCLS1/113-187----------------------------------------------------
A7I857_METB6/11-74----------------------------------------------------
A7RKV5_NEMVE/15-79----------------------------------------------------
A7S043_NEMVE/20-85----------------------------------------------------
A7TP16_VANPO/45-116----------------------------------------------------
A7TTC1_VANPO/25-91----------------------------------------------------
A7UX77_NEUCR/71-176----------------------------------------------------
ALBA_IGNH4/9-73----------------------------------------------------
A8A9J8_IGNH4/4-67----------------------------------------------------
A8ME47_CALMQ/7-71----------------------------------------------------
A9A2B8_NITMS/21-84----------------------------------------------------
ALBA_NITMS/7-70----------------------------------------------------
ALBA_METTH/5-68----------------------------------------------------
ALBA1_ARCFU/4-67----------------------------------------------------
POP6_YEAST/45-119----------------------------------------------------
ALBA1_SULSH/10-74----------------------------------------------------
ALBA_NANEQ/2-66----------------------------------------------------
Q019H7_OSTTA/25-86----------------------------------------------------
Q01CS1_OSTTA/23-88----------------------------------------------------
Q0V560_PHANO/115-213----------------------------------------------------
ALBA_UNCMA/5-68----------------------------------------------------
Q17F94_AEDAE/52-116----------------------------------------------------
Q17HU6_AEDAE/72-136----------------------------------------------------
Q2FNQ6_METHJ/8-71----------------------------------------------------
Q2GTN6_CHAGB/76-152----------------------------------------------------
Q2H3L4_CHAGB/86-190----------------------------------------------------
RP25L_BOVIN/26-91----------------------------------------------------
Q2MGL3_DROME/40-104----------------------------------------------------
Q2QQM2_ORYSJ/59-122----------------------------------------------------
Q2U097_ASPOR/50-145----------------------------------------------------
Q385X2_TRYB2/12-74----------------------------------------------------
Q3KPY2_XENLA/25-90----------------------------------------------------
Q4CW22_TRYCC/12-74----------------------------------------------------
Q4DE55_TRYCC/11-73----------------------------------------------------
Q4DPV6_TRYCC/28-97----------------------------------------------------
Q4J974_SULAC/7-71----------------------------------------------------
Q4MZ36_THEPA/18-82----------------------------------------------------
Q4N0P6_THEPA/19-89----------------------------------------------------
Q4RBZ3_TETNG/26-112----------------------------------------------------
Q4RGZ2_TETNG/106-177----------------------------------------------------
Q4RS91_TETNG/13-83----------------------------------------------------
Q4UCZ5_THEAN/19-90----------------------------------------------------
Q4XNA6_PLACH/13-76----------------------------------------------------
Q4Z4H5_PLABA/11-76----------------------------------------------------
Q54HY6_DICDI/58-122----------------------------------------------------
Q54U04_DICDI/18-84----------------------------------------------------
ALBA_METJA/3-65----------------------------------------------------
Q583J0_TRYB2/27-96----------------------------------------------------
Q59R03_CANAL/32-102----------------------------------------------------
Q59SK4_CANAL/38-117----------------------------------------------------
Q5B499_EMENI/60-177----------------------------------------------------
Q5CNA2_CRYHO/16-91----------------------------------------------------
Q5CXW7_CRYPI/34-123----------------------------------------------------
Q66GV3_XENLA/26-91----------------------------------------------------
Q68EX3_XENLA/26-91----------------------------------------------------
Q6BH32_DEBHA/36-115----------------------------------------------------
Q6CI32_YARLI/30-96----------------------------------------------------
Q6CLX6_KLULA/27-93----------------------------------------------------
Q6CW86_KLULA/52-115----------------------------------------------------
Q6DGS1_DANRE/26-110----------------------------------------------------
Q6FJI5_CANGA/22-83----------------------------------------------------
Q6FMZ5_CANGA/45-111----------------------------------------------------
Q6NNC7_DROME/33-97----------------------------------------------------
Q6W390_9CREN/16-80----------------------------------------------------
Q6ZZY6_METVO/3-67----------------------------------------------------
Q74ZI6_ASHGO/24-91----------------------------------------------------
Q7PTH5_ANOGA/29-93----------------------------------------------------
Q7RXG6_NEUCR/164-240----------------------------------------------------
Q7XUT4_ORYSJ/19-84----------------------------------------------------
Q7YWL9_CAEEL/28-96----------------------------------------------------
Q8I617_PLAF7/15-80----------------------------------------------------
Q8IJX8_PLAF7/14-84----------------------------------------------------
Q8ISG7_STYLE/100-163----------------------------------------------------
ALBA2_METKA/5-68----------------------------------------------------
ALBA1_METKA/6-69----------------------------------------------------
ALBA_PYRAE/5-69----------------------------------------------------
RPP25_MOUSE/36-101----------------------------------------------------
Q94E63_ORYSJ/43-106----------------------------------------------------
ALBA2_SULTO/7-71----------------------------------------------------
ALBA2_SULSO/6-70----------------------------------------------------
POP7_MOUSE/35-105----------------------------------------------------
ALBA_THEAC/5-68----------------------------------------------------
Q9LNU5_ARATH/242-307----------------------------------------------------
Q9M8Z6_ARATH/19-84----------------------------------------------------
Q9U1X8_CAEEL/32-96----------------------------------------------------
ALBA1_AERPE/9-73----------------------------------------------------
ALBA2_AERPE/7-71----------------------------------------------------

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window