Sequence alignment for CL0452

PF12718

Q755U4_ASHGO/7-149-KLATLKAESEQWQDKYEELKEEKKQLEDKNIEMENQIKSLTVKNEHLEEELEKLESQLNEHKQLAEDSTNLRSHN----
Q91XN6_RAT/7-153-KMQMLKLDKENALDRAEQAEADKKAAEDRSKQLEDELVSLQKKLKGTEDELDKYSEALKDAQEKLELAEKKATDA----
C3ZKT3_BRAFL/7-153-KMLMLKNDKENALDRAEQAEQAMKDAQEKNVKLEDEINDLNKKIRMVEDELDKAQESLKDATEQLEAATKKAADA----
A5D6H8_LIMPO/4-150-KMQAMKLDKENACDRADIAEQQSRDANARADKAEEEVRSLQKKIQQIENELDQVQEQLVTANAKLEEKDKALQNA----
A5D6I0_9CHEL/7-153-KMQAMKLDKDNACDRADTAEQQCKEAELRAERAEEEVRTLQKKIQQIENELDQAQEGLLQANNNLDEKDKALQTA----
B0KZJ4_ACASI/7-153-KMQAMKIDKDNAIDRAEIAEQKARDANLKSEKTEEEVRALQKKIQQIENELDQVQESLTQATTKLEEKEKALQTA----
A5D6I3_9CRUS/7-153-KMQAMKLEKDNAMDRADTLEQQNKEANNRAEKAEDEVNKLQKKMQQLENDLDQVQESLLTANNQLEEKDKALSNA----
Q17H75_AEDAE/7-153-KMQAMKLEKDNALDRALLCEQQARDANLRAEKAEEEARQLQKKIQAIENDLDQTQEALMAVNAKLEEKEKALQNA----
A8DKY0_9BILA/7-153-KMQAMKIEKDNALDRADAAEEKVRQMTDKLERIEEELRDTQKKMMQTENDLDKAQEDLSVANSNLEEKEKKVQEA----
B3W666_SCHJA/7-153-KMIAMKLEKENAMERAVQYEELLKKKEEEREKRENEISELNTKMKQAQIDCDEVQETLQEQMNKLEETEKRATNA----
TPM_ECHMU/7-153-KMMAMKLEKENALEKAINLENQLKEKAKDFEKKEEEMNDWLSKVKNIQTEVDTVQESLQEAISKLEETEKRATNA----
B5AF35_MIZYE/7-153-KMQAMKVDRENAQDLAEQMEQRLKDTETAKAKLEEDFNDLQKKLTTTENNFDVANEQLQEANVKLGNSEKQITQL----
B7XC63_TURCO/7-146-KMLAMKMEKENALDRAEQLEQKLRDTEEQKAKIEEDLNNLQKKCANLENDFDNVNEQLQDALSKLENSEKRVTEM----
TPM_MYTGA/7-153-KMVAMKMEKENALDRAEQLEQKLRETEEAKAKIEDDYNSLQKKSIQTENDLDNTQTQLQDVQAKYETTEKQIAEH----
B7XC66_CRAGI/7-153-KMIAMKMEKENAQDRAEQLEQQLRDTEEQKAKIEEDLTSLQKKHSNLENEFDTVNEKYQECQTKLEEAEKTASEA----
C1BRY8_9MAXI/7-153-KMQSLKSETDALYATINKFETETKEANARSDQFECDIRDLGKKSQSYEVEFDETNDKLTKALESLEEKEKAFKNA----
C4JZW7_UNCRE/11-153-KHKALQQENEALQETLTQLKEEIKTLKDQNREQERQVTELSQGKELLEKDIERIRDQLREAKDAVDAGAQDNATL----
A1CDA8_ASPCL/16-158-RMSALRLEADEAQNKVEELKSKVKTLEQENLAKEQEITSLNHRNQLLEGEVEKLETTLKEAKESANQSAQHDTQN----
A6R7T4_AJECN/7-149-KMNTLRLEADDAHAKVEELQNKVKALEQENLAKEQEIKSLTHRNQLLEADVEKLEADLKDAKASASENAQHGTQN----
A6S0T0_BOTFB/7-149-KMNTLRIEADEATAKVQELQEKVKALEQENLQKEQEITSLTHKNNLLETEVEKLEGGIKEAKAVAEEGSQHGTQN----
B2B5X9_PODAN/7-149-KMTQLRLESEESAAKVEELQAKVKALEQENLQKEQEIISLTHKNSVLESEVEKYETQVKDLKSAASEGAQHGTQN----
B2VZI7_PYRTR/7-149-RMEALRVEADESSARAEELKAKVKQLESETTQKEQEITSLSHKNQVLESEVEKLETQVKTYKDEAGAGAQAGTQA----
B6HMN3_PENCW/7-149-RMVSLRAEADEAHELVDELKAKVKTLEQENLSKEQEITSLNHRNQLLEEEVEKAEAALKEAKDAASQSLQHDTQN----
C5FYF1_ARTOC/7-149-KIESMRLEIDDGQTKLSEQKARIKELEQENLAKEQEVTSLTHRNQLLEERVENLEATLKEAKAKASEAAQDSSQN----
B6K811_SCHJY/7-149-KLNSIRAEAEEALARAEAAEESLKEKEHELARKDQELASLHKKNEDLEEQVDQLEQELKDVKEQAESESNQQSLI----
TPM_SCHPO/7-149-KINAARAETDEAVARAEAAEAKLKEVELQLSLKEQEYESLSRKSEAAESQLEELEEETKQLRLKADNEDIQKTEA----
A3LSG6_PICST/7-149-KINNLKADAEKWQEKSDELADRIKELEQENLEKDHQIQSLTRKNQVLEEQVEKLETDLEEIKHTADESHSLKTSN----
C4R6W6_PICPG/7-149-KINKLKLDAETWQEKHDDVNSKIKVLEQEALEKDHQIQALTRKNDVLEEQVEKLEEQLSTSKETVNESHSLKTNN----
Q6C081_YARLI/7-149-KMNSLRLETDAAQEKADEALEKVKAQEQELLQKDHEIQALTHKNSLLEEEVEKLEQQLSESKDAAEEGATHGAAN----
A6ZVD7_YEAS7/7-149-KLNSLKLESESWQEKYEELREQLKELEQSNTEKENEIKSLSAKNEQLDSEVEKLESQLSDTKQLAEDSNNLRSNN----
Q6FKV5_CANGA/7-149-KLTNLKLEAESWQEKYEELKEQMKQLEQDNIQKENEIKSLTVKNQQLDQEVEKLEDQIKETKELAEESTTLKSHN----
A7TEE8_VANPO/7-149-KLNNLKLEAESWQEKYEELKEQYKQLEQDNTDKENEIKSLSTKNQQLEEDVENLETKLTDSKQIAEDSHNLRSNN----
C5DUA1_ZYGRC/7-149-KLNNLKLESESWQEKYEELKEQYKQLEQDNTEKENHIKSLTTKNQHLEEEVEKLETDLTDSKQLADESHNLRSNN----
B4UN77_KLULA/7-149-KLSNLKLEAESWQDKYEELKEQVKVLEQEKTDNENLIKSLTTKNQTLEEEVETLEGQVSEHKQLAEDSTNLKSHN----
C5DMG5_LACTC/7-149-KLSNLKLEAESWQEKYEEVKEQMKQLEQENTEKENQIKSLTTKNQQLEDEVEKLEGELSEHKQLSEDSHNLRSHN----
A6ZS01_YEAS7/7-152-KLSNLKLEAESWQEKYEELKEKNKDLEQENVEKENQIKSLTVKNQQLEDEIEKLEAGLSDSKQTEQDNVEKENQI----
Q6FPA3_CANGA/7-152-KLNNLKLEAESWQEKYEELKEKNKELEQEKTDLENQAKALTVKNQSLEEEVEKLESGADQSRGLEQEKTDLENQV----
A8PRF4_MALGO/7-149-KLNSLRAEADAALERAEVAEARNKELEQDNLSKEQEISSLQHKLSVLESDLENAEAKLSEAKVGKEEGESHKSNV----
B0CUA0_LACBS/10-152-KLNSLRTEADNAVLRAEEAEAKNKKYEQLLLEKEQEITSLQHKLSQLDAELEKAEEKVAEYKTANVDGEQTKMTS----
Q5KF76_CRYNJ/10-149-ILGQ.KIEAAEA..RAEAAESENKKLNQTLLERDQELASLQHKLQLAEEELEASESKVKELKAASDEGETHRTTG----
Q4P5V6_USTMA/7-149-KLHTLRVEADAASERADELAEKNKQLEQELLTKDQEIASLQHKLSLAESDLDKLESKLHEHKSAREEHESNATNS----

PF00261

Q294A9_DROPS/48-284KKFVQVEVDLVTAKEQLEKANAELEEKEKLLTSTESEVATQNRKVQQIEEDLEKSEERSTTAQQKLLEATQSADEN.NRM
TPM2_HUMAN/48-284KKLKGTEDEVEKYSESVKEAQEKLEQAEKKATDAEADVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAADES.ERG
TPM3_HUMAN/48-284KKLKGTEDELDKYSEALKDAQEKLELAEKKAADAEAEVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAADES.ERG
Q7PKX8_ANOGA/48-284KRLEQVTQDHEKFKASLEQATKDSEEKDKLLTSTEANVAALTRKVQQVEEDLEKSEERSSAALSKLLEATQSADEN.NRM
Q6PPH7_HOMVI/48-284KKLTQVEGDLETNKKNLEQANKDLEEKEKLLTQAEAEVAALNRKVQMIEEDLERSEERSGQAQTKLAEASQAADEA.KRM
Q17H78_AEDAE/17-253KKMRQTKEEMEKYKDECEEFHKKLQGEVMRREEAESEVAALNRRIQLLEEDLERSEERLASATAKLSEASAAADES.ERI
Q1HPP7_BOMMO/16-252KKMRQTKEEMEKYKDECEEYHKRLQVEIMRREEAESEVAALNRRIQLLEEDLERSEERLATATAKLSEASQAADES.ERI
TPM1_DROME/102-338KKMRQTKEEMEKYKDECEEFHKRLQLEVVRREEAESEVAALNRRIQLLEEDLERSEERLGSATAKLSEASQAADES.ERA
Q6NN28_DROME/48-284KKIQTVENELDQTQEALTLVTGKLEEKNKALQNAESEVAALNRRIQLLEEDLERSEERLGSATAKLSEASQAADES.ERI
TPM_MYTGA/48-284KKSIQTENDLDNTQTQLQDVQAKYETTEKQIAEHEQEIQSLTRKISMLEEDIMKSEERYTTAASKLEEASKAADES.ERN
A1KYZ4_AEQIR/48-284KKLTTTENNFDISNEQLQDANTKLENAEKQITQLESDVAGLQRRLQLLEEDYERSEEKLNSTSEKLEEASKAADES.ERN
TPM1_BIOGL/48-284NKFSNLQNDFDTANEGLTEAQTKLEASEKHVAELESDTAGLNRRIQLLEEDLERSEERLQSATEKLEEASKAADES.ERG
TPM_HALRU/48-284KKCANLENDFDSVNEQVQVAMAKLETSEKRVTEMEQEVSGTTRKITLLEEDLERNEERLQTATERLEEASKLPDES.ERG
Q2V0V3_SEPLE/48-284KKYANLENDFDNANEQLTAANTNLEASEKRVAECESEIQGLNRRIQLLEEDLERSEERFSSAQSKLEDASKAADES.ERG
A7UMC0_SINCO/48-284KKYTNQENEYDKVNEQFNESTVKLEASEKRVTECEDEIKGFTRRIQLLEDELERTQQKAEEAVLKLEEASKAADES.ERG
TPM_ECHMU/48-284SKVKNIQTEVDTVQESLQEAISKLEETEKRATNAEAEVAAMTRRIRLLEEDFEQSSGRLTETSTKLDDASKAAEES.ERN
TPM_CLOSI/48-284NRMKQAQTELDEIQEALQDSLNKMEETDKRATNAEAEVARMTRRIRLLEEDLEVSSSRLTETLAKFDEASKTAEES.ERG
Q5DHF2_SCHJA/48-284KKIQQVDTDKETAQTQLAETNTKLEETDKRATEAEAEVASLQKRIRQLEDELESTETRLQEATLKLEEASKAADES.DRG
Q5VU70_HUMAN/6-242KKMQMLKLDKENALDRAEQAEAEQKQAEERSKQLEDELAAMQKKLKGTEDELDRAQERLATALQKLEEAEKAADES.ERG
Q91XN7_RAT/12-248RKIRSLQEQADAAEERAGSLQRELDQERKLRETAEADVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAADES.ERG
Q05705_CHICK/12-248KKIQSLQQVADEAEERAEHLQREADAERQARERAEAEVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAADES.ERG
Q6PA57_XENLA/9-245RKIQVLQQQADEAEEKSERLSRDLEGEKRSRETAEAEVASLNRRIQLVEEELDRAQERLSTALQKLEEVEKSADES.ERG
Q91864_XENLA/12-248RKIKSLQDQADAAEERAEKLQRERDMERKLREAAEGDVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAADES.ERG
Q4SWD9_TETNG/12-248KKIKVLQEQAEEAVERAERLQKEVEKERKAKEEAEMEVCTLCNRLQNQEDVLERTQQDLEKACRQQLEFEKVADER.QRG
A6QR15_BOVIN/48-284KKLKETEDELDKYSENLKDAQEKLELTEKKASDAEGDVAALNRRIQLVEEELDRAQERLATALQKLEEAEKAADES.ERG
Q5RBC9_PONAB/48-284KLLRVSEDERDRVLEELHKAEDSLLAAEEAAAKAEADVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAADES.ERG
Q805C4_TAKRU/12-248RKIQTLQQQADDAEDRAQVLQRQLDSERELREKAEGEVAALNRRIQLVEEELDRAQERLAVALQKLEEAEKAADES.ERG
Q7SZ31_XENLA/48-284KKTKGTEDEVEKYSESVKDAQEKLEMAEKKATDAEAEVASLNRRIQLVEEELDRAQERLATALQKLEETEKAVDES.ERG
Q5BKL2_XENTR/48-284KKTKSTEDEVEKYSESVKEAQEKLEMAEKKATDAEAEVASLNRRIQLVEEELDRAQERLATALQKLEETEKAVDES.ERG
TPM1_CIOIN/48-284KRLKATEDELDTSQEKLRTAIENLENAEKKAADAEQEVASLNRRITLVEEELDRAQERLTISLSKLEEAEKAADES.ERG
Q676A8_OIKDI/48-282KKQKATEEELNSAKERLQKVQDELKAAEKKAADAENEVTHCNKKIMTMEEELDSVQEKLNTSIVKLDEAEKNADES.ERG
TPM_BRABE/48-284KKIRMVEDELDKAQESLKEATEQLEAATKKAADAEAEVASLNRRIQLVEEELDRAQERLNSTVEKLTDSEKAADES.ERA
Q0ZDM4_SACKO/48-284KKMRNLELELDTTQDKLSQAELKLDDAEKTASTAEAEVSSLQRRLQLLDEELERAQERYQVAADKLADIEKAADES.ERA
Q0ZDM0_NEMVE/9-245EKMQQIKDQTDDAEERELGAKSLLKEAEAKEEQLLSEASGIQRRITLLNSELEKKNERVEE.QEKLLQNLVHNSEMNEEA
TPM2_PODCA/12-244AKLKEITEQIDDADQKKVEAKHALVDSLARLEKNEVEVNSAKRRIKLIEKDLEDSSERLKVAEEKLIKVEAEEKKI.EEA
A7SC63_NEMVE/12-247AKLQAIKEKIDETEDRELAAMEKLREAEERFEKAEGEAESFKRRIQLIEAESRRVKELSQKKDHELEEMHKRSKEE.ENL
Q0ZDL8_NEMVE/3-232KKI.......EEFEEREKAAMKKIARLEEVIAKDKNESATLRRSCSLTEHQLDKTEDILDQKLERLVMLHKKTEQD.IQM
Q6S5G5_NEMVE/6-242KKMATLRQTLEDAEARAAKAEDELKNANDRADSAETEVAALTKQLQQLEDDLDAAESKLADTQGQLTEAEKQADES.ERA
Q86DU9_SCHJA/13-211KKIKELQTELEKLQFDVIAEDETLKHETGLREKAEAEVAAMTRRIRLLEEDLEVSSSRLTETLTKLEEASKTAEES.ERT
TPM_CAEBR/20-256KKMRQAREEAEAAKDEADEVKRQLEEERKKREDAEAEVAALNRRIVLVEEDLERTEDRLKVATSKLEQATKAADEA.DRA
TPM_DERPT/48-284KKIQQIENELDQVQEQLSAANTKLEEKEKALQTAEGDVAALNRRIQLIEEDLERSEERLKIATAKLEEASQSADES.ERM
TPM_CHIOP/48-284KKSQLVENELDHAQEQLSAATHKLVEKEKAFANAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAADES.ERM
TPM_TRIPS/48-284KKMMQVENELDKAQEELTGANAQLEEKEKKVQEAEAEVAALNRRIQLLEEDFERAEERLKIATEKLEEASQTADES.ERV

PF12718

Q755U4_ASHGO/7-149--------------------------------E....NFTKKNQQLEEELEESDTK------------------------
Q91XN6_RAT/7-153--------------------------------EADVASLNRRIQLVEEELDRAQER------------------------
C3ZKT3_BRAFL/7-153--------------------------------EAEVASLNRRIQLVEEELDRAQER------------------------
A5D6H8_LIMPO/4-150--------------------------------EGEVAALNRRVQLLEEDLERSEER------------------------
A5D6I0_9CHEL/7-153--------------------------------EGEVAALNRRIQLIEDDLERSETR------------------------
B0KZJ4_ACASI/7-153--------------------------------EGDVAALNRRIQLIEEDLERSEER------------------------
A5D6I3_9CRUS/7-153--------------------------------EGEVAALNRRIQLLEEDLERSEER------------------------
Q17H75_AEDAE/7-153--------------------------------ESEVAALNRRIQLLEEDLERSEER------------------------
A8DKY0_9BILA/7-153--------------------------------EAEVAALNRRMTLLEEELERAEER------------------------
B3W666_SCHJA/7-153--------------------------------EAEVAAMTRRIRLLEEDLEVSSSR------------------------
TPM_ECHMU/7-153--------------------------------EAEVAAMTRRIRLLEEDFEQSSGR------------------------
B5AF35_MIZYE/7-153--------------------------------ESDVGALQRRLQLLEEDFEQSEEK------------------------
B7XC63_TURCO/7-146--------------------------------EQEVSGTTRKITLLEEDLERNEEG------------------------
TPM_MYTGA/7-153--------------------------------EQEIQSLTRKISMLEEDIMKSEER------------------------
B7XC66_CRAGI/7-153--------------------------------EQEIQSLNRRIQLLEEDMERSEER------------------------
C1BRY8_9MAXI/7-153--------------------------------EEEVGALSRRIMLMEEEAKKAETT------------------------
C4JZW7_UNCRE/11-153--------------------------------K....SLEGRVELLQNELDETYAA------------------------
A1CDA8_ASPCL/16-158--------------------------------E....ALQRRVQLLEEEAEEADRN------------------------
A6R7T4_AJECN/7-149--------------------------------E....SLQRRLQLLEEEAEETDKT------------------------
A6S0T0_BOTFB/7-149--------------------------------E....TLQRRLQLLEEEAEEADKN------------------------
B2B5X9_PODAN/7-149--------------------------------E....TLTRRLQLLEEEAEQADKT------------------------
B2VZI7_PYRTR/7-149--------------------------------E....SLQRKIQVLEEEAEESDRT------------------------
B6HMN3_PENCW/7-149--------------------------------E....ALQRRVQLLEEEAEENDKT------------------------
C5FYF1_ARTOC/7-149--------------------------------E....ALQRRIQLMEEEAEQTDKT------------------------
B6K811_SCHJY/7-149--------------------------------D....SLNRKIESLEEELENSDKS------------------------
TPM_SCHPO/7-149--------------------------------E....QLSRKVELLEEELETNDKL------------------------
A3LSG6_PICST/7-149--------------------------------D....NYTKKNQVLEEELEEADKN------------------------
C4R6W6_PICPG/7-149--------------------------------E....NITKKNQLLEEELEAADKN------------------------
Q6C081_YARLI/7-149--------------------------------E....GLSKKLAILEEDLENSDRN------------------------
A6ZVD7_YEAS7/7-149--------------------------------E....NYTKKNQDLEQQLEDSEAK------------------------
Q6FKV5_CANGA/7-149--------------------------------E....NFNKKNQMLEEELEETDRK------------------------
A7TEE8_VANPO/7-149--------------------------------E....NFTKKNQQLEEELEETDLK------------------------
C5DUA1_ZYGRC/7-149--------------------------------D....NYTKKNQQLEEELEESDAK------------------------
B4UN77_KLULA/7-149--------------------------------E....NFSKKNQQLEEELEENDSK------------------------
C5DMG5_LACTC/7-149--------------------------------E....NFTKKNQQLEEELEESDTK------------------------
A6ZS01_YEAS7/7-152--------------------------------K....SLTVKNHQLEEEIEKLEAE------------------------
Q6FPA3_CANGA/7-152--------------------------------K....ALTVKNQTLEEEVEKLESE------------------------
A8PRF4_MALGO/7-149--------------------------------D....ILQRRIDMLEEQLDQSERS------------------------
B0CUA0_LACBS/10-152--------------------------------E....GLQRKVQLLEEELDVAEKN------------------------
Q5KF76_CRYNJ/10-149--------------------------------E....NLARKVQLLEEELDKAEKD------------------------
Q4P5V6_USTMA/7-149--------------------------------E....SLQRKVELLEGELDTAEKN------------------------

PF00261

Q294A9_DROPS/48-284CKVLENRSQQDEERMDQLTNQLKEARMLAEDADTKSDEVSRKLAFVEDELEVAEDRVRSGEAKIMELEEELKVVGNSLKS
TPM2_HUMAN/48-284MKVIENRAMKDEEKMELQEMQLKEAKHIAEDSDRKYEEVARKLVILEGELERSEERAEVAESKCGDLEEELKIVTNNLKS
TPM3_HUMAN/48-284MKVIENRALKDEEKMELQEIQLKEAKHIAEEADRKYEEVARKLVIIEGDLERTEERAELAESKCSELEEELKNVTNNLKS
Q7PKX8_ANOGA/48-284CKVLENRSQQDEERMDQLSNQLKEARMLAEDADTKSDEVSRKLAFVEDELEVAEDRVKSGEAKIMELEEELKVVGNSLKS
Q6PPH7_HOMVI/48-284CKVLENRSQQDEERMDQLTNQLKEARMLAEDADGKSDEVSRKLAFVEDELEVAEDRVKSGDSKIMELEEELKVVGNSLKS
Q17H78_AEDAE/17-253RKALENRTNMEDDRVAILEAQLSQAKLIAEEADKKYEEVARKLVLMEQDLERSEEKVEMNESKIVELEEELRVVGNNLKS
Q1HPP7_BOMMO/16-252RKALENRTNMEDDRVAILEAQLSQAKLIAEESDKKYEEVARKLVLMEQDLERAEERAEQSDCKIVELEEELRVVGNNLKS
TPM1_DROME/102-338RKILENRALADEERMDALENQLKEARFLAEEADKKYDEVARKLAMVEADLERAEERAEQGENKIVELEEELRVVGNNLKS
Q6NN28_DROME/48-284RKALENRTNMEDDKVALLENQLAQAKLIAEEADKKYEEVARKLVLMEQDLERSEEKVELSESKIVELEEELRVVGNNLKS
TPM_MYTGA/48-284RKVLENLNCGNDERIDQLEKQLTEAKWIAEEADKKYEEAARKLAITEVDLERAEARLEAAEAKVIDLEEQLTVVGANIKT
A1KYZ4_AEQIR/48-284RKALEGKNNTNEERIDELEKQLDSAKNVAQDADSKFDEAARKLAITEVDLERAETRLEAADAKVLELEEELTVVGANIKT
TPM1_BIOGL/48-284RKVLESRSLADDERLDGLEAQLKEAKYIAEDAERKYDEAARKLAITEVDLERAEARLEAAEAKVWELDEELHIVGNNIKT
TPM_HALRU/48-284ARVLESRSLADDERIDQLEAQLKEAKYIAEDAERKYDEAARKLAITEVDLERAEARPKAAEAKILELEEELKVVGNNTKS
Q2V0V3_SEPLE/48-284RKVLENRSQGDEERIDLLEKQLEEAKWIAEDADRKFDEAARKLAITEVDLERAEARLEAAEAKIVELEEELKVVGNNMKS
A7UMC0_SINCO/48-284RKVLESRSIADDDRIDKLEKDVKDSKYLAEEADRKYDEAARKLAITEVDLERAETRLEAAESKITELSEELQVVGNNCKA
TPM_ECHMU/48-284RKTLETRSISDDERMAQLEEQVKEAKYIAEDAERKYDEAARRLAVTEVDLERAESRLETSESKIVELEEELRIVGNNMKS
TPM_CLOSI/48-284RKELEIRSIADDEGLSQLEDQQKEGKYIAEDADRKYDEAARKLAIVEVDFERAESRLEAAESKIVELEEELRVVGNNMKA
Q5DHF2_SCHJA/48-284RKVLENRTFADEERINQLEEQLKESTFMAEDADRKYDEATRKLAVAEVALSHAEDRIEAAESKITDSKEELRIVGNNVKS
Q5VU70_HUMAN/6-242MKVIENRALKDEEKMELQEIQLKEAKHIAEEADRKYEEVARKLVIIEGDLERTEERAELAESKCSELEEELKNVTNNLKS
Q91XN7_RAT/12-248MKVIESRAQKDEEKMEIQEIQLKEAKHIAEDADRKYEEVARKLVIIESDLERAEERAELSEGKCAELEEELKTVTNNLKS
Q05705_CHICK/12-248MKVIENRAMKDEEKMELQEMQLKEAKHIAEEADRKYEEVARKLVVLEGELERSEERAEVAESRVRQLEEELRTMDQSLKS
Q6PA57_XENLA/9-245MKVIENRALKDEEKMELQEIQLKEAKHIAEEADRKYEEVARKLVVIEGDLERTEERAELAESRCRDLEEQIRQLDHGLKC
Q91864_XENLA/12-248MKVIENRALKDEEKMELQEIQLKEAKHIAEEADRKYEEVARKLVIIEGDLERAEERAELSESHCRQLDNQQRIMDQTLKT
Q4SWD9_TETNG/12-248MKVIENRAQKDEEKLEFLEAQLNEAKGIADEADRKYEESARRVKCLEDDLERAEDKAAKSLSKCCVLEEELKTIIATSRS
A6QR15_BOVIN/48-284MKVIENRAMKDEEKMEIQEMQLKEAKHIAEEADRKYEEVARKLVILEGELERAEERAEVSELKCGDLEEELKNVTNNLKS
Q5RBC9_PONAB/48-284MKVIESRAQKDEEKMEIQEIQLKEAKHIAEDADRKYEEVARKLVIIESDLERAEERAELSEGKCAELEEELKTVTNNLKS
Q805C4_TAKRU/12-248MKVIENRAMKDEEKMEIQEMQLKEAKHIAEEADRKYEEVARKLVILEGELERAEERAELSECKASDLEEELKNVTNNLKS
Q7SZ31_XENLA/48-284MKVIENRATKDGEKMVDQDQQLKEAKTIAEDSDRKYEEVARKLVGIEGDLERSEERAEVAESKCGDLEEELKNVTNNLKS
Q5BKL2_XENTR/48-284MKVIENRATKDEEKMVDQEQQLREAKNIAEESDRKYEEVARKLVVLEGDLERSEERAEVAESRLRQLEEELRTMDQNLKS
TPM1_CIOIN/48-284RKVIENRSLKDEERLEVQEIQLTEAKNIAEDADRKYVEVARKLVMVEAELERGEERAELAESKAIELEEELKIVANNLKS
Q676A8_OIKDI/48-282RKVIEARAAKDEERLKDQETALKEAKSVAEEADKKYEEVARKLVLVETDVEKAEERAELAETRANELEEELKAVANNLKS
TPM_BRABE/48-284RKVLENRQGADEDKMELLDMQLREAKMIAEEADRKYEEVARKLVITEGDLERAEERADLAETKARELEDELKTTTGQLKS
Q0ZDM4_SACKO/48-284RKVLENRGLSDDDRITELENLVKTTRQMAEDADVKYEEVARKLVVTEAELERAEERAEVAEAKGSDLEEELKIVATNLKS
Q0ZDM0_NEMVE/9-245RKGLEESEMKGDEKIMDLEAKLKEMERVEKETLETLTEAERKEVVVTRDLERAIEKGRTLENRIQSLESTMGNALTNIQK
TPM2_PODCA/12-244RNLLEEAESADDEKMYNIEEEFKESKRTLESNETKYIEAQRKGVVISRDVEKTRDKADTLEKRVAVLEQTIASAGESLVE
A7SC63_NEMVE/12-247CKTLEVTDRESDEKMRELEDALEEAIELDKSTADKLAEVELKIKVVQGELEKAVERGDRAEMMCEHLMNDFTGTSEVLRD
Q0ZDL8_NEMVE/3-232LKVLEDRELEVDNSLDRLEPSAKAAIQRQHDAEMRCMEVQRRLTLTTSELHKIRARQREKEEEVRELENRLKVGGRSIQQ
Q6S5G5_NEMVE/6-242RKVLENRGASDEERLASLERQYNDALERTEEAEKQYEEISERLQELENELEEAEQKADAAEARVKELEEEVTLVGNNLRS
Q86DU9_SCHJA/13-211WRQVQNKMDTYDKKVEQLKKAVEDATEAAKETDKKYKEISCTLALTEKNLAEAEIRMAKSEELVAELENALKNLAAKWKS
TPM_CAEBR/20-256RKSMETRSQQDEERANFLETQVDEAKVIAEDADRKYEEVARKLAMVEADLERAEERAEAGENKIVELEEELRVVGNNLKS
TPM_DERPT/48-284RKMLEHRSITDEERMEGLENQLKEARMMAEDADRKYDEVARKLAMVEADLERAEERAETGESKIVELEEELRVVGNNLKS
TPM_CHIOP/48-284RKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAEERAESGESKIVELEEELRVVGNNLKS
TPM_TRIPS/48-284RKVMENRSLQDEERVYQLEAQLKEAQLLAEEADRKYDEVARKLAMVEADLERAEERAEAGENKIVELEEELRVVGNNLKS

PF12718

Q755U4_ASHGO/7-149------------------L...KETLELLRETDLKSEQLERKVASLENEVQDWESKYEELQTKYSSAKG-----------
Q91XN6_RAT/7-153------------------L...ATALQKLEEAEKAADESERGMKVIESRAQKDEEKMEIQEIQLKEAKH-----------
C3ZKT3_BRAFL/7-153------------------L...NSTVEKLTDSEKAADESERARKVLENRGAADEDRMELLDMQLREAKM-----------
A5D6H8_LIMPO/4-150------------------L...KIATQKLEEATQLADESERMRKMLEHRSITDEERMDSLDGQLKEARM-----------
A5D6I0_9CHEL/7-153------------------L...VSATEKLAEASQAADESERMRKMLEHRSITDEERMDGLENQLKEARG-----------
B0KZJ4_ACASI/7-153------------------L...KVATAKLEEASQAADESERMRKMLEHRSITDEERMEGLENQLKEARM-----------
A5D6I3_9CRUS/7-153------------------L...NTATTKLAEASQAADESERMRKVLENRSLSDEERMDALEDQLKEARF-----------
Q17H75_AEDAE/7-153------------------L...ASATAKLSEASAAADESERARKVLENRALADEERMDALENQLKEARF-----------
A8DKY0_9BILA/7-153------------------L...KLATEKLEEATHTADESERVRKVMENRSFQDEERANTVESQLKEVQM-----------
B3W666_SCHJA/7-153------------------L...TETLTKLEEASKTAEESERGRKDLEIRSIADDERLNQLEDQQKEAKY-----------
TPM_ECHMU/7-153------------------L...TETSTKLDDASKAAEESERNRKTLETRSISDDERMAQLEEQVKEAKY-----------
B5AF35_MIZYE/7-153------------------L...LTTTEKLEEASKAADESERNRKVLEGRSNTSDERIDVLEKQLDSAKT-----------
B7XC63_TURCO/7-146------------------L...QTATERLEEASKAANESERG.......SLADDERIDQLEAQLKEAKY-----------
TPM_MYTGA/7-153------------------Y...TTAASKLEEASKAADESERNRKVLENLNCGNDERIDQLEKQLTEAKW-----------
B7XC66_CRAGI/7-153------------------L...QTATEKLEEASKAADESERNRKVLENLNNASEERTDVLEKQLTEAKL-----------
C1BRY8_9MAXI/7-153------------------L...ADTVTKLAYASKEADGILKKVKYFENKTMRNEVELEEGDKNLRETTK-----------
C4JZW7_UNCRE/11-153------------------A...KLANKSRQEAELTAEHYERQAKSAEAQAKEWEAKHDEVSKKYKDLQQ-----------
A1CDA8_ASPCL/16-158------------------L...RETNEKLRQTDVKAGHYERKVQALEASRDQWESKYEEMAKKYAELQK-----------
A6R7T4_AJECN/7-149------------------L...RETNEKLRQTDVKAGHYERKVQALETSRDQWEAKYEQMSKKYEDLQK-----------
A6S0T0_BOTFB/7-149------------------L...RETNDKLRQTDVKAGHFERKVQALEQDRDQWEAKFEEMAKKYATVQK-----------
B2B5X9_PODAN/7-149------------------L...REANEKLRQTDVKAGHFERKVQALEQERDQWESKYEEMAKKYATVQK-----------
B2VZI7_PYRTR/7-149------------------I...RELNEKLRQTDVKSGHYERKVQALEQSRDQWETKYEEMAKKYADTKK-----------
B6HMN3_PENCW/7-149------------------L...RETNEKLRQTDIKAGHYERKVQALEDQHAKLEQRYEDAIKEHSAVKK-----------
C5FYF1_ARTOC/7-149------------------L...RETNEKLRQTDVKAGHFERKVQALEATREQWETKYEEMSKQYAAVKE-----------
B6K811_SCHJY/7-149------------------L...RETTEKLRQIDINTEHTERKIQALEHERDDLEVRLEDTTDKYNKVKA-----------
TPM_SCHPO/7-149------------------L...RETTEKMRQTDVKAEHFERRVQSLERERDDMEQKLEEMTDKYTKVKA-----------
A3LSG6_PICST/7-149------------------L...KETTEKLRETDIKAEQLERKVASLEQEKEEWERKYEELTEQHLAAKS-----------
C4R6W6_PICPG/7-149------------------L...KETTEKLRDTDIKAEALEKKVTSLENEREEWERKFEELQEKYNATRE-----------
Q6C081_YARLI/7-149------------------L...RETTEKLRQTDVKAEHFERKVTSLEQERDDWEKKHEELLEKYNAAKK-----------
A6ZVD7_YEAS7/7-149------------------L...KEAMDKLKEADLNSEQMGRRIVALEDERDEWEKKCEEFQSKYEEAQK-----------
Q6FKV5_CANGA/7-149------------------L...KETSDRLKEIELNSETLERKTAALQEERDEWEKKYEEVAAKYEDAKK-----------
A7TEE8_VANPO/7-149------------------L...KETIEKLRESDLKSETLERKVNALEDERNDWEKKYEDLSVQYETAKK-----------
C5DUA1_ZYGRC/7-149------------------L...KETTEKLRETDLKAEQLERKVVALEEERDEWERKHEELTSKYEEAKK-----------
B4UN77_KLULA/7-149------------------L...KETTEKLREADLKVEQLERKVTSLEQERDDLEKKYDDLQTKYDAAKA-----------
C5DMG5_LACTC/7-149------------------L...KETTDKLRETDLKAEGLERKVVSLEQERDDWEKKYEELTAKYDEAKK-----------
A6ZS01_YEAS7/7-152------------------LAESKQLSEDSHHLQSNNDNFSKKNQQLEEDLEESDTKLKETTEKLRESDL-----------
Q6FPA3_CANGA/7-152------------------LSELKQTSEESTTLRSNNENFTKKNQQLEEELEESDAKLKETTEKLRESDL-----------
A8PRF4_MALGO/7-149------------------L...KETTEQLRHTDVRAEQLERQIQGAEQERDQWEHKYEEAQERYQASKR-----------
B0CUA0_LACBS/10-152------------------V...KETVERLRQVDVKAEHFERQVQRLEQERDLWEKKYEESEAKYKKSQA-----------
Q5KF76_CRYNJ/10-149------------------L...KETTEKLRQVDVKAEHFERQVQRLEQERDEWERKHGEAVEKYQQSKR-----------
Q4P5V6_USTMA/7-149------------------L...RETTDKLRQVDVKAEHFERQVATLEREVATWEKKYEAAEERYRASKA-----------

PF00261

Q294A9_DROPS/48-284LEVSEEKANQRVEEFKREM---KTLAIKLKEAEQRAEHAEKQVKRLQKEVDRLEDRLFNEKEKYKAICDDLDQTFAELTG
TPM2_HUMAN/48-284LEAQADKYSTKEDKYEEEI---KLLEEKLKEAETRAEFAERSVAKLEKTIDDLEDEVYAQKMKYKAISEELDNALNDITS
TPM3_HUMAN/48-284LEAQAEKYSQKEDKYEEEI---KILTDKLKEAETRAEFAERSVAKLEKTIDDLEDELYAQKLKYKAISEELDHALNDMTS
Q7PKX8_ANOGA/48-284LEVSEDKANQRVEEFKRQL---KSLTIKLKEAETRAENAEKNVKKLQKEVDRLEDKLMNEKEKYKAICDDLDSTFAELTG
Q6PPH7_HOMVI/48-284LEVSEEKANQRVEEYKQQI---KQLTVKLKEAEARAEFAEKTVKKLQKEVDRLEDDIRHEVDRYKALSGDVDATFSEMLS
Q17H78_AEDAE/17-253LEVSEEKAMASRDSVEDKI---HQLNDKLTNAEARAEFAERSVQKLQKEVDRLEEEVTKEKSKYKAIAAELDLTFADLSG
Q1HPP7_BOMMO/16-252LEVSEEKATKREETYETHL---KLLDAQLKEAEARAEFAERSVQKLQKEVDRLEDDLVAEREKSKLLQEEMEATLHDIQN
TPM1_DROME/102-338LEVSEEKANQREEEYKNQI---KTLNTRLKEAEARAEFAERSVQKLQKEVDRLEDDLVLEKERYKDIGDDLDTAFVELIL
Q6NN28_DROME/48-284LEVSEEKANQREEEYKNQI---KTLNTRLKEAEARAEFAERSVQKLQKEVDRLEDDLVLEKERYKDIGDDLDTAFVELIL
TPM_MYTGA/48-284LQVQNDQASQREDSYEETI---RDLTNRLKDAENRATEAERTVSKLQKEVDRLEDELLTEKEKYKAISDELDATFAELAG
A1KYZ4_AEQIR/48-284LQVQNDQASQREDSYEETI---RDLTKSLKDAENRATEAERQVTKLQKEVDRLEDELLAEKERYKAISDELDQTFAEIAG
TPM1_BIOGL/48-284LSIQNDQASQREDSYQETI---RDLTQRLKDAENRATEAERTVSKLQKEVDRLEDELLAEKERYKSISDELDSTFAELAG
TPM_HALRU/48-284LEISEQEASQREDSYEETI---RDLTQRLKDAENRATEAERTVSKLQKEVDRLEDELLAEKEKYKAISDELDQTFAELAG
Q2V0V3_SEPLE/48-284LEISEQEASQREDSYEETI---RDLTHRLKEAENRAAEAERTVSKLQKEVDRLEDELLAEKERYKTISDELDQTFAELAG
A7UMC0_SINCO/48-284LQNAVDQASQREDSYEETI---RDLTQRLKDAENRAAEAERVVNKLQKEVDRLEDELLQEKEKYKQISDELDQTFAELAG
TPM_ECHMU/48-284LEVSEQESLQREESYEETI---RDLTERLKTAEQRAAEAERQVSKLQNEVDRLEDELLSEKERYRAISGELDTTFAELTS
TPM_CLOSI/48-284LEISEQESAQREESYEETI---RDLTERLKAAEQRAAEAERQVSKLQNEVDHLEDDLLSEKIRYKDLSGGLDQTFAELTG
Q5DHF2_SCHJA/48-284LEISEQEAAQREEAYEENI---RDLTERLKAAEDRAQESERLVNTLQADADRLEDELVTEKEKYKALSEELDSTFAELTG
Q5VU70_HUMAN/6-242LEAQAEKYSQKEDKYEEEI---KILTDKLKEAETRAEFAERSVAKLEKTIDDLEDELYAQKLKYKAISEELDHALNDMTS
Q91XN7_RAT/12-248LEAQAEKYSQKEDKYEEEI---KVLSDKLKEAETRAEFAERSVTKLEKSIDDLEDELYAQKLKYKAISEEPDHALNDMTS
Q05705_CHICK/12-248LIASEEEYSTKEDKYEEEI---KLLGEKLKEAETRAEFAERSVAKLEKTIDDLEDEVYAQKMKYKAISEELDNALNDITS
Q6PA57_XENLA/9-245LNATEEKYSKKEDKYEEEI---KILSDKLKEAETRAEFAERSVAKLEKTIDDLKDKMRLTKDENAKMQMMLDDTLQQLNS
Q91864_XENLA/12-248LIASEEKYSQKEDKYEEEI---KVLTDKLKEAETRAEFAERTVAKLEKSIDDLEEKVAHAKEENLKMHQMLDQTLLELNN
Q4SWD9_TETNG/12-248LEAQVEKYSVKEDKYELAI---RNLTDKLKEAENRAEAAERTLSTCERTISSLEDALGEAREENTKITATLDQTLHDLNL
A6QR15_BOVIN/48-284LEAASEKYSEKEDKYEEEI---KLLSDKLKEAETRAEFAERTVAKLEKTIDDLEEKLAQAKEENVGLHQTLDQTLNELNC
Q5RBC9_PONAB/48-284LEAQAEKYSQKEDKYEEEI---KVLSDKLKEAETRAEFAERSVTKLEKSIDDLEEKVAHAKEENLSMHQMLDQTLLELNN
Q805C4_TAKRU/12-248LEAQAEKYSEKEDKYEEEI---KILTDKLKEAETRAEFAERTVTKLEKSIDDLEEKLSSAKEENLGMHQVLDQTLLELNS
Q7SZ31_XENLA/48-284LEAQADKYSSKEDKYEEEV---NQLTEKLKEAESRVEFAEKSVVKLEKTIDDLEDEVYSQKMRYKAISEDLDNALNDITS
Q5BKL2_XENTR/48-284LIAAEEEYASKEDKYEDEI---KLLSEKLKETDGRVEFAEKSVVKLEKTIDDLEENLSAAKEESIELNQTLDQTLLELNN
TPM1_CIOIN/48-284LEASAEKYAAKEGIFEEEI---KTLSDKLKDSETRAEFAEKSVVKLEKNIDELEDSLYAEKCKIKAISEDMDVTLQGIGD
Q676A8_OIKDI/48-282LEAAAEKYTTKEAQYIEEV---RSLEEKLKDAGERADHAEKSVTELESTIDELEDKLYAEKLKIKQTVEDMDNTIH..AS
TPM_BRABE/48-284MEAQATKASEKEEAYEEQV---RDLSAKLKEAETRAEFAERTVAKLEKNVDDLEDALYAEKEKYRGVSEELDQALNELHN
Q0ZDM4_SACKO/48-284LEVSEEKASEREFNYEEKI---KQLEASLKEAETRAEFAERSNQKLERQVDDLEDELFSEKEKNKSMADELDQTLQDLHA
Q0ZDM0_NEMVE/9-245LEASGDEAYEREELKEEKL---KFFQEQLKQYEQRYEDAEREALKLERINDTIIIEIDSYKKKKEEILREMDLELVDLNR
TPM2_PODCA/12-244LEEREGESSEREEINEEKL---IFLAGQFKESEVRAEAAERSCNVLERNIFETENEINTWIQKRKEIEDEM....IEMDT
A7SC63_NEMVE/12-247LEVKDAAASEREIDNEDKI---EFIQENLKQMVYRYEEAERKAPPLEMLLDQLVEDLELYRLKRKQVDEEM.KAMGELVE
Q0ZDL8_NEMVE/3-232LVISEEKYCDKEDEFRHRI---RLLKANLAATILRAEESERRCMRLERENDMVEEETRAYKKNYDMMQKELHDTLNDIEC
Q6S5G5_NEMVE/6-242LEISEGKASEREDTYENQI---RELETKLQDAEERAEKAEQKVQELEAQAEAMEAELEKAKEQYEKVKEELDSTLAELSE
Q86DU9_SCHJA/13-211MEIKKEQSAEIEKNLEERI---NVLTHHVKEAEYRADSAE......................................AG
TPM_CAEBR/20-256LEVSEEKALQREDSYEEQI---RTVSSRLKEAETRAEFAERSVQKLQKEVDRLEDELLLEKERVRNLTEEIEQTVQEIQG
TPM_DERPT/48-284LEVSEEKAQQREEAHEQQI---RIMTTKLKEAEARAEFAERSVQKLQKEVGRLEDELVHEKEKYKSISDELDQTFAELTG
TPM_CHIOP/48-284LEVSEEKANQREETYKEQI---KTLANKLKAAEARAEFAERSVQKLQKEVDRLEDELVNEKEKYKNIADEMDQAFSELSG
TPM_TRIPS/48-284LEVSEEKALQREDSYEEQI---RLLTQRLKEAETRAEFAERSVQKLQKEVDRLEDELVHEKEKYKAISEELDQTFQELSG

PF12718

Q755U4_ASHGO/7-149-
Q91XN6_RAT/7-153-
C3ZKT3_BRAFL/7-153-
A5D6H8_LIMPO/4-150-
A5D6I0_9CHEL/7-153-
B0KZJ4_ACASI/7-153-
A5D6I3_9CRUS/7-153-
Q17H75_AEDAE/7-153-
A8DKY0_9BILA/7-153-
B3W666_SCHJA/7-153-
TPM_ECHMU/7-153-
B5AF35_MIZYE/7-153-
B7XC63_TURCO/7-146-
TPM_MYTGA/7-153-
B7XC66_CRAGI/7-153-
C1BRY8_9MAXI/7-153-
C4JZW7_UNCRE/11-153-
A1CDA8_ASPCL/16-158-
A6R7T4_AJECN/7-149-
A6S0T0_BOTFB/7-149-
B2B5X9_PODAN/7-149-
B2VZI7_PYRTR/7-149-
B6HMN3_PENCW/7-149-
C5FYF1_ARTOC/7-149-
B6K811_SCHJY/7-149-
TPM_SCHPO/7-149-
A3LSG6_PICST/7-149-
C4R6W6_PICPG/7-149-
Q6C081_YARLI/7-149-
A6ZVD7_YEAS7/7-149-
Q6FKV5_CANGA/7-149-
A7TEE8_VANPO/7-149-
C5DUA1_ZYGRC/7-149-
B4UN77_KLULA/7-149-
C5DMG5_LACTC/7-149-
A6ZS01_YEAS7/7-152-
Q6FPA3_CANGA/7-152-
A8PRF4_MALGO/7-149-
B0CUA0_LACBS/10-152-
Q5KF76_CRYNJ/10-149-
Q4P5V6_USTMA/7-149-

PF00261

Q294A9_DROPS/48-284Y
TPM2_HUMAN/48-284L
TPM3_HUMAN/48-284I
Q7PKX8_ANOGA/48-284Y
Q6PPH7_HOMVI/48-284Y
Q17H78_AEDAE/17-253Y
Q1HPP7_BOMMO/16-252M
TPM1_DROME/102-338K
Q6NN28_DROME/48-284K
TPM_MYTGA/48-284Y
A1KYZ4_AEQIR/48-284Y
TPM1_BIOGL/48-284Y
TPM_HALRU/48-284Y
Q2V0V3_SEPLE/48-284Y
A7UMC0_SINCO/48-284M
TPM_ECHMU/48-284F
TPM_CLOSI/48-284Y
Q5DHF2_SCHJA/48-284N
Q5VU70_HUMAN/6-242I
Q91XN7_RAT/12-248I
Q05705_CHICK/12-248L
Q6PA57_XENLA/9-245L
Q91864_XENLA/12-248M
Q4SWD9_TETNG/12-248L
A6QR15_BOVIN/48-284I
Q5RBC9_PONAB/48-284M
Q805C4_TAKRU/12-248L
Q7SZ31_XENLA/48-284L
Q5BKL2_XENTR/48-284M
TPM1_CIOIN/48-284L
Q676A8_OIKDI/48-282A
TPM_BRABE/48-284M
Q0ZDM4_SACKO/48-284M
Q0ZDM0_NEMVE/9-245N
TPM2_PODCA/12-244V
A7SC63_NEMVE/12-247Q
Q0ZDL8_NEMVE/3-232V
Q6S5G5_NEMVE/6-242M
Q86DU9_SCHJA/13-211S
TPM_CAEBR/20-256S
TPM_DERPT/48-284Y
TPM_CHIOP/48-284F
TPM_TRIPS/48-284Y

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window