Sequence alignment for CL0455

PF08294

TIM21_YARLI/99-246KIGVFFQLSWYLGIILAALGLFGLVWYYLIMELVMPSGDVRIFNRAFKEIEKNEDVMRVL........G--GQLSSMGEG
TIM21_YEAST/67-219QVKSASTFTFSGILVIGAVGISAIVIYLILSELFSPSGDTQLFNRAVSMVEKNKDIRSLLQCDDGITGK--ERLKAYGEL
A8WJK3_CAEBR/79-219KVAEKASNTFMYTAVVAGVGLIGAFIYVLAGEFFAQDSPQTIFNKALALVREDGRCQDIF........G--ASIAGFGEE
Q9VMR0_DROME/68-209KIKENTKTASYTAIIIAGLGVTCVMFFAIFRELFSSESPNNIYADALRRVVEDPRVQDAI........G--APIKGFGET
Q7PPN0_ANOGA/66-207RVKENTKTASYMGVILLGVGVTGMLFYVIFWELFSSDSPNNIYSEALERVKEEPRVKDAL........G--APIKGYGEE
TIM21_ASHGO/63-215KVRAAATFSASGMLVLGAAGVAGIVLYLILSELFSPSGDTQIFNRAVSTVEGDAVARSLLQCEDGVHRS--ERLKAYGDS
TIM21_RAT/99-241KVKEAGRDVTYLIVVLFGVSITGSLLYTIFKELFSSSSPNIIYGKALGKCRTHPEVISVF........G--EPVKGYGEM
TIM21_NEUCR/82-229KAGRAVQQTFNFGLVILGVVLTGGIAYLLFTDVFSPESKTAYFNRAVDRIRADPRCVALL....SPGDP--KKIAAHGEE
TIM21_KLULA/63-215RIRAFTTFTFSGILVIGATGLAGVVIYLIGAELFSPSGDTQIFNRAVSKVENDEVARRLLKCNDTETST--ERLKAYGEI
TIM21_DEBHA/100-247RIGRAFTFSLSSVIVLGATCISVLVVYLILSELFLPSGDTRTFNKAVRMLESNELAHEAL....GFKKG--QRVKAHGEQ
TIM21_CANGA/43-195KLKALTSFTASSLLVVGGVGVSGVVLYLILSELFSPSGDTMLFNRAVTLVEDNEEVRKLLQCNDSSFKK--ERLKAYGEL
TIM21_SCHPO/62-200KAYRTSANIGNFSIVIFGGGVFGLIIYALVTSIW..KGEAHYGDEAFELLKANEECRYVF........G--DHMKALGEA
TIM21_XENLA/88-232KVKEAGRDFTYFIVVLIGIGVTGGLFYVVFEELFSSSSPSKIYGEALEKCRSHPEVIGAF........G--EPIKGYGET

PF08695

A6ZVB9_YEAS7/74-190---------IAGF.LLFSVAIGSALSLIFNYEKTESP----IISNTLYYIRRSPATKNIL--------G..ESIEFDGII
Q6FRQ5_CANGA/56-172---------IAAF.AAFSLATGSALAVIFNYEKTESA----IVSNTMYYMRRSGQTIDAL--------G..ENIEFAGVI
A7TIU6_VANPO/63-179---------RIGF.AAFVIAVGSSLALIFNYEKTESP----IVVNTLYYLRRSPRTRELL--------G..DNIEFDGII
C5DSG2_ZYGRC/59-175---------RATF.AAFSIGVVAALAIIFNYEKTESP----IISNTFYHLRRSPRTRELL--------G..ENIEFDGLM
C5DH22_LACTC/58-174---------RVQL.GLFTVAICVALASIFNYEKTQSP----IISNSLYHLRRSQSIRDLM--------G..DNIDFDGLV
Q6CKG0_KLULA/56-172---------RLQF.VGFIVLMTSALAMIFNYEKTQSP----VISNTLYHMRRSPKIREVL--------G..DQIDFDGLV
Q753L3_ASHGO/60-176---------RATF.AVFATATTAALLLIFNYEKVQSP----VVTNTMYQMRRLGVVRELL--------G..DNLEFGGLL
C4R8T1_PICPG/70-186---------KIYF.IAFVVVMGTSLFGIFNYEKVSSP----IMNSTMYFLRRSQVARDLI--------G..KEITFAGIF
A5E4N7_LODEL/92-211---------RKYF.VVFAIGMTLACLVIFNYEKSSSP----IINSVLYYLRRSTIGQDAL--------G..KDIDFASSW
B9WG77_CANDC/73-192---------RRYL.FVYAIGVTLSCIAIFNYEKTQSP----IITSSLYFLRRSQPSIELL--------G..KDIDYSSSW
C5M2M0_CANTT/69-189---------RRYF.VVYAIGMTVACAIIFNYEKTQSP----IITSTLYFLRRSQESIDLL--------G..KDIDFSSSW
A5DA30_PICGU/112-227---------RNYF.WTYGIGVTLACVIIFNYEKTRSP----IVNSTLYLLRMSDEVTSRL--------G..DNIDFKSSW
Q6BQQ4_DEBHA/62-180---------RRYF.LAYGLGVTLACAVIFNYEKTTSP----IINSVMYFLRRSQNAKQLL--------G..EDIGFKNSW
C4YAZ9_CLAL4/63-179---------KRYF.WVYAVGVTLSCALIFNYEKTRSP----IINSVLYCLRRSDVAKAEL--------G..PNIGFQSSW
A3LYN8_PICST/19-139---------RKYF.VSYAIGITLACAIIFNYEKTRSP----ITNSTLYFLRRSALAKEHL--------G..EGIDFRSSW
Q2GVS3_CHAGB/85-201---------SRTL.PLFAAALIIASISIFNYQKLSSP----VVGATLYALRTSEKARAHL--------G..DEIYFAQQI
Q873B2_NEUCS/64-180---------SRTF.PIFLGIVAATSIAIFNYQKLSSP----VVESTLYALRTNQRAREYL--------G..DEIYFKAQI
B2B1D6_PODAN/65-181---------MKTL.PLFALCVGVASVAIFNYQKFSSP----VVGATLYALRTSDVGREHL--------G..DNIYFAQQI
C1GD42_PARBD/56-172---------LRTL.PFFAVIIGASILGILNYQKSSSS----VVNSMLYALRTSPKGRELL--------G..DEIYFAQNI
C5FF83_ARTOC/60-176---------LRTI.PIFFAIIGISSLAIFNYQKSSSS----IVSSTLYALRHSPKARELL--------G..DEIYFAQQI
B6HF32_PENCW/58-174---------LYTL.PIFIIATGAGMLGIFNYQKSSSS----IVNSTLYALRTSPRAREIL--------G..DEIYFAQQI
B8LTQ5_TALSN/65-181---------VRTL.PIFAVLVGAAMFGIFNYQKSSSS----VVSSTLYALRTSKQAREIL--------G..DEIYFAHKI
Q0USG3_PHANO/90-206---------LKTF.PIFIIAMVITTGAFFNYQKQESS----VVTSTLYALRTNPGVRELL--------G..DEIYFASKY
Q6C280_YARLI/91-207---------WAGF.GLFVVIMTVSLAFSFNYEKMSSS----QVSSCMYTLRKSPLANEEL--------G..SGIRFASAY
COA1_SCHPO/125-240---------PILF.AAFCLLWGTCAVLAIQYGKQNSN----VTQVVMYRVQHSKEAQDLL--------G..SNIDFKYPF
Q55V66_CRYNB/125-246---------VIAL.GLLGLGWGLFILHATNSERLSSS----VLRQATFQLRNSKEVIALL--------G..ENVRLVEEW
Q4PHZ0_USTMA/5-132---------VVTV.GMALGSWAVFSLYATNTEKLSSS----ILKSVISQVKASPLVVDLL--------DTHEPIVLKPEL
B0DQ95_LACBS/77-198---------ISAL.TIAVLGWSGFMAYVTNQEKLSSS----VSRSILRAVREDPQLRQVL--------G..EVIRPQPEW
A8Q044_MALGO/36-157---------IAGG.ASLVALWYVLSAYFNNKERVGSS----VLRMVSQRVRSAPEVYELL--------G..EPVRIKRSM
Q16I65_AEDAE/13-130---------TATYIAIGGITAALLMKSKLEDRVRMQP----YYRESLKLLRAHPGAIQLL--------G..E..PIKEMG
B0S673_DANRE/11-128---------MTIFMTVVTGGGCATMYYLMQKNFAKSE----YYRQALEQLNSNSTAMASL--------G...APPLKIHN
Q3T081_BOVIN/8-124---------QVFFAGVAASGSCAILYYLVQKTFSRAS----YYQLALEQLHSHPEALEAL--------G..T..PLNVHY
Q7UH60_RHOBA/80-194---------GCLIAVMVCGGVIATGVVGAFALIKSSE----PYTESLARAQTNEELQSMI--------G..D..PVDASI
Q484Y8_COLP3/91-201---------GLIL.....LFVVFPLFFTLIGSMLKGE----AFDQSMVSISQNTEVIEVV--------G..E..PIEAGY
A4BHQ1_9GAMM/4-95---------ITLL.....................KGE----PYELSLQYIKENTQVAEMI--------G..Q..SIEPGW
A3WN37_9GAMM/95-207---------GFIF.TGIIVVFCVISVFGINALFKNSD----AYKVSFAQVSDSKEVQSRI--------G..S..PLDSGF
Q1JWU1_DESAC/91-202---------GLLL....VCVGLPALILSISMGMKSSD----AYTMSLAQLQHNQRVIKLL--------G..E..PVEAGF
Q1IH80_KORVE/30-145---------LVISIVLFFVLAVVVFVVGIFVLVSNTE----PEKLAFAKAANSPAVVERL--------G..Q..PIKKGM
B0RXY3_XANCB/35-147---------LLLI..VVLAVSIGALVAGIARVMKSTE----PYRVGVLTAQHDPRVATVL--------G..A..PIEDGF
B8HQS1_CYAP4/92-206---------AISF.PLMVISIGASIFFLVMNFISSSA----PYEMAVNQVKNNPLVFEQF--------G..K..PIAIGW
Q09C66_STIAD/31-140---------PVLM....CGCLGAFVAYFVTSTIKSTD----AYQQAVALVTANPEVQEAL--------G..T..PIDFGW
A5US50_ROSS1/18-133---------GVTF..IVVVGCVVGIFAGVISLFRNSD----VAQEALARAQRDPQVEAAL--------G..R..PLEIGW
A7NPN6_ROSCS/16-127---------ALLF..VLIGACVGGVFFVVIRSIRDSD----VVQEALVRAERDPQVAAAL--------G..A..PLEAGW

PF08294

TIM21_YARLI/99-246GG.GRWGRNQPPVSKRGIDKYGREHIW-MNFYVSG..DI---N-EGRAKLELVQNTDSKLSSERFVYRYFVVD---IPGH
TIM21_YEAST/67-219ITNDKWTRNRPIVSTKKLDKEGRTHHY-MRFHVES..KK---K-IALVHLEAKESKQN..YQPDFINMY..VD---VPGE
A8WJK3_CAEBR/79-219TSRGR....RRHVAHHKYEKDGMQRIR-VLFHVKG..DR---D-EGIAQAEMEQRD....GDWEWRFLYVENK---RRPK
Q9VMR0_DROME/68-209SRRGR....RQHVAHSSYERNGKPHMR-MQFYVQG..LR---N-KATVQLESRRSDS...GKLEYRYLFVQLD---HYPR
Q7PPN0_ANOGA/66-207TRRGR....RTRVAHTQYVKDGVEHIR-MQFHVQG..FR---N-RGTVHLEKRKTDA...GGYEYRYLFVQLD---YNPH
TIM21_ASHGO/63-215VGDDRWTRNRPISSTRRLDASGREHYY-MRFHVET..GR---R-RGVVSLEAQQSDDS..YQPEFVRMY..LD---VPGE
TIM21_RAT/99-241SRRGR....RQHVSFTEYANNGLKRIR-VKFYIEGSEPG---K-QGTVHAEVEENPRS..GQFDFRYIFV..D---VAPK
TIM21_NEUCR/82-229TH.NKWRRARPIAATVEKDNRGVEHLK-MHFHVEG..PR---G-SGVVGLHLTKQPGH..WEHEYQTFY..VD---VRGH
TIM21_KLULA/63-215LTDDRWTRNRPISSTRRIDKEGKEHYL-MRFHVES..KQ---K-MGIVHVEAKESDVN..YQPDFVSMY..LD---IPGE
TIM21_DEBHA/100-247HA.DKWARNRPAQSVRTRGADGKDYLF-MKFQVES.PSG---K-YGTVTLEQVDRTF...WSSEFLYIA..LD---MPGN
TIM21_CANGA/43-195VTNDRWTRNRPIVSTQKIDKYGKCHHF-MRFHLES..KK---K-LGLVHVEAVDSEQN..YKPNFVSMY..ID---IPGE
TIM21_SCHPO/62-200THPLR..RTHGILTSRVWDHHGVEHLV-LQFHLIG..NE---R-KGHVFGRLVNVQ....GDYKWEYLF..VD---VANY
TIM21_XENLA/88-232TRRGR....RQHVSHMEFVKDGIKCMR-LKFYIEGSEPR---K-QGTVHIEVKENPAS..GKYEFQYIFVEID---TYPR

PF08695

A6ZVB9_YEAS7/74-190.....----PWVYGELNSV...KGRIN.ITFYIKG--DK...NVTGTVRLVADRNTHD--EEFLIHEWSVTAA.....GQ
Q6FRQ5_CANGA/56-172.....----PWVWGELNPV...AGKIN.ITFSVKG--KK...GVTGIVKLVADRENRR--EEFRIHEWSLTVP.....DK
A7TIU6_VANPO/63-179.....----PWVYGELNQV...AGNVN.IKFHIKG--SN...NVSGTVKLIADRKNRE--EEFLIHQWTLTVG.....DK
C5DSG2_ZYGRC/59-175.....----PWVHGELNQV...AGKVN.IRFNIRG--SK...GTKAVVRLVANKDNEF--KEFLIREWSLTAD.....DE
C5DH22_LACTC/58-174.....----PWVYGDLNQV...AGRVN.ISFYIKG--TK...DVQGMVKLVANRENKN--QEFLIHEWSIKVG.....DK
Q6CKG0_KLULA/56-172.....----PWVSGELNQV...AGNVN.IKFYLKG--SK...GKVGEVRLVADRENQH--QEFFIHEWSVKVD.....DK
Q753L3_ASHGO/60-176.....----GWVHGELNQV...AGRVN.VRFTLKG--SK...GVPGEVRLVADRENRQ--QQFLIREWTVTID.....GK
C4R8T1_PICPG/70-186.....----PWVKGPLNTM...KGDIN.FTVNVSG--DK...S.EGVMRLVANRDSRH--HAFEIRDWTLTMQ....DGT
A5E4N7_LODEL/92-211.....----PWIWGTLNTV...QGKID.IKFKVKG--FE...R.SGYLVLKAERESKR--HPFEVEKFVLEVDTKDS.KV
B9WG77_CANDC/73-192.....----PWIWGKLNTV...QGIIN.IEFSVKG--SK...G.NGVVKLNATRESKA--HPFDVHQFVLEVE.RDGKKE
C5M2M0_CANTT/69-189.....----PWISGQLNTV...QGKID.IKFNVKG--SL...G.TGVVKLRATRESKL--HPFDIHMFSLEVDGKDGSKK
A5DA30_PICGU/112-227.....----PWISGTLNTV...SGDID.IEFAVKG--SI...R.DGMLKLRASRTSKT--QPFDVHEFTLTVD.....GE
Q6BQQ4_DEBHA/62-180.....----PWIWGTLNTV...RGDID.IEFAVQG--SQ...N.TGKLKLKATRESKL--HPFDIHHWILQIN..DAQKT
C4YAZ9_CLAL4/63-179.....----PWIWGPLNTV...RGDID.VVFGVRG--DS...G.AGKLRLKASRTSKL--VPFDVHHFTLETA....DGT
A3LYN8_PICST/19-139.....----PWISGPLNTV...KGDID.ISFVVQG--SK...S.KGVLKLKASRDTKL--HPFEVHHFILEVTDSNGQAV
Q2GVS3_CHAGB/85-201.....----PWISGEMNQL...HGRID.ITFRVKG--TR...G.GGVMRFTSFRPSPR--GMFETTEWSLETD....DGV
Q873B2_NEUCS/64-180.....----PWISGEMNQL...HGRID.IKFNVKG--TK...R.TGVMRFASFRPTPR--GMFETTEWSLETE....DGK
B2B1D6_PODAN/65-181.....----PWISGTLNQV...QGRID.ITFRVKG--TK...G.EGVMRFASFRPSPR--GVFETTEWSLEMD....GGK
C1GD42_PARBD/56-172.....----PWISGEINQL...HGRID.ISFWVKG--TR...G.KGKMRFRSRRDRRM--SFFQTEEWSLTLE....DGT
C5FF83_ARTOC/60-176.....----PWISGEMNQL...HGRID.ISFWVKG--TR...G.KGKMRFKSTRESRL--GRFNTEVWSLEME....DGT
B6HF32_PENCW/58-174.....----PWISGEMNQL...HGRID.ISFWVKG--TK...S.QGKMKFRSIRPDRM--SYFRTEEWSLETE....DGT
B8LTQ5_TALSN/65-181.....----PWISGTMDQL...HGKID.ISYWVKG--TR...S.QGKMRFKSVRPDRM--SYFRTEEWSLETE....DGK
Q0USG3_PHANO/90-206.....----PWIKGEINQV...HGRID.IRFWVKG--TK...R.QGEVRLRCRRRGRG--GLYATQEWSLTMD....DGE
Q6C280_YARLI/91-207.....----TWVSGTIRPL...VGKVD.FSFPVKG--NK...A.EAIMHFNSRRASGR--EKFRVLEWSLTFP....DGR
COA1_SCHPO/125-240.....----PWVPGKLHKR...QGFID.INFEVSG--SL...A.SGTVHYQSQRFGPI--AHWVELDCTLTSN.....GK
Q55V66_CRYNB/125-246WALGA----PWISGTINLM...QGRVD.LSFRIRG--SK...G.AGTVYFTSIRPQEQ--GAWRIVRYKVIAD....DGQ
Q4PHZ0_USTMA/5-132WLANK----PHIQGSVNMM...QGRID.LAFKIHP--RNNHTN.TATVYFTSIRPHKH--APFHILRFLVIHN...HSAK
B0DQ95_LACBS/77-198WLNGD----PWISGHINQL...QGNID.VSFRIRG--SR...S.SGTIYFTSIRKEKG--VPFTVLRFKVICD....DGT
A8Q044_MALGO/36-157..FGD----PWIEGIINPL...KGKVD.MSFEVVG--PR...G.VGTVYFTSVRKHKT--DPFELLRFLVVPH.....GD
Q16I65_AEDAE/13-130.....----F.DFGEESKK.YGEGKIEDFTLPVKG--TQ...Q.RGKLHFWAERKDDQ--..WHITRAELELN..KDADR
B0S673_DANRE/11-128.....----IHLSDRHNRI..DHSSAQ.LKIPVTG--SK...T.GGYLYTTSTRDSLT--NRWHLQQVVLKLR....KGD
Q3T081_BOVIN/8-124.....----LRLTDKYNFV..DIADAK.LKIPVSG--PK...S.EGHLYVSSSRDAPF--KRWNLQEVFLELK....DGQ
Q7UH60_RHOBA/80-194.....----F.VQGSIKLN.NDDGNTD.LNYSVSG--PN...G.AATVHVTGTKLDGN--..WDYSRMDATTE....DGT
Q484Y8_COLP3/91-201.....----F.VMGSIQTS.GAKGEAS.LQYSISG--PK...G.EADVYVLAYKEMEA--..WSLHNVIVHIP...ETDK
A4BHQ1_9GAMM/4-95.....----P.VLGSITNS.GTAGHSD.IYYAIRG--DV...S.KATVHVKASKHLNE--..WQLDEVIVTPT...DGQ.
A3WN37_9GAMM/95-207.....----..IIGSITTS.GPDGTAS.LAYPVEG--PK...G.EAKVALYASKKLNK--..WTLECLVVNYK...SVEE
Q1JWU1_DESAC/91-202.....----F.VSGNISVS.TAGGQAS.LGYSVSG--PK...G.EATAYVYAVKELGV--..WKLIELGVYSE...ALQR
Q1IH80_KORVE/30-145.....----F.SSGSINTT.GPSGHAE.LKVPISG--PK...G.EGYIYLTANKSADR--..WTFTQLEVAID...GDEK
B0RXY3_XANCB/35-147.....----L.PSGNIATS.GGGGHAT.LSVSLHG--AR...G.NGTLYIEAERHAGQ--..WHYTSVQVVPD....VGD
B8HQS1_CYAP4/92-206.....----I.TTGNIETS.NDRGLAC.LQIPVSG--SK...A.SGVIYVDAVRQDGE--..WKFRQLFVTNE...QTNQ
Q09C66_STIAD/31-140.....----..PRGSVNTT.NGEGRAS.ISVPLEG--PK...A.SGTMRVEALAEGET--..WTLDLLQVEVP....GRP
A5US50_ROSS1/18-133.....----FLPTGSLRTDANGGGEVD.LTLPISG--PR...G.SGTLIISGVRTRGV--..WEYDRLIVTVD...GTGQ
A7NPN6_ROSCS/16-127.....----F.PMGSISTG.DGSGNAN.LTLSVAG--PR...G.SGEMMIEAVHREGV--..WQYRRLIVTVG.....GR

PF08294

TIM21_YARLI/99-246KRIYIAGNA
TIM21_YEAST/67-219KRYYLIKPK
A8WJK3_CAEBR/79-219TTHVLIDNR
Q9VMR0_DROME/68-209TTIILEDNR
Q7PPN0_ANOGA/66-207SPIILEDNR
TIM21_ASHGO/63-215KRHYLIRPE
TIM21_RAT/99-241RSIVVEDNR
TIM21_NEUCR/82-229QRIYLENKE
TIM21_KLULA/63-215KRHYLIKPK
TIM21_DEBHA/100-247KRIYIKEPK
TIM21_CANGA/43-195KRFYIIRPK
TIM21_SCHPO/62-200GKIIIFDHT
TIM21_XENLA/88-232RTIIIEDNR

PF08695

A6ZVB9_YEAS7/74-190K...IDLLA
Q6FRQ5_CANGA/56-172K...IDLLA
A7TIU6_VANPO/63-179Q...IDLLS
C5DSG2_ZYGRC/59-175Q...IDLLE
C5DH22_LACTC/58-174K...IDLLA
Q6CKG0_KLULA/56-172K...YDLLE
Q753L3_ASHGO/60-176T...VDLLA
C4R8T1_PICPG/70-186V...VDLTK
A5E4N7_LODEL/92-211E...YDLMT
B9WG77_CANDC/73-192V...VDLTK
C5M2M0_CANTT/69-189V...VDLTK
A5DA30_PICGU/112-227V...LDLKQ
Q6BQQ4_DEBHA/62-180Q...INLLE
C4YAZ9_CLAL4/63-179V...LDLMK
A3LYN8_PICST/19-139E...YDLTK
Q2GVS3_CHAGB/85-201V...IDLLE
Q873B2_NEUCS/64-180V...IDLLE
B2B1D6_PODAN/65-181K...IDLLD
C1GD42_PARBD/56-172V...VQLLD
C5FF83_ARTOC/60-176A...VPLLN
B6HF32_PENCW/58-174V...VQLLD
B8LTQ5_TALSN/65-181V...IQLLE
Q0USG3_PHANO/90-206R...VELYD
Q6C280_YARLI/91-207V...VNLAD
COA1_SCHPO/125-240T...IKIPT
Q55V66_CRYNB/125-246V...IRLED
Q4PHZ0_USTMA/5-132S...VNLLD
B0DQ95_LACBS/77-198I...VHISD
A8Q044_MALGO/36-157TSRAISLLS
Q16I65_AEDAE/13-130R...LVIRK
B0S673_DANRE/11-128T...VEIFN
Q3T081_BOVIN/8-124Q...IPLFK
Q7UH60_RHOBA/80-194K...IDLLD
Q484Y8_COLP3/91-201K...IQIVT
A4BHQ1_9GAMM/4-95.....AMVQ
A3WN37_9GAMM/95-207Q....TIIV
Q1JWU1_DESAC/91-202R...IILIV
Q1IH80_KORVE/30-145R...IELVE
B0RXY3_XANCB/35-147T...IALLD
B8HQS1_CYAP4/92-206P...ILLFM
Q09C66_STIAD/31-140A...IDLLD
A5US50_ROSS1/18-133R...IDLLR
A7NPN6_ROSCS/16-127Q...IDVLR

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window