Sequence alignment for CL0471

PF04015

B0TDY0_HELMI/37-243------RVALKPNLVM....GKD.PAA.......AVTTHPALVE.AVAKTV.I.ALGA..T..PFIVDSPGGPS..ANAA
C0QEP7_DESAH/76-276------TVVIKPNIGW....NRP.PES.......GANTNPELIQ.RIVAHC.V.DAGA..KK.VHVFDHSVEN.......
A8ZT10_DESOH/36-245------KVFLKPNIVFW.SKAVAFPKW.......GVITTSRVIE.DMVVLL.K.ERGI..DD.ITIGEGIVCDP..KDKE
A0L9G6_MAGSM/100-298------SVLLKPNVGW....DRF.PEQ.......AANTRPELVG.ALVRLC.Q.QAGA..AQ.VYVSDLSLND.......
A9GM32_SORC5/179-435------PVLLKPNICGFDSVKDP.AKSKGDDGVTGRITQPEFVR.GVVQCL.K.ARGH..TK.ITIAEGCGHS.....HK
B8FNM3_DESAA/41-250------RVALKPNLLV....PAP.PEK.......AVITHHEFFR.AAARIV.K.EYGG..D..PVLIESPSIH.......
B7JVX7_CYAP8/40-240------RVLLKPNLLT....ASR.PTK.......ECITRPEIVY.CVAQLV.Q.EIGG..K..PFFGDSPAFG.......
A8ZYA7_DESOH/40-246------TVLFKPNLLM....RIR...........NACTEADFLA.AVARFI.RPLNAN.....LKAGDSPGQF.....RH
C4XMM3_DESMR/82-287------QVLVKPNLVE....PHA.GAG.......HINVHPLMVR.AVAEAF.L.ALGA..GS.VVVGEGAGHR......R
D6SMM9_9DELT/85-285------KVVIKPNMSF....AHT.PDR.......ATNTHPRVVR.TLAEMC.V.EAGA..SR.VMVLDNTLQS.......
B8FHF3_DESAA/36-244------KVFVKPNVVF....AFR.SEIF....GGNAFTAPPFVG.ACLSTL.AGAPGV..DR.VDMGENCAVG......M
O26866_METTH/40-238------RVLLKPNMLM....AAS.PER.......HVTTHPSVIE.AVAEVF.L.DLGA..E..VSIGDSPGGS.....FR
B0PEP7_9FIRM/37-245------RVVIKPNLIM....RCG.PER.......AATTHPAIVE.AVVRQL.Q.AMGV..RD.ITIADSPGGLY...TPQ
D6SUD8_9DELT/43-249------LIWIKPNLVN....DSP.F.........PVTSDPEMIR.AVVEYV.R.ENSR..AR.IIIAEGCGDS.....GM
A9KHQ5_CLOPH/41-245------VVVITPNWVS....PAS.PCS.......GRVVGPESLR.TIIRLV.K.SCKP..KR.IVVATGPGDE.......
A3CX66_METMJ/37-246------AVAIKANFNS....DDP.F.........PATTHPDMLE.AILARV.R.DAGA..RS.IALGERSGMG.......
A0LHW9_SYNFM/98-298------KVLIKVNAAF....ATA.PAL.......SATTDPRLLS.EVVRLC.L.KAGA..SE.VAVTDNPIND.......
A4J439_DESRM/41-245------TVVITPNWVN....TRA.PQT.......GTVVGPETLR.ELIKFIKGQNPGR.....LVVACGSGGA.......
C0QYI7_BRAHW/40-241------KVLLKPNFLA....AET.AEK.......SVTTHPVVFE.AIVSIL.Q.EKTK..N..ISYGDSPGIG.......
Q6AMI6_DESPS/59-257------RVLLKPNLVS....ARG.PS........WACTNALFIR.AVALWF.L.EQGA..H..VALGDSPAFG.......
A6NZP8_9FIRM/42-251------TLALKANLLE....SIA.PDR.......AVTTHPSVVA.AVATQT.A.KAGA..K..AVILDSPGGGHWQNSPA
B5YC98_DICT6/95-296------TVLIKPNVNS....NDP.Y.........PGTTNPEVLA.EVIEMV.K.EKGA..KR.IIVADSSGIP.....WP
B4VLW5_9CYAN/97-306------TVFLKPNYNT....GDP.A.........PAATDTQLLE.ALVQEL.Q.TAGS..QG.ITIGDRSGMA.......
A8ZSZ4_DESOH/71-273------RVVIKPNIGW....DRT.PEQ.......GANTHPLVVR.TLVELA.L.GAGA..AS.VSVFDRTCNE.......
B8FL32_DESAA/68-268------KVVVKPNIGW....DTP.VER.......AANTHPELVS.RIIKHC.L.DAGA..KE.VVVFDHTCDQ.......
Q1Q6F8_9BACT/43-245------KVLLKPNFLK....ESN.YGD.......CTVTHPLVIE.GIAEKL.L.EFGA..T..PIIGDSPAFG.......
B5EFB1_GEOBB/63-262------TVVVKPNIGW....DRT.PEF.......AATTNPAVVK.ALVEEC.L.KAGA..KK.VKVFDRTCND.......
B8F9A9_DESAA/40-249------RVALKPNLLM....PSH.PDK.......CVVTHPVFFR.AVASIV.K.DYGG..H..PVLIENPNFF.......
A3CSE9_METMJ/46-253------SVLLKPNLLQ....GQA.PER.......CVTTHPEVVA.AVARLL.V.EHGC..R..VVIGDSPGAGIV.YSEA
C0CH74_9FIRM/37-232------LVGIKPNLVS....PSE.ASY.......GATTHPEIVA.GILEYL.Q.ENGF..QR.MVILEGSWVG......D
A8F5L0_THELT/34-232------RVLVKPNLLS....ARE.PNE.......GVTTHPEVLK.TILKFL.I.SLET..R..PFVGDSPASG.......
Q1Q0G5_9BACT/40-248------KVLLKLNLLS....SSQTPER.......AVNTHPAVVR.ALVDIFQK.DFGC..E..VYIGDSSGSV....KNS
B0VJW9_CLOAI/40-242------RVLIKPNALG....AYP.PER.......AVTTHPIVLE.AIIRYF.L.DRKK..E..IWFGDSPGNS......V
Q02C16_SOLUE/87-301------YAIIKPNFVN....TVN.Q.........LAASHADTMR.GILDYLGERFKGP.....VVIAESSAGN.....TL
C0BXI3_9CLOT/112-328------KVAVKLSTGE....PPA...........SNYLRPELIR.DLVQLVDG..........TIVECNTAYGGSRAATA
A8ZTZ9_DESOH/31-237------RIIIKPNAVG....ADPGMPY......YGMMTTATVVE.GIVRAL.L.DFGCRPEN.ITIGDGGAVRR..ELGL
Q3A1K2_PELCD/35-241------CILIKPNLVN....ASP.P.........PVTLPVAACE.ALVAAC.R.RWSK..AR.IVIAEGSGDR.....DL
B8J2N6_DESDA/65-275------RVLVKPNLLM....GKP...........LACTSPGVVA.AACRWL.R.DHGA..Q..MAVADSPGFG.......
B1H0P1_UNCTG/40-246------KILIKPNLLS....PKD.PSK.......AITTHPEIVR.VVIKLV.K.EAGA..V..PAVGDSPGGA.....IR
Q01ZF9_SOLUE/69-328------TVAIKINLTG....APT.YRIGHLPLEDTHYTNQHVIA.ATVHLM.G.KAGA..RR.IRLLESPWST.....AD
B2A581_NATTJ/44-252------KVLLKVNLLS....PKE.PEQ.......AVTTHPQLVK.VICELV.K.ELGA..N..PIVGDSSGGMT..SKGS
C4XT04_DESMR/38-236------TALVKPNLVA....PRN.PA........LSCSHPAVVR.AVCLAL.V.EGGA..R..VVVADSPAFG.......
B1I1Q6_DESAP/33-238------RIVIKPNLVL....PEP.P.........PVTTNVACVE.AVARFC.L.ERSP..AE.VVVAEGSGGT.......
B1C5P9_9FIRM/37-254------MVVIKPNVLC....AQD.HET.......GATTSPVLVK.AVADMC.L.NAGA..EK.VIVAESSNWG......I
C7LRB8_DESBD/73-273------RVVVKPNIGW....DVT.PER.......GGNTNPALVK.RIVEHC.L.QAGA..RD.VSVFDHTCDP.......
D4H7U4_DENA2/37-236------RILIKPNLLS....ASI.PEK.......AVTTHPDFVR.TVIRIL.R.EYTE..AE.LWLGDSPGAN.....FG
A7AFK1_9PORP/72-273------KVVIKPNIGW....DRT.PEL.......AGNTNPELIK.ALVKKC.F.EAGA..EK.VTVFDHTCDN.......
C8X3C8_DESRD/68-268------RVVIKPNMSF....DNP.PEM.......ATTTHPAVVS.TLVALC.Q.EAGA..DT.VMVRDHTLRG.......
Q2LY82_SYNAS/69-267------VVVVKPNIGW....DRT.PEY.......AANTNPEVVG.AVVRLC.F.EAGA..KQ.VKVFDRPVND.......
B1C978_9FIRM/40-242------KILIKPNLLK....PRS.PEY.......AVTTHPSVFE.AMVKILKENDYKN.....ISYGDSPGKG.......
C8X2E5_DESRD/38-236------KVLIKPNLVA....ARHTP.........LACTHPAVVR.EVGRYF.R.QAGC..R..VTVGDSPAFG.......
Q64AT3_9ARCH/48-256------RVLLKPNAGR....IAT.PES.......GITTNPQVVA.AAIDRF.R.EAGA..T..VAVGESPIIG......V
Q3A9J0_CARHZ/39-240------RVLIKPNMLE....GLP.PER.......AVTTHPEVVR.AVVRMV.K.KAGA..I..PLVGDSPGTG.......
A8ZU87_DESOH/51-252------NVLVKPNILS....GYA.PEK.......AVTTHPVLVS.AVVEKL.R.GAGA..R..VMVGDNPGLH....GYG
Q3A6X8_PELCD/41-242------KVLIKPNMLA....GKS.HDK.......AVTTHPEVVR.AVIRMV.Q.EAGG..S..VSVGDSPGVG.......
Q02CN1_SOLUE/65-329------TVTIKVNMTG....APS.QRFKGMALGLTHYTHPKVVG.ATAYLL.G.RAGA..KR.IRFVESPWAT.....AA
C0GJS2_9FIRM/39-238------KVLVKPNLLV....GAP.PQN.......AVCTHPEVVR.SVLQNL...SAKQ.....VQVGDSPGFG.......
D1C824_SPHTD/94-288------RVLIKPDAAS....GIP.A.........PASTSPGALE.AIIQLV.Q.DHGA..RE.VIVGEMAGPP.....WH
C4XGU5_DESMR/56-256------VVLLKVNAAF....ASP.AIL.......GATTHPDLLA.AAVEAC.R.AAGA..AR.VVVTDNPINS.......
C4XGL5_DESMR/50-253------SVFLKPNLVR....PNPASPR.......SVVTDERVIL.AMVRLL.V.RAGA..RS.VAVGDNPGWG.....LS
B2UQQ8_AKKM8/51-249------TVVIKPNIGW....NKA.PEF.......GANTHPETVA.TLVELC.R.KAGA..KE.VRVFDHCCHN.......
Q8TQV4_METAC/37-242------TVLIRPNANT....ADP.A.........PGSTNPEVLR.GAIREVKKYNPGK.....IIVAEKSMSS......L
A6DH41_9BACT/37-240------SILLKPNFVM....PSP.VGD.......SSCTQPNFYM.AIAQIF.L.DKGF..K..VGIGESPAFG.......
B8FLE0_DESAA/47-254------KVLIKPNLVN....SSP.F.........PVTTRPECCA.AVVDFV.R.SCSN..AS.IVIAEGCGEP.....SM
A4XJ40_CALS8/35-230------KIAIKPNLVV....AKP.YTS.......GATTNPQIVE.GIIEYL.K.ENGH..DN.ITILEGAWLG......A
A5G4H9_GEOUR/41-249------RVLIKPNMMA....AHP.PDA.......HVCTHPEVVR.AVIRLV.K.EHGS..H..PLVGDSPAGLI...GKW
C4FC45_9ACTN/57-345------FVAIKIHFGE....LGN...........LSFLRPNYAR.AVADVV.K.ELGG..MP.FLTDCNTLYVGSRKNAL
D0LLI3_HALO1/243-443------IVVIKPNVAF....ERA.APL.......GATSSPEVVS.ALIRVV.R.EAGA..EE.VRVADNPIES.......
Q1NX93_9DELT/39-246------RIILKPNLVE....AAA.P.........PITTPVELVA.AVVEYL.RAACPR..AE.LIIGEGCGSK.....SY
B8D1J2_HALOH/38-243------KVLLKVNLLM....GKP.PDK.......AITTHPRVVK.AVGELV.K.QAGG..Q..VIIGDSPGGPF...TKN
B8FFA8_DESAA/37-237------KVFIKPNVVT....ANK.KYI......HNSFTHPQLTA.AMAEVIRKDQPES.....LVIGESGGFG......I
Q1Q6G1_9BACT/104-329------KISLKINLVATKDCLDL.PAG......DTYVTNPLVVK.ALGEVL.L.DLGA..GS.LFIVEGSTHP......S
A6UVE5_META3/35-239------KILIKPNVLG....PYP.PER.......NATTHPLFLEWVILYLLNN.EVDK..NK.IIVGDSSGYN.......
B0AB85_9FIRM/40-246------KVVIKPNLVI....KKH.PEE.......GATTHPVLVR.IVCEEL.L.KLNC..E..VIIAESPGGPY...NKS
C0D7U9_9CLOT/37-238------RVLVKPNMTG....PAS.YEK.......GVTTNPAVVE.ALARMA.L.ETGA..GA.VDIGDGTGSV.....HI
Q026Y6_SOLUE/54-259------KVLIKINTVI....PVP.ANA.......GFTTDPRMLE.ALIELV.Q.EQNP..GR.IQIGERC..A....MGA
A1ATM1_PELPD/98-298------RVLLKPNMLA....ARS.PEA.......AVTTHPALVR.IMAELV.R.STGA..S..VMVGDSPGID.......
B2A6N3_NATTJ/41-242------QVLIKPNLVA....VPP.EDF......RGAITHPLIVQ.KLSDIV.R.SLGG..Q..VIIGDSSAVG......V
B9MLY7_ANATD/37-241------CVLVKPNLLM....KKN.PED.......AVTTHPAVVQ.ATVEII.K.EKAS..K..IIIADSPGGPY...TKK
A9G6Q8_SORC5/40-243------RTLIKPNVVA....SGA.HFP.......HAYTRPEFVE.GVIGALKDRDDGR..VRELAVGERCGIT......L
A6TU65_ALKMQ/45-250------RVLLKLNLLM....KKK.PED.......ATTTHPMFTK.ALAEIL.I.NYGA..E..VIIGDSPGGPY...NIN
B8GJS8_METPE/36-236------MVFIKPNFTY....PFY.KE........GITTNPVVLK.EILAIL.KDRAGR.....VIVGESNGGN....HSF
C6C140_DESAD/43-240------KVLVKPNLVS....SKN.P.........LACTHPNVTL.SLCRYL.K.DCGA..Q..ITVADSPGYG.......
D2Z7N5_9BACT/38-240------SVLIKPNMLG....AYS.PDR.......AVTTHPAMVR.AVTEMT.L.DCGG..K..PTIADSPGIE.......
O28048_ARCFU/70-274------TVGLKANYNS....ADP.F.........PASTHPKTLS.AIVDVL.KEQKAE.....VFMAERSGMG.......
A9F071_SORC5/101-299------VVVVKPNIGW....DRT.PIH.......AANTNPKVVA.EVVRLA.Y.DAGA..KS.VIVTDASCNE.......
Q46CA4_METBF/38-243------SVLLKPNILA....AVS.PEN.......AVTTQPSVVA.SMCKFV.L.QARG..R..PVVGDGAGIS....RPG
D1N489_9BACT/73-273------KVVVKPNIGW....DKK.PEE.......AANTNPELVA.EIVRQA.L.AAGA..SE.VTVFDHTCNE.......
C8X0Z6_DESRD/32-238------NILIKPNLVN....ASP.P.........PVTTPVECCA.ALVALL.Q.NCTS..AS.ITIAEGSGAA.....NL
O28963_ARCFU/29-221------FRYIKPNFLK....HDS.PEN.......GCITHPELVK.AVVGVA.R.EHGV..EP.VVIEGGFYKN.......
C0GEG7_9FIRM/35-241------RVLLKPNLVMW.DRVYPFPKY.......GVLTTSVVME.GVVRAL.K.EYGC..TK.IAIGEGAIVDK..GLGS
Q0W4U5_UNCMA/31-238------TVLVKPNLSC....ARP.SGS.......GLVTNVEVVK.AVVEMV.A.ARGA..R..PIVGDLPILG......W
B5YEQ4_DICT6/36-227------TVLIKPNA......FIN.KEE......KGFISDPKVVL.SLAKLC.K.EQGA..KE.VYIGE............
Q0W7R4_UNCMA/39-237------RILIKPNYVN....NSD.PST.......GVTTDPRVVR.GIVEYL.L.EHGWSNSE.FAVGEGGMAS......F
D6SKE1_9DELT/40-241------LILVKPNILG....PHA.PEK.......AVTTHPMLVK.SVVRVL.E.KKGA..R..VIVGDNPGMG....GYG
B1ZNQ0_OPITP/79-285------RVALLINAPR....WWT.KP........GSFTSPEVSL.AVVKAC.A.DAGA..KEMVTIVDPPGGY.......
D6SMX5_9DELT/72-277------KVLIKPNFNT....ADP.A.........PGSTHNDTLS.TMIDEV.R.QRGA..RE.IIIGERSGPP.......
A3DEM5_CLOTH/40-242------KILLKPNLLS....ADP.PER.......CSTTHPSVFK.AVAEIF.M.EAGI..TN.LSYGDSPGIH.......
A5GCX4_GEOUR/71-274------RVLLKPNFNT....ADL.F.........PASTHNDTLV.QLIAEL.R.GMGA..KA.VTIGERSGPP.......
B0A6W7_9FIRM/42-247------KVIISPNGVK....DKK.PKD.......GVVSGPKTLK.KLIEYVKKREPSE.....IYIAFGSGGT.......
Q30WA5_DESDG/52-250------RVLVKPNLLR....AQ..PDG.......LCCTHPQVVR.AAVEYA.L.DCGA..V..VTVGDSPAFG.......
B8DIZ2_DESVM/89-288------KVVIKPNMSF....ASA.ASL.......GTNTHPEVVA.ALVRMC.R.DAGA..AS.VLVLDNPLAP.......
B5YB81_DICT6/37-240------RILIKPNLLM....ASS.PDK.......AITTHPVLIE.AIIEVL.K.EKEV..GE.IFIGDTPG.N....TST
Q3ABD0_CARHZ/32-236------KILIKPNLVSW.DFNLPFPPF.......GVVTTSAVMA.ALVRIL.K.EEGF..SR.LTIGEGSLMN....PRP
A1VA95_DESVV/57-259------RVLVKPNLLR....FQ..PGG.......LCCTHPEVVR.AACVWL.Q.ARGV..H..VTVGDSPAFG.......
B9Y9X4_9FIRM/42-245------SVLIKPNLLS....AKT.PEE.......FTTTHPEVLR.AVIRYVHQ.RGGS.....VTLADSPAGRF...TPD
B2A5X2_NATTJ/39-234------KIGLKPNLVL....PNS.SES.......GATTSPELVS.GIVEHF.L.SRGF..KK.LIIMESSWVG......A
Q20JY2_9BACT/38-245------RIILKPNLLA....AVK.PQK.......AATTHPSIIA.AVGRLV.K.QAGA..T..PVLIDSPGSGYP.HTAN
A0LEU5_SYNFM/65-266------KVLLKPNLLA....PAS.PEK.......AMLTHPLVVR.VAAEYV.L.EKGG..V..VQLSDSPAMG.......
A2SS29_METLZ/39-246------KVLLKPNLLS....DAG.IDR.......AITTHPEIVY.AVGKMI.I.EAGG..I..LTIADSPGAGII.YSPR
Q02D98_SOLUE/66-270------NILLKPNLVE....FEP.GT........CINTHPLVVH.AAYEAF.L.KMGA..AS.VRIAEGPGHR......R
B8GKV1_METPE/42-249------RVLIKLNLLS....SYD.PSA.......AVTTNPALVR.AVVEQV.Y.QIGA..I..PLVGDSPGGRN...TPA
B8FX06_DESHD/40-245------KVFLKVNLLM....KKR.PEE.......AVTTHPSVVE.AVVRLV.Q.EVGG..I..PIIGDSPGGPY...TVG
C0A4C5_9BACT/77-278------TVVIKPNIGW....DVV.PER.......SANTHPDIVC.RLVEMC.L.AAGA..SQ.VSVFDHTCDA.......
A7I744_METB6/37-246------GVALKANFNS....DDP.F.........PASTHIDMLR.GIADSI.L.NEGP..AH.LTLAERSGMG.......

PF09861

A6CEC2_9PLAN/11-206YGFN.GTFQCEIPSERLIHYHQA-PA.-------...GIDDVAA-RMKQVL-NSPLEL-----PPLDLAVVPG..DKITI
A1HP90_9FIRM/9-212FGDN..QIKVALPEEKIINVVEG-KQ.-------.VAPITDVPA-AVREAL-NNPIGS-----PPLKEVVKAG..DKVAI
Q38XJ2_LACSS/8-213YDQK..IITANIADANFAGKLVS-QAA-------TYQNPLSEAE-TVEQSL-DNPIDS-----PKLEELAKGK..KNIVI
Q8TR70_METAC/61-260FGSG..VFELNIPEKNISSLILP-SE.-------.PEKKEDGAL-LIRKAL-ENPINS-----KRLSEIVNPE..SRIAI
Q7MSU0_WOLSU/7-208YGKE.EKIHLEIADSQLIGVYEP-NS.-------..VEKIDYAK-AIDEAL-AKPLGK-----DSFDHFINTS..ERIVF
B8FVM0_DESHD/8-210YGHG..TQACLIPDDVDCVYGRL-KS.-------.VEPTAEAGE-QISAAL-QNLIGN-----INFDKLRNA...KSVAI
Q4A0S0_STAS1/7-207YGKS..NVEIDLPDHS..VLIEP-TD.-------.IDALDDDTN-AIRNAL-ADPIGT-----KPLNEMVSAN..QTVAI
A3ZLC3_9PLAN/7-211YGRN..GLVAEIPDNGNVRTLAY-KD.-------.APPLADPNA-SLRKVL-TQPHGT-----APLAELAQGK..QDACI
A4QGL8_CORGB/1-216MSQK..TITLPIPEGLAESAALL-GG.-------..PTEVLNDE-QARQFI-LDEVSK-----LDIDG.......KTVCM
A6TUJ7_ALKMQ/19-224YSKG..FVDLKVSDENLSAVLES-KAH-------HFKTTEDEVT-IVKKAL-ENPVNN-----SRLRDLAKGK..NKIVL
A0B768_METTP/5-193YGNS..SVRIKLQDGW..EVLRP-NE.-------.LPPAHDGE.-.IERAL-DSPIGA-----.GLEDLSG....RSAAV
A6TKP7_ALKMQ/8-211YGTG..STNVSIPAEHLLSIIKN-NP.-------.MNINGTEEE-IILNSL-EKPVGT-----PKLREIVHPG..EKICI
Q649M8_9ARCH/8-203YGSK..LIEIDIEGE.LLDPIDK-SV.-------...GKTKNRD-VIRHAL-QNPIGT-----KRLREIVKSKKDAEIVI
A6TUX2_ALKMQ/8-211YGRG..ELLCKINEKLILNTLLP-RV.-------.AAPIIDVKE-AVIRAI-ENPTAS-----ASLKNVIKKG..ETVVI
Q3AFZ6_CARHZ/7-206FGKE..KKQLSVKSENLLGVLVP-NQ.-------.VEVELTGKE-EVIRAL-NNPIDS-----PKLREIAKPG..EKIAI
A6LWC1_CLOB8/8-213YSTK..SLKINIDDKNLKGILVS-KAN-------TYKADISQND-IVNKAL-DNCIGS-----KSLEELVIGK..NNMVI
Q464W1_METBF/12-214FGSG..ILELDIPEKNISSIILP-SE.-------.LEIKEEGAS-LIKKAL-ENPIKS-----KRLSDIVNPD..SRIAI
Q8CQ57_STAES/7-207YGKS..EIEINVPDDS..TIIEP-QN.-------.IDAIQDYES-TIKNVL-RNPTNS-----KPLKEMVNSN..DIVSI
A7GC44_CLOBL/8-213YHKK..MIEIGIEDKNLVGILES-KAD-------EYKRNLSQEE-IVEAAL-DNPIQC-----EKLEDLVKGK..KNMVI
Q24SB3_DESHY/7-210YGTS..YLETTIPEERLAGILAL-ES.-------.YSPEKDGIS-LVQAAL-ANPIGS-----SALHELASSA..QKIVV
A7ZC16_CAMC1/7-208YGKD.DHINLKIDEKNLLGVFNP-NK.-------..VAKFDEAA-LIAKAL-ANPINQ-----KSFDEFIAGD..EKIVI
A6LSU3_CLOB8/8-211YGRD..KMRAFIEEENLLEIIES-ND.-------.FKKSKTEDE-IIAEAL-YNPIDS-----ERLKDIVHEG..EKVCI
A6TKS3_ALKMQ/8-211YGRK..EVLLGLPEKTLVQVLEG-KP.-------.NGHEKTEEA-IIVEAL-SNPMGT-----DRLQDIVKAG..QRVCL
Q24QM2_DESHY/9-209YGEG..YQSFLLNPQYVIQELHA-KA.-------.IQPVEDVVK-EIGRIL-DDPIAS-----APFNTLFKAG..DKVTI
Q12XD0_METBU/7-204YGNDFVDIDVTIPHE....VLSP-NE.-------..PEVGDELS-IILEAL-SNPVEK-----EPFVEFANNA..DKILV
Q39QL7_GEOMG/5-203YGDT..SFTLTLPPERLLGVIRP-EI.-------.GVPVDRPET-IIAAAL-D...RC-----AETIGTFRPG..ERVVI
A1HLY5_9FIRM/8-211FGKG..TLPVTLPDEKILAVIEG-RP.-------.VQPVGDVRA-AVQAAL-RRPIGA-----PPLAEVIKPG..DKVAI
A7H7M7_ANADF/33-231LGYG..ARPLPLPDVPGARVLLP-PV.-------.APPVAELAA-ALDAAL-AHPVGA-----RPLASVATAR..TRVVV
A7HGF3_ANADF/7-208YGRE..GLDVEIPSHR.VRVVEP-TF.-------.VPGLPDEAA-SFTEAV-RRPIGG-----KPLRECVAAR..ERLAV
Q464V9_METBF/12-211FGSM..ALELDIPKRNVSSIILP-SE.-------.PEKKEDPTS-LIKKAL-ENPIKS-----RRLSEIVNPD..SKVAI
A5I2T6_CLOBH/8-211YGKD..SIKFSLPKEDILGVIDR-NK.-------.WNLDKTEEK-IIKESI-ENPICS-----APLKELVHEG..EKICI
A5I3E3_CLOBH/8-211YGDG..YKKILFKPSYNVDILDK-NF.-------.LS.EKKEEE-VIKRAL-LNPIGS-----RKINEIVTPE..DKLCI
B9M1P9_GEOSF/5-202YGET..TFSLQIPPGRLLGELRT-DN.-------..PASDPPFQ-LIDRAI-S...DC-----EPYLSSFTKG..EKVVI
Q18B34_CLOD6/8-213YSKQ..GMILEIPDERFLGVLES-KSD-------NYIEHKTQEE-IVEESM-NNPIGS-----NSLEELVKGK..KNVVI
Q747H1_GEOSL/25-223YGDT..SFSLAIPPERLMGVIRP-SV.-------.PAPDSDPAA-IISEAL-D...RC-----ADAIATFRTG..ERVVI
Q0W3S9_UNCMA/8-206YGKG..HFDVDVPEENLAGIILP-EE.-------.LAGVPDEVA-EIRRAL-ENPIGS-----QRLREKVKPG..MKVAV
Q51312_9NOSO/2-192YS.......LAVNNG........-...-------.....TLSDE-QISGLV-HQALAD-----RQLDG.......QRILI
A4E8U8_9ACTN/44-249FDHK..TLHLELEDKNFAGVMEG-HQN-------EFKTTKSQEE-LVEESL-ANPYGS-----PSLEELCAGK..KDIVI
A6P1C6_9FIRM/14-218YGKE..TLSIDIPQERLSAVLTS-EMH-------HYKPELSQEE-LVREAL-EHPIGT-----PKLSVMAEGK..KKVVI
A1HRB0_9FIRM/10-212YGRG..KVNFEVDSDLVIGELTI-KD.-------.MPVLADPEV-AILEAI-RNPIGS-----KPLREIVKPG..ETVAF
Q97KZ7_CLOAB/10-215YDKK..QITAKIYKRNLAGILVS-KSE-------NYKNSLSEKE-LVEKSL-DNPIAS-----PKLEELVKGK..KNIVL
Q8PUN0_METMA/12-214FGNG..VSELNIPEKNLSSIILP-SE.-------.PEEKDYEAL-LIKKAL-ENPVKS-----RRLSEIVNPD..SKISI
Q2RH63_MOOTA/18-219YGQG..YLVGELPEGIKVKEVVP-SE.-------.IAGVPDPSA-DVRRAL-EQPIGN-----HGVEELRGV...RQVVI
Q67NT5_SYMTH/7-210IGQS..EMLLELPDENLKGILLP-NE.-------.VAPLPNPLK-TVEHVL-KSPTGT-----PPLAELLRARRPERVVI
A1HLP3_9FIRM/10-213YGRE..TVEVIIPRKNLIGVYSP-KD.-------.VAAVADVKQ-EVIRAV-NNPIGT-----KPLRELVKGA..KKVVI
O30187_ARCFU/10-210YGDK..PLLFEPPESWEVSVFRM-AG.-------.DSAREVEKE-EIFRVL-REPIGQ-----KALSKLAEER..GEAVV
A1HS76_9FIRM/8-208YGRT..DLVIRVPDQA..VVIEP-RH.-------.LEGLADEKA-AVLAAI-RNPIGT-----PPLKDMVKPT..DTVAI
A1SI75_NOCSJ/23-229LGFR..LESFPLGTRV...VYPP-ES.-------.IPAVPDVEE-AIREAL-LHPHDS-----EPLPALLRPG..MRLTI
Q2RKJ2_MOOTA/9-212YGTH..KLTFHIPEEKIKAVLSP-VA.-------.MKEIPSTEV-EIQRAL-ENPIGC-----QSLGTMVSPT..SRVLL
A5GC39_GEOUR/5-203YGDI..SFPLDLPPDKLLAAIRA-VI.-------.PSPSCSPAA-IIRTAL-A...GC-----DAVISGFRPG..ERVVI

PF04015

B0TDY0_HELMI/37-243GLRMVYKK-TGM-------AAVAE....RLGI..EV.SYDTAEVEVPLTE............RSPLRKVSILKVLYE.A.
C0QEP7_DESAH/76-276.GRRCYVA-SGI-------ESAAK....SAGA..VIVPGDHERYFQAIDI..........PNGTTLTSTRVHELVLA.S.
A8ZT10_DESOH/36-245TPVHAFKT-LGY-------ETLAK....KYGI..RHINVFDHDFEPVDLG..............DGVEFSFNTDMLH.S.
A0L9G6_MAGSM/100-298.PQRCFFR-SGI-------EKAAQ....EAGA...KVLIPGRDGFIQTDM...........GGEVLGVWPVLEVMHR.V.
A9GM32_SORC5/179-435FWKDIAQR-TGY-------EAMAA....EEGA..ALVAMDDDGVYDVAGDRPGKPLAIRGIQATHVPTLLMPKVLAEHLD
B8FNM3_DESAA/41-250STDRVIKK-TAY-------AQVVA....EEGV..EVASVDKTR.TLNYAG............SRRYKHVDVAEAFFD.A.
B7JVX7_CYAP8/40-240SARGVAKA-NGY-------LPLME....ALNI..PIVEFQGQRYPIENES...............FNHLRLSKEAME.A.
A8ZYA7_DESOH/40-246RAASVMRG-VGM-------DAVLE....AEKI..AYAEFESGGVLVENPK............ARHMKRFHIAKPVVE.A.
C4XMM3_DESMR/82-287DAYLVLEE-SGL-------AEVLA....EDRL..AFYDLNSGPVARRPNA..........GGFSKLGDLWLPGRLLA.A.
D6SMM9_9DELT/85-285.AQRCMEL-SGI-------RDACA....DIPN.TRVETLDARRFFQEVSI..........SEGESFRSTEVMRDVLD.A.
B8FHF3_DESAA/36-244PTRLNYKH-AGY-------YQEVKNVRSRASRPVGIFCMDEVLRDSVFVG............GNVHDNLRISRKMAR.A.
O26866_METTH/40-238NIERFWRA-TGI-------LDVCR....RLDI..EPVNFEASGSYIMGSG..................YPISRPVVD.S.
B0PEP7_9FIRM/37-245LLAAAYAA-TGM-------ETVAK....QYGV..KL.NTTVGSRELRGAD............AALCRTFDIIDPVAD.A.
D6SUD8_9DELT/43-249ETREVFES-LGY-------DRLAA....ELGV..ELLDLNHEPLKRLSNP...........GLEFLPEIYLPKRIFS...
A9KHQ5_CLOPH/41-245DVISLMEQ-VGF-------ASIIK....EEKV..EFINLNQGPFISIDIN............HPCPSRLCLNQLFNE.M.
A3CX66_METMJ/37-246ETALVLKN-RGA-------ADVAA....RVGA..EVTVLDSVPPAGWEAIP........PDGLHWERGFLVARLFRE.A.
A0LHW9_SYNFM/98-298.PQSCFAL-TGI-------GEAAR....SSGA...KVIYPKQTFFRPVTL..........PGGNLIRKWPVLVTPFEGV.
A4J439_DESRM/41-245PTPQVLEQ-TGY-------KEVLQ....QEQA..EFVDTNYGPYVELELN............HPYPPSTPINKLIME.A.
C0QYI7_BRAHW/40-241KGSSVALK-SGI-------DEIAN....KLNV..KYADFEE...PVGVTY..........EDGVQEKSFTIAKPIQE.A.
Q6AMI6_DESPS/59-257SALAVCEA-HGI-------SAALK....DLNI..PIVEFDRKE.SCRLSC...............GIEVGLARAALD.C.
A6NZP8_9FIRM/42-251ALEKLYNV-TGM-------AEAAR....QSGA..VL.NYDMSREQRSFPQ............GELVRSFEVLSAPFQ.A.
B5YC98_DICT6/95-296NTLKNMET-TGI-------LAVAK....KAGI..EVYSLDNMEWIWVKPE..........GLKYWSRGFRIPKLVKE.V.
B4VLW5_9CYAN/97-306NTRQAMEQ-KQV-------FQLAD....RYGL..ETIVFDEMDADQWQYIS........ADGTHWQKGFAFARPILD.A.
A8ZSZ4_DESOH/71-273.ERRCYQN-SGI-------KPVLD....AMGDRRVRCEFIDDRRFVPVTI..........ARGKALTEWPFYKEALA.A.
B8FL32_DESAA/68-268.WKRTYES-SGI-------EAAVK....DAGG..VMAPGHVGRHYAEVAV..........PGGKDLKKARVHELVLE.A.
Q1Q6F8_9BACT/43-245AVSKIVRR-LKL-------DTFAE....KHGI..DIVELDNAR.RVKAQC............GTKTFNLTVSGKALD.V.
B5EFB1_GEOBB/63-262.ARRCYAS-SGI-------EAALK....GMEN..VEVKHLEEERFKKVAL...........NGKALKDCELYGEALS.A.
B8F9A9_DESAA/40-249SLENTLKK-AGY-------GPIVE....ELGI..EVADPVPTR.PLHWEH............AKLYRTIDISAAYFE.A.
A3CSE9_METMJ/46-253NLRRAYAR-SGF-------AAVAE....ETGT..AL.NYDTGSQIVAFPE............GEVMKQFSIITPAVE.A.
C0CH74_9FIRM/37-232RTSDALEI-CGY-------RSLCE....RYGV..EFWDTQKDGSYQEECR...............GMKLNLCDSVRK.I.
A8F5L0_THELT/34-232SFKKVIAH-TGI-------SQICE....KLSV..PIVELDD...PVEVDG.............EIYKKIKISSKVFQ.A.
Q1Q0G5_9BACT/40-248STFNAFRV-TRI-------NEIAE....NTGA..KIVNFDKDK.YIDVYN..........KDYEILDKFRIARTLRE.V.
B0VJW9_CLOAI/40-242AFETVWQT-CGF-------SSLAE....KYHL..KVVNFSTLG.FRELSY..............KDINIKVSEALFQ.C.
Q02C16_SOLUE/87-301QGYENFKY-SAL-------PKEYR....KQQL..KLIDLNDEAKFERVALL.........DSDLHLVPCRIAARLVDPE.
C0BXI3_9CLOT/112-328MHYQVAKD-HGF-------TEIAE..........VQIQDENGSMTLPVEG............GTVLSENYVGAAFAD.Y.
A8ZTZ9_DESOH/31-237NTRIILTA-MGM-------RHIAR....THGV..KMIDFNEAPMKTVECG...............TLQLGIARPVLE.A.
Q3A1K2_PELCD/35-241STGEIFQR-LGY-------ERLAR....RYDV..DLVDLNNAELVELQNP...........LCEVFPTFMMPRMVMD...
B8J2N6_DESDA/65-275RAVAVARA-IGL-------ESSLR....PLGL..AVRELDRPV.PVRLDTDLPAG.LQGGRGGRKRPSFQVSSAVQE.C.
B1H0P1_UNCTG/40-246NIKNLWET-TQM-------ERICK....EENV..ELINFEASGSKEFDIN............DKNIKKVNFSNAALD.C.
Q01ZF9_SOLUE/69-328PVEEYILQ-ANW-------EPRDI....LGAA..QNVEFENTNYLGRAKKYSRM...KVPFGGYIYPAFDLNHSYED.C.
B2A581_NATTJ/44-252RTNRAFQI-SGI-------QQAAE....EAGA..EIVNFDEAGSVEMTSQ...........VQGNTYQFYVAQPVIE.A.
C4XT04_DESMR/38-236TGRIVARL-AGF-------EEALA....GLPV..TIRSLDRPR.RLALSG...............GGHIGLSRLAEE.A.
B1I1Q6_DESAP/33-238DTERCFEI-LGY-------QAMAR....RLGI..RLVDLDRARFTIKSDP...........RAVLYDRFPLPTILDG...
B1C5P9_9FIRM/37-254DSMEAMKE-CGY-------DKIAD....GEKI..VLMDLKKGEFVKKDID............GLVLKSINIPKVLCD.A.
C7LRB8_DESBD/73-273.WAQSYRS-SGI-------ERAVK....DAGG..KIVPGDNEGYYQQVAV..........PDGKRLSEVKVHGVLLE.A.
D4H7U4_DENA2/37-236KYDKVLEV-TGM-------TKVAE....ETGV..HV.........VRVES..........FEPVSRGGIVYSSLAEE.V.
A7AFK1_9PORP/72-273.WQKCYET-SGI-------AAAVK....EAGG..IIMPGNDEKYFKEVDI..........PDGVTLKKAKIHESLIE.A.
C8X3C8_DESRD/68-268.VEQCLEH-TGI-------REACQ....PLSG.SDVRGVNVPDGFAPTSI..........PGATHYTETAVMGEVLE.A.
Q2LY82_SYNAS/69-267.PRRTYRQ-SGI-------AAAAS....ALGA...SVLFTDSRKFKDMRI...........NGSSLKSWPLYTEVFE.A.
B1C978_9FIRM/40-242STISVAKE-SGL-------YDIGE....KYNI..ELKDFSQGN.TVHNPE............NDFAKQFEIANAVTE.S.
C8X2E5_DESRD/38-236SASGVARR-CGY-------GPWLR....DEGM..PIVTLDRPV.AVDVSW...............GERVGISRRALE.A.
Q64AT3_9ARCH/48-256KTMAAFEA-TGI-------ASVAR....ERNC..PLIDMDVRQPVHVIVE...........DGVAMQSLTVCPEVVE.Y.
Q3A9J0_CARHZ/39-240NTERVAAR-CGI-------ARVCQ....EEGA..ELLPFAE...AKDYPH..........PEGRTVKRFSLARELSE.V.
A8ZU87_DESOH/51-252RSEKAARI-AGI-------LQAAG....D.....SFINLGGRPVRHTVSS.............RVIDHVMIASEVLS.A.
Q3A6X8_PELCD/41-242TPAEVARR-CGI-------MQVIE....ETGA..RFAPFVE...SVRVGP...........VGRTFRQLELARDILD.A.
Q02CN1_SOLUE/65-329PLEDVILD-SGW-------NLRAL....QSAA..AGVEFENTNALCKRKKYARF...KFPGQAYMYPEYVMSQAYED.T.
C0GJS2_9FIRM/39-238STGSVART-AGI-------HQVCS....EENV..ELTDFCDPQ.RIQAPQ............TAKTNSVPLSSAVVG.S.
D1C824_SPHTD/94-288DTTARVFR-SGL-------LDVIE....NNGA..HFVDFRYDRWVTVPLG..........DRARAIKAVSIPQSVYE.A.
C4XGU5_DESMR/56-256.PESCFEV-SGL-------AGAAR....SSGA...TILLPRPALFSPLTL..........PGGRLLTDWPVLAGAFAGV.
C4XGL5_DESMR/50-253LLEATAGL-SGF-------LHRLE....AEGA..QLVAFDAKPPVPVPNP...........GAFLFDPVPLPQAVLE.A.
B2UQQ8_AKKM8/51-249...GAYEG-SGV-------KEAVE....KAGG..VMVDGGNESQYVRTEN..........PKARKFTSAKVHKAVLE.A.
Q8TQV4_METAC/37-242DTEEVLKK-LGL-------WQAAE....AEGV.DEILTFDHMKREHVEPG..........KAFSWPQGFDVPEFLKS.I.
A6DH41_9BACT/37-240SCKKALKT-HGV-------YDEAI....EKGI..EVVEFSNNQDYPGLKH............QGPYSTLSICKELKE.W.
B8FLE0_DESAA/47-254ETTDVFRR-LGY-------HEIAG....RLDV..ELVDLNYAPLRRLTDP...........ECNFFPDIFLPEMAFT...
A4XJ40_CALS8/35-230STKRAFEV-CGY-------SEISK....KYGV..KLIDTKDDQVKKVNVD...............GYELNVCKSVFE.Y.
A5G4H9_GEOUR/41-249DIDNVWKE-TSM-------ERIVE....EEGA..EKVVFERCK.ITKIKT..........PYLEKLDEHLITSLAYE.C.
C4FC45_9ACTN/57-345EHIDCAYQ-NGF-------TPYAT......GC..QVIIADGLKGTDETLVP........VKNGEYVQEAKIGHALMD.A.
D0LLI3_HALO1/243-443.PEACFAR-SGV-------RKAAL....SENA...RLFLPSPGDFETLHV..........PGAKWIEEWPFFWRPFQGA.
Q1NX93_9DELT/39-246DTHHCFQQ-LGY-------SRLAA....AYGL..ELIDLNQAVAVKKSRA...........RCRRWPEMYLPEILFD...
B8D1J2_HALOH/38-243ALRKIYRV-TGM-------EEVAE....ELGA..EL.NYDVEQEKVEYRS............GIITKSFIVGKYITG.A.
B8FFA8_DESAA/37-237PSRLFFKE-SGY-------FDMAK....KEGI..TLLDLNEHPLIKTTLS...........KAKWHKEMLLSKYIAE.A.
Q1Q6G1_9BACT/104-329NTMEAFTA-LGY-------DVIAS....QLEA..TLIDLNKADPYPDFTHVD.......IERGLIYNSIAVNNHIAE.T.
A6UVE5_META3/35-239.TKNSFEV-SRI-------KEICE....KHNI..KWLPFEGDE.TVEIEV..............MGNELHLPKSLVD.S.
B0AB85_9FIRM/40-246NLKGFYKT-CGL-------IDELS....DLDI..KF.NYDTSEVQVHNDD............AVYLKTMEVIKPIDD.A.
C0D7U9_9CLOT/37-238GSLKVLEL-CGM-------AEVAG....RLGC..GLVDLNKGECVKIPVE...........GGLILDHVMVNRNFLE.Y.
Q026Y6_SOLUE/54-259DTMEAMRV-CGI-------VDVAE....RTGV..ELCPFEHAEFDMYKID...........RPISFNEFPVPRPVRD.A.
A1ATM1_PELPD/98-298NYQKVAER-SGI-------GRASL....EGGA..ELVPFDE...TVEVQG............NGTFRRITLARAYWE.A.
B2A6N3_NATTJ/41-242NTEDVIST-TGY-------EKL.R....QQGY..QVIDLKQDSVVDLQVP..........GGGKALSQLPVAKTVKD.V.
B9MLY7_ANATD/37-241RLESIYQA-AGI-------KVLEK....LENV..YL.NYDTSYKDLSIET.............TTFKKLSLISPYFE.S.
A9G6Q8_SORC5/40-243PTRMTYES-AGY-------YPMFR....RTGV..KHYHFEEEQQVEIPLT..........HEGRLRDYVFTPEPVAK.A.
A6TU65_ALKMQ/45-250LLKGVYRA-CGI-------EEIAN....EVGA..QL.NYNTNVVEIKNEE............GLLLKKITAIEVLQE.V.
B8GJS8_METPE/36-236TANQAFKG-HGM-------PEICK....ETGA..ELVNLSTLPSRFIEDT...........IQGKRVKVQVPDLLVDEI.
C6C140_DESAD/43-240SAAQVSKA-IGM-------TDGLK....KMGL..KPKSLGRPT.PLKLSF...............GETIGISRDALE.S.
D2Z7N5_9BACT/38-240KFSKVAEK-TGI-------AQVGR....ILGV..PVVPLDE...SRPVPG..........KRDDRFRGLEISALALE.S.
O28048_ARCFU/70-274NTSAVLKT-MGI-------LDLAR....EKGF..TVIDLDSYDGWVLHQP..........EDSHWKKGYPFADIFLT.V.
A9F071_SORC5/101-299.PNRCFQR-SGI-------WKAAY....DVGG...EVVIPAAHRFRGMRL...........KGEVLDDWPVYTPLVN.A.
Q46CA4_METBF/38-243ATSKALKA-SGI-------EEAAR....KAGA..KVVNFETAG.FTLVDV..........PDPLQFRKLYIANPVLE.A.
D1N489_9BACT/73-273.WQSCYKN-SGI-------AAAVT....EAGG..KVLPANLKEHYSRVER..........PEAVKMKNALIHNAILE.A.
C8X0Z6_DESRD/32-238ETGEIFEA-LGY-------TKLAR....ETGI..SLLDLNHTEVVECQDA...........QCSAFPRMYLPQVAFE...
O28963_ARCFU/29-221SASKCFVD-FGL-------KDLVE...........CRNLNREEFVEVDIG............GEVLERVKVAETALD.AK
C0GEG7_9FIRM/35-241DTTAAFAG-LGY-------HKLRD....RYGV..ELVDFNDGPFVQTDFG...............GYSLDVSAHVLE.T.
Q0W4U5_UNCMA/31-238DADAVFDT-TGI-------REIEK....AGG...EFIDWRNNHVEIQLQE............AGVLKKVRIARPAIE.A.
B5YEQ4_DICT6/36-227RTPTVFKW-YKK-------EDINF....A.....KIVCFDDPPHNLRTLP..........EAEVIKSAVPIPKIVEE.C.
Q0W7R4_UNCMA/39-237NTIETFQK-VGL-------TDELK....GYGV..KLIDLNAEPHVEVKIE...........GGRSLKSVKVARSFTE.Y.
D6SKE1_9DELT/40-241KALHSARK-CGV-------LECAG....Q.....CFVNLGHNPVRKDIHS.............KYFSQATISREVLE.A.
B1ZNQ0_OPITP/79-285.....WRR-SRH-------AEQCA....AALA..RVQSASGGRTTVNIPK............GRALKQAEISRALLE.A.
D6SMX5_9DELT/72-277DTREVMEE-KGI-------FDLAE....KEGV..QVINFDQLEDHELVHFE........DKELHWKDGFHVPRILYE.V.
A3DEM5_CLOTH/40-242KPITAARK-NGI-------EKAAN....ELGI..KLADFLEGK.EVFFEN............AIQNKKFIIANGVLE.S.
A5GCX4_GEOUR/71-274DTADVLRD-KGI-------IELCK....RLDV..GLINFEELTPESWTKVI........PPASHWNDGFLMARPVLD.A.
B0A6W7_9FIRM/42-247DSQKVLKS-AGF-------DKIIE....EEKV..EFVDMNYGPFFELELD............GPILKSTPVNKVVED.A.
Q30WA5_DESDG/52-250SAERVAQA-VGL-------TDALQ....GLGV..RVVTLDDPV.DCRLPS...............GLRVGVARAALE.A.
B8DIZ2_DESVM/89-288.AEQCIAR-SGI-------RVACA....EFGD..IVQAPTAERFYRELDI..........DGAQQMTANTFMRDALD.A.
B5YB81_DICT6/37-240NLDYLYKI-TGM-------KEIAE....RQKV..NLVNLY....TYGVIN..........IKSEVAENIPITKFIKD.V.
Q3ABD0_CARHZ/32-236MGRQIFKV-LGY-------EKLAE....KYGV..ELVDFNEEKFTEIDFG...............PIKLSVANRALK.A.
A1VA95_DESVV/57-259TAQGVAAR-IGL-------ADALA....PLGL..AVIQLDGPR.QVEVAD...........GGGGTTTIGVSRHALD.A.
B9Y9X4_9FIRM/42-245SIQLVYQK-TGL-------RALVQ....EEGC.....RLNENLSSVDSGL............RAGSEPVPVLECVAQ.A.
B2A5X2_NATTJ/39-234STEASFEK-CGY-------TAISN....RYNL..PLVDLKTVPTKAITFK...............DHTIKIATPPLQ.V.
Q20JY2_9BACT/38-245MLDKVYRT-TGM-------YAAAE....QAGI..EV.SLDTGYQTVSYLE............GHYVKRLDVLTPILE.A.
A0LEU5_SYNFM/65-266GFDKVLRE-SGI-------KDALA....GLPV..EFKEFRD...SVPVEV............GPPFNRLELAADALD.A.
A2SS29_METLZ/39-246VLKRVYHK-CGI-------EKVAD....ELGI..KL.SYDTGYQERSCPA............GNVMKRFTVINQACE.A.
Q02D98_SOLUE/66-270NTLDLAEA-AGY-------FRTVP....AFEE..NFTDLNLDEVTRVRPA..........GQFSRIKKLYLPNSALR.A.
B8GKV1_METPE/42-249SYRALLKR-TGI-------AQVIE....ETGC..ESIFFDDQTVDRSSDQ............AKTFRRFTVAAVVDQ.V.
B8FX06_DESHD/40-245ALQGIYAR-CGL-------KEVAE....RTGA..EL.NFNVGQEVVTHPD............GKLVKSLTITKSVWD.A.
C0A4C5_9BACT/77-278.WERCYEN-SGI-------AAAVK....EAGG..KIVPGNDESYYREVEI..........PGGTALKTTKVHSLILD.S.
A7I744_METB6/37-246ATRTVLEN-RGV-------FSLAQ....ELGF..SVVVLDEIERNGWQEIQ........APGLHWQRGFFIANVFTW.A.

PF09861

A6CEC2_9PLAN/11-206AV.DYQAP.AAA........EVIN----------SVWDYFSDCGIEAGDV-------------TIL.QTSSESSMLQ-EK
A1HP90_9FIRM/9-212IASDITRLWVKH.......DQFLP----------VLLDELNAAGVPDKDI-------------KLVVGLGAHRYHTD-KE
Q38XJ2_LACSS/8-213ISSDHTRP.VPS.......HIMTP----------ILLRRIRS.VAPDARI-------------RILVATGFHRPSTH-EE
Q8TR70_METAC/61-260IVSDVTRP.TPT.......AKILP----------PLLDELYLGGARDKNI-------------MIIFALGLHRQQTE-EE
Q7MSU0_WOLSU/7-208IVNDGTRP.TPT.......RKVLA----------QIYPKIK.....NRDI-------------FFIIATGCHRAPTQ-EE
B8FVM0_DESHD/8-210AVSDMTRP.VPS.......RLIVE----------KLLPWLAEFGIHGDQI-------------TVLVGGGLHHPATQ-EE
Q4A0S0_STAS1/7-207VISDITRP.TPN.......HILVP----------LILETLSH..VPPENF-------------VIINGTGTHRDQTQ-EE
A3ZLC3_9PLAN/7-211VICDITRP.VPN.......EIILR----------PTLEILEAAGIPRDKI-------------VILNATGLHRPNHG-EE
A4QGL8_CORGB/1-216PIPDGTRS.GPH.......GLMIQ----------AAYDAIAD...RAKSI-------------TILIALGTHAAMDE-PS
A6TUJ7_ALKMQ/19-224ITSDHTRP.VPS.......KITLP----------ILLEEIRM.GNPDADI-------------TILIATGFHRSTTE-AE
A0B768_METTP/5-193IVSDITRP.SPS.......HRILP----------PLVRRLKGVGVKD..L-------------RVVFALGTHRRMTE-DE
A6TKP7_ALKMQ/8-211VFSDITRAWQKM.......STFIP----------YIVAELNQAGIKDEDI-------------LFISSTGSHRGHTK-EE
Q649M8_9ARCH/8-203VVDDHTRD.APT.......EKMLD----------CLIEEIGH....TDRI-------------TLLVACGTHAPPNE-ED
A6TUX2_ALKMQ/8-211VVSDITRLWIKT.......DQFLI----------HLIDYLNAMGVEDSHI-------------DILIALGTHRPSNE-GE
Q3AFZ6_CARHZ/7-206ITSDITRP.VPN.......KILLP----------LVLEELWQAGVKDEDI-------------TIVFALGSHRFHTE-EE
A6LWC1_CLOB8/8-213ITSDHTRP.VPS.......KITMP----------ILLQRIRN.VNPNINI-------------KILIATGFHRATTR-EE
Q464W1_METBF/12-214IVSDVTRP.TPT.......AKILP----------PLLEELYIGGAKNENI-------------TIVFALGLHRVQTE-EE
Q8CQ57_STAES/7-207VISDITRP.TPN.......HILVP----------LLIEELNH..VPRENF-------------VIINGTGTHRDQTR-DE
A7GC44_CLOBL/8-213ITSDHTRP.VPS.......KITMP----------ILLRRIRE.VNPDIDI-------------KILIATGFHRESTK-EE
Q24SB3_DESHY/7-210VTSDHTRP.LSS.......KLTLP----------YLLKELRQ.GNPAAEI-------------TILVATGLHRAPTP-EE
A7ZC16_CAMC1/7-208IVNDGTRP.TPT.......AKILK----------QIYPKLR.....DKNK-------------IFIIATGCHREGTL-DE
A6LSU3_CLOB8/8-211IISDITRSWQKP.......YKFLY----------KIVEELNEGGVKDEDI-------------IFLSAQGTHRKQTR-EE
A6TKS3_ALKMQ/8-211VISDVTRAWQKM.......SLYLP----------YIVEELNQAGILDENI-------------IFLCATGSHRKQSR-EE
Q24QM2_DESHY/9-209VVSDITRL.LKL.......HDYLP----------TIVNRLNGLGIPDEDM-------------LILTATGTHRGQTP-EE
Q12XD0_METBU/7-204IVNDATRP.TPT.......ARVLE----------EVQDTLRS....HPDV-------------KFIVATGAHRGPTE-DE
Q39QL7_GEOMG/5-203VTSDITRY.TGS.......ELYLP----------LLVERLVATGIRERDM-------------EILVALGIHRKQTE-HE
A1HLY5_9FIRM/8-211VASDVTRAWLKQ.......DQFLP----------VLLDELNGAGIPDDDI-------------FLVVALGAHRRHSE-AE
A7H7M7_ANADF/33-231IVSDSSRD.EPR.......SELFS----------AVRRALAA..VPDDHL-------------TVAVANGTHGPKPL-ER
A7HGF3_ANADF/7-208VIPDITRP.LPT.......DRLLR----------WLFAELEH..VPPEHV-------------VIVNGTGSHRANTP-DE
Q464V9_METBF/12-211IVSDVTRP.TPT.......VKLLP----------PLLEELYIGGAKNKNI-------------TIFFALGLHRNQTE-EE
A5I2T6_CLOBH/8-211VIPDITRAWQRL.......SVYLP----------YIVEEIKKGGVKDEDI-------------IFLSSTGTHREQTK-EE
A5I3E3_CLOBH/8-211VISDVTRLWQKP.......RVFLP----------ILIEEIKKSGIKDENI-------------IFLCALGSHRKQSK-EE
B9M1P9_GEOSF/5-202VTSDITRY.TGS.......DLYLP----------LLVDRLNQAGISDRDI-------------EIVVALGIHRHQSE-QE
Q18B34_CLOD6/8-213ITSDHTRP.VPS.......RITMP----------IILRRIRN.VNPEIDV-------------KIIVATGFHRPSTR-EE
Q747H1_GEOSL/25-223VTSDITRY.TGS.......EIYLP----------LLVERLAAAGVRERDI-------------EIVVALGIHRKQTE-HE
Q0W3S9_UNCMA/8-206IISDVTRP.VPS.......YKFLP----------MLLDELNAGGVQDSDI-------------TVVVALGSHRKSTP-EE
Q51312_9NOSO/2-192LIPDGTRT.API.......PQIFR----------LLHQELGK...RVPAL-------------DFLIALGTHNPMSE-EQ
A4E8U8_9ACTN/44-249ISSDHTRP.VPS.......RVTMP----------ILLHHIHS.AAPEARV-------------RILVATGMHRPSTH-EE
A6P1C6_9FIRM/14-218IASDHTRP.VPS.......KIIMP----------QMLAEIRK.GNPDADI-------------TILISTGCHRETTK-EE
A1HRB0_9FIRM/10-212IVNDPTRV.ANS.......HVFMP----------LLLNELNAVGVPDKDM-------------FVIFSLGTHRLMTE-EE
Q97KZ7_CLOAB/10-215ISSDHTRP.VPS.......KIITP----------ILLRRIRS.VEPNANI-------------IILVATGFHRPSTH-EE
Q8PUN0_METMA/12-214IVSDVTRP.TPT.......AKILP----------PLLEELYLGGAKDENI-------------TIVFALGLHRQQTE-EE
Q2RH63_MOOTA/18-219VVSDLTRP.VPN.......DVILP----------VLLEKLNAIGIKDEQV-------------TILVGTGLHRPAPP-EE
Q67NT5_SYMTH/7-210IVNDITRP.TPY.......DIMLP----------PLLRTLDEAGVRPEQV-------------TFVVATGIHRPHTD-EE
A1HLP3_9FIRM/10-213VADDNTRL.TPT.......DKIIP----------VLLDEMNAAGIKDEQV-------------TVIIALGTHRFMNN-EE
O30187_ARCFU/10-210VFDDMTRP.TKL.......KGIAK----------AVIEELKRGGVSDENI-------------TFICANGAHGTYDR-DD
A1HS76_9FIRM/8-208VISDITRP.TPN.......HKLVP----------WLIEELNH..VPRENF-------------VIINGLGSHRANTR-EE
A1SI75_NOCSJ/23-229AFDDLSLP.LPTMRAPDIRGRIIE----------QVLTMAAEAGV..DDV-------------QLIAANALHRRMTA-AE
Q2RKJ2_MOOTA/9-212LCDDNTRP.TPA.......NIIVP----------AILRELESGGVRKENI-------------KILMALGTHRPMTL-EE
A5GC39_GEOUR/5-203VTSDITRY.TGS.......EIYLP----------LLVERLNAAGVRDQDM-------------EIVVALGIHRRQTE-HE

PF04015

B0TDY0_HELMI/37-243.DAIIN------LPKIKTH----AQTG.YTGAVKNLY.GAIPGM...............R--------------KAE...
C0QEP7_DESAH/76-276.DVYIN------VPVLKHH----SSSG.LSLAMKNQM.GVVW.................N--------------RGT...
A8ZT10_DESOH/36-245.DFVVD------LPVMKTH----NQTV.VSLGIKNLK.GVMDIP...............S--------------RKK...
A0L9G6_MAGSM/100-298.QRVIN------LPIVKHH----SLSH.CTLSMKNHY.GVIGG................R--------------RNR...
A9GM32_SORC5/179-435HGLFLS------LPRLKMH----RYSV.ISVGIKGMQ.GTVMLSDSA........PAYKQ--------------KWR...
B8FNM3_DESAA/41-250.DIIIN------LPKFKTH----GLTY.VTGAVKNMF.GAIPGL...............Q--------------KSK...
B7JVX7_CYAP8/40-240.DVVIN------LPKVKSH----VQLT.VTLGVKNLF.GCVPGK...............M--------------KAW...
A8ZYA7_DESOH/40-246.DCIVN------LCRPKSH----IEAA.YTGAVKNYW.GIIPGG...............E--------------KAR...
C4XMM3_DESMR/82-287.DIVVS------LAKMKTH----HWAG.VTLAMKNLF.GVMPGVVY...........GWP--------------KNV...
D6SMM9_9DELT/85-285.DVLIA------APVAKSH----SATG.VSVSMKGMM.GLIR.................N--------------RGV...
B8FHF3_DESAA/36-244.DSKVY------LPKLKGH----CVSN.MTGAVKLNI.GICSDD...............E--------------RAI...
O26866_METTH/40-238.DLVVN------LPKLKTH----SMTI.FTCAVKNMY.GAVPGF...............G--------------KAD...
B0PEP7_9FIRM/37-245.DCVIN------LCKLKTH----CMTM.LSCGVKNLF.GCIPGL...............L--------------KPQ...
D6SUD8_9DELT/43-249.GMLIS------VPVLKRH----SLAG.VTLAMKNLM.GLAPPKHYQQ.......GGSWK--------------KSY...
A9KHQ5_CLOPH/41-245.TFLIS------FTQLKIH----EEAT.ISAAIKNITMGWPAGDEQG.........YPKK--------------DLG...
A3CX66_METMJ/37-246.DAVVQ------TCCLKTH----RFGGHVSLSLKNTV.GAVAARNP...........GNG--------------YNYMAE
A0LHW9_SYNFM/98-298.GKVIG------MAPVKDH----HRSG.ASMTMKNWY.GLFGG................R--------------RNI...
A4J439_DESRM/41-245.DVLIS------FTQIKQH----EEAT.VSLGIKNIALSWPPAEIHG.........WPKT--------------QRG...
C0QYI7_BRAHW/40-241.DVIIS------LPKLKSH----ALTT.MTGAVKNQF.GCIPGF...............R--------------KAE...
Q6AMI6_DESPS/59-257.DLLVN------LPKIKAH----SQMY.VSMAVKNCF.GLITGL...............Q--------------KAM...
A6NZP8_9FIRM/42-251.DGILN------LCKLKTH----MFMM.MTGAVKNTF.GLIPGL...............A--------------KAG...
B5YC98_DICT6/95-296.DHIIN------VAVVKTH----SIAD.FTMSLKNFV.GFIHRE...............D--------------RIL...
B4VLW5_9CYAN/97-306.GAIVN------TCCLKTH----RFGGHFTLSLKNSV.GMVAKYVP...........GDS--------------FNYMQD
A8ZSZ4_DESOH/71-273.DCYIN------VPVAKHH----GLTG.VTLGLKNIM.GIIGG................S--------------RGQ...
B8FL32_DESAA/68-268.DVFIN------VPVLKHH----GGAG.LTIGMKNNM.GIVW.................D--------------RGD...
Q1Q6F8_9BACT/43-245.DAIIN------IPKLKAH----VQLL.FTAAVKNMY.GCVSGK...............R--------------KVW...
B5EFB1_GEOBB/63-262.DVYIN------VPVAKHH----GLSR.LTLGMKNVM.GIMGG................N--------------RGS...
B8F9A9_DESAA/40-249.DVILN------LVKFKTH----SYSY.VTGAVKHWF.GTIPGL...............K--------------KSR...
A3CSE9_METMJ/46-253.DAIVV------VSKAKTH----MWTR.MTGAAKNLF.GLIPGL...............E--------------KPV...
C0CH74_9FIRM/37-232.EFLVN------VPVWKGH----CQTK.ITCALKNLK.GLIPNS...............E--------------KRR...
A8F5L0_THELT/34-232.DKVVN------VAKLKTH----SQMI.FTMGVKNTF.GCVPGF...............E--------------KSG...
Q1Q0G5_9BACT/40-248.DFIVS------VPKLKTH----GLTQ.YTGAIKNML.GSIPGN...............G--------------KKN...
B0VJW9_CLOAI/40-242.GIVIN------VGKYKTH----QLTA.FTGALKNLF.GFVPGL...............A--------------KSE...
Q02C16_SOLUE/87-301.AFVIS------AAMLKTH----NTVI.ASLSIKNMVLGAPLHQANGE......STRWNE--------------KRK...
C0BXI3_9CLOT/112-328.ENYLV------LSHFKGH----AMAG.FGGAIKNISIGLGSSE...............G--------------KSW...
A8ZTZ9_DESOH/31-237.DFLIN------VPVPKYH----DQTG.VTLSLKNLK.GCLAPA...............A--------------KRS...
Q3A1K2_PELCD/35-241.SFVIS------AAVLKAH----SLAE.VTLSMKNMI.GVAPPAYYQQ.......GGHWK--------------KSA...
B8J2N6_DESDA/65-275.DFILS------LPRVKAH----GQML.LTLAVKNCF.GCVSGL...............H--------------KAV...
B1H0P1_UNCTG/40-246.DGIIN------LPKLKTH----ALMS.FSAGVKNLY.GLVPGL...............M--------------KVE...
Q01ZF9_SOLUE/69-328.DVFVS------LAKMKEH----ATAG.ITLSMKNCF.GLTPATIYGTGAGIDEPSVVPK--------------GGRG.M
B2A581_NATTJ/44-252.DVIIN------LPKLKTH----GLTY.FTGAVKNMY.GVLPGN...............Q--------------KRD...
C4XT04_DESMR/38-236.DHIVN------LARLKCH----DQMG.MTLCVKNFF.GCVCGF...............R--------------KSL...
B1I1Q6_DESAP/33-238.AFVIS------VPVLKEH----SMTT.VTLSLKNMI.GICPASEFSG.......FWSFR--------------KSR...
B1C5P9_9FIRM/37-254.DVVIN------CPVLKAH----TMTK.VTIGIKNLSVGISSDE...............D--------------KQH..S
C7LRB8_DESBD/73-273.DVLIN------VPVLKHH----SSTM.LTVGMKNLM.GVVW.................D--------------RGY...
D4H7U4_DENA2/37-236.DIILN------LPKLKTH----GLTG.MTLAVKNLF.GLIPGT...............A--------------KVG...
A7AFK1_9PORP/72-273.DAWIN------VPILKNH----GGAK.LSCAMKNMM.GIVW.................D--------------RRF...
C8X3C8_DESRD/68-268.DVLIA------APVAKHH----GSTG.VSLSMKGMM.GLIY.................N--------------RGE...
Q2LY82_SYNAS/69-267.DKVIN------IPIAKTH----GTSK.LTLGMKNWM.GVMGG................W--------------RGR...
B1C978_9FIRM/40-242.DSIIS------ISKMKTH----QLTR.ITGAIKNIF.GCVNGF...............N--------------KGA...
C8X2E5_DESRD/38-236.DLIVN------VGKLKAH----GQMR.LTACIKNLF.GCVSGV...............R--------------KGL...
Q64AT3_9ARCH/48-256.DVVVS------IPVMKTH----MHTV.VTLAVKNMK.GCLWRR...............T--------------KIE...
Q3A9J0_CARHZ/39-240.DKVIS------VAKMKTH----SFMG.ITGGIKNLF.GFNVAT...............T--------------KAQ...
A8ZU87_DESOH/51-252.DLVIN------LPKLKTH----GLTY.FTGAVKNTF.GYVVGG...............D--------------KMR...
Q3A6X8_PELCD/41-242.DVIIN------IPKLKTH----GMMG.LTCGVKNLF.GAVVGM...............R--------------KPA...
Q02CN1_SOLUE/65-329.DVFVS------LAKLKNH----ADCG.VTLSLKNCF.GNVPASIYGDDAGVDEPNESPK--------------QGRAAV
C0GJS2_9FIRM/39-238.DEVIN------IAKLKTH----GLTR.YTGAVKNLF.GCLPGK...............L--------------KGQ...
D1C824_SPHTD/94-288.DVIVG------VPVLPPH----RPES.VAPSLALWS.GIVHPR...............T--------------QVA...
C4XGU5_DESMR/56-256.TKVIA------LSPVKDH----QRAG.ASMSLKNFY.GLLGG................R--------------RNI...
C4XGL5_DESMR/50-253.EVYIN------LPKMKTH----VHTL.VTLGIKNQY.GLILDD...............N--------------RMP...
B2UQQ8_AKKM8/51-249.DVYIT------CPPLKHH----SGSE.MTACMKNVM.GTVW.................D--------------RGA...
Q8TQV4_METAC/37-242.DYTIA------LPVIKTH----WTAT.FTMGLKSQI.SITS.................D--------------RDRRQL
A6DH41_9BACT/37-240.DFLIN------LPKLKVH----QQMH.FTGACKNLY.GCVAGK...............K--------------KIL...
B8FLE0_DESAA/47-254.HFILS------VPVLKAH----SLAG.ITCSLKSMM.GFAPPQYYSG......SHGIWR--------------KAV...
A4XJ40_CALS8/35-230.DYLIN------VPLLKGH----CQTK.LTCALKNLK.GLIPDS...............E--------------KRR...
A5G4H9_GEOUR/41-249.DAVIN------VPKFKTH----TYMT.MSGAVKNLY.GMIPGK...............W--------------KGE...
C4FC45_9ACTN/57-345.DIVIS------LTHFKGH----EQAG.FGGCMKNLGMGGGSRA...............G--------------KME...
D0LLI3_HALO1/243-443.TKVIG------VAPVKDH----NLCR.ASMTSKNWY.GLLGG................R--------------RNQ...
Q1NX93_9DELT/39-246.SYLIS------LPVLKAH----TLAG.VTLTLKNMM.GVAPPAHYQQ.......GGAWK--------------KAS...
B8D1J2_HALOH/38-243.DVIIN------IPKLKTH----GMTM.YTGAVKNLY.GAIPGL...............L--------------KAD...
B8FFA8_DESAA/37-237.DVKVW------MPKLKYH----IFAS.ITHALKLNI.GLLVHK...............E--------------RML...
Q1Q6G1_9BACT/104-329.DCLIT------VSKLKVH----SSAG.VTLSLKNMI.GLLPIQKYG.........TNGN--------------GARMQY
A6UVE5_META3/35-239.DLIIN------LPKLKTH----ILMK.YTGAVKNLY.GCIPGG...............M--------------KPK...
B0AB85_9FIRM/40-246.DFVIN------LCKLKTH----KMAK.YTGGVKNLY.GVIPGL...............K--------------KAE...
C0D7U9_9CLOT/37-238.DAVIN------VPVLKTH----FITE.VSLGMKNMK.GCIPPS...............E--------------KRR...
Q026Y6_SOLUE/54-259.DCYIG------LPKMKVH----VHTT.FTGAMKLQF.GNLP.NY.............DW--------------MVR...
A1ATM1_PELPD/98-298.DKVIN------LPKLKTH----EMMT.MTCAVKNLF.GAVVGM...............E--------------KAE...
B2A6N3_NATTJ/41-242.DLIIS------VPVMKTH----DQVE.VSLSIKNLK.GLLPDK...............I--------------KKA...
B9MLY7_ANATD/37-241.QGIIN------LPKLKTH----QMAV.YTGAVKNLF.GLIPGG...............Q--------------KAE...
A9G6Q8_SORC5/40-243.DFFVN------CPKFKSH----PWTT.VTFSMKNYI.GIQDDR...............H--------------RLI...
A6TU65_ALKMQ/45-250.DKVIS------VSKLKTH----GMMM.FTGAVKNMF.GIVAGL...............E--------------KAE...
B8GJS8_METPE/36-236.DCFIS------VPVLKVH----VMTT.ITLSMKNLW.GCYPDT...............M--------------RCL...
C6C140_DESAD/43-240.DMIIN------VPKLKAH----GQFV.VTGAVKNLF.GTVVGF...............R--------------KAY...
D2Z7N5_9BACT/38-240.DKIIN------LPKLKTH----CQMT.LTMGVKNLF.GTVVAQ...............R--------------KAA...
O28048_ARCFU/70-274.DSVIQ------TCCLKTH----RFGGHFTMSLKNSV.GMVARRW.............KG--------------HDYMSE
A9F071_SORC5/101-299.DKVIN------VPIAKHH----NLSK.YTGAMKNWY.GALGG................R--------------RNR...
Q46CA4_METBF/38-243.DLVIS------LPKLKTH----ELTY.YTGAVKNFF.GTLPLR...............C--------------RKE...
D1N489_9BACT/73-273.DVFIN------VPVLKHH----GGAK.MSCAMKNFM.GLVE.................D--------------RGF...
C8X0Z6_DESRD/32-238.SFIIS------VPVLKAH----SLAE.MTGSLKNMM.GFAPPHHYGH.......SGGWK--------------KAA...
O28963_ARCFU/29-221KEGYIS------IPKMKVH----HLTK.VTLGIKNNM.GF...................L--------------KKPAVY
C0GEG7_9FIRM/35-241.DFLIN------LPVLKTH----SNTK.VSLGFKNLK.GCLNSK...............S--------------KMF...
Q0W4U5_UNCMA/31-238.DYIIN------VPVLKHH----FFTH.ISGAMKNLF.GVVEPD...............F--------------RPL...
B5YEQ4_DICT6/36-227.DVFIN------VPGLRFH----ALTI.ISNGMKNMM.GIMP..................--------------KETTLL
Q0W7R4_UNCMA/39-237.DCILS------VPKLKVH----CWSL.STLSMKNMMGGILP..................--------------KGI...
D6SKE1_9DELT/40-241.DEVIN------LPKLKTH----SLTV.LTGAVKNTF.GYVVGA...............D--------------KMY...
B1ZNQ0_OPITP/79-285.DVVIN------VPIAKHH----AGTG.FTGCLKNMM.GACS.G..............ST--------------NRF...
D6SMX5_9DELT/72-277.DHILA------CGCLKTH----QFNGVFTMALKLAV.GIIPRE...............G--------------TDYMSQ
A3DEM5_CLOTH/40-242.DGIIS------LPKLKTH----GFAR.MTGCVKNQF.GCIPGP...............L--------------KGE...
A5GCX4_GEOUR/71-274.ECVVV------TCCLKTH----GYGGVFTMSLKNSI.GFV..................H--------------KKNMRE
B0A6W7_9FIRM/42-247.DVIIS------FTQLKYH----EEAT.VTASIKNICLGYPPASVHG.........FPKK--------------NTG...
Q30WA5_DESDG/52-250.DALLN------VPRVKVH----CQMR.LTLAVKNLF.GCVCGV...............R--------------KAV...
B8DIZ2_DESVM/89-288.DVLIA------APTAKSH----SSTG.VSLGLKGMM.GLIR.................Q--------------RGV...
B5YB81_DICT6/37-240.DYIIN------VPKLKTH----TFML.MTCVIKNTF.GLVPGM...............N--------------KSR...
Q3ABD0_CARHZ/32-236.DKIIN------LPVLKTH----NQCK.VSLGIKNLK.GTISRR...............S--------------KTH...
A1VA95_DESVV/57-259.DAILS------VPRLKAH----CQMR.VTCAVKNLF.GCVCGV...............R--------------KAL...
B9Y9X4_9FIRM/42-245.DLIID------CCKFKSH----SYTV.ASGAVKNMF.GVIPGL...............V--------------KAQ...
B2A5X2_NATTJ/39-234.DRLVN------VPVLKAH----CQTD.VTCALKNLK.GCLPDS...............E--------------KRN...
Q20JY2_9BACT/38-245.DGVLN------LCKLKTH----GFLS.MTGAVKNSF.GIIPGL...............T--------------KPG...
A0LEU5_SYNFM/65-266.DVLIN------LPKLKTH----GQML.LTLGVKNLF.GCVVGL...............R--------------KPQ...
A2SS29_METLZ/39-246.DVIIS------VCKLKTH----MFTH.FSGAVKNTF.GVVPGL...............D--------------KPV...
Q02D98_SOLUE/66-270.DLLVS------IAKMKTH----HWVG.TTLSMKNLF.GVVPSGIY...........GWP--------------KNV...
B8GKV1_METPE/42-249.DVVIT------LPKLKTH----QLTG.MTGAVKVLY.GFIPGV...............K--------------KAA...
B8FX06_DESHD/40-245.DVIIS------LSKLKTH----AMMT.FTGAVKNLF.GVIPGL...............L--------------KAE...
C0A4C5_9BACT/77-278.DVFIN------APVLKHH----GGAT.MTACMKNLM.GAIW.................D--------------RRF...
A7I744_METB6/37-246.DRVIQ------TCCLKTH----RYGGHFTMSLKNSV.GLVAKRVP...........GLD--------------YDFMGE

PF09861

A6CEC2_9PLAN/11-206LKAAVN......SELQEQA....SWVI-HAPDSKEEV-GYLGTS---------------A..............GGE---
A1HP90_9FIRM/9-212NVMVYG......QQVVDRV....EIVQ-SHAQNEEDF-VYVGKT---------------S..............RGV---
Q38XJ2_LACSS/8-213LVNKYG......EEIVANE....EIVM-HISTDDSSV-VKIGQL---------------P..............SGG---
Q8TR70_METAC/61-260SKKLVG......EDIYKKI....RCIQ-H...DTSRC-RRIGVT---------------S..............RGT---
Q7MSU0_WOLSU/7-208YHFIFG......KEIYEDLARQNRIWS-HDS.RKDEM-VYLGKS---------------T..............NGT---
B8FVM0_DESHD/8-210MNYILG......EELPKKIK...QVLP-HDADDQDCL-TFLGTS---------------P..............LGT---
Q4A0S0_STAS1/7-207LIQMLG......KDVVDQI....KIVH-NHCNDKDTL-SKVGHS---------------K..............YGC---
A3ZLC3_9PLAN/7-211LVEMVG......QHIVDNY....RIEN-HYGENRDEH-AYLGES---------------P..............HGV---
A4QGL8_CORGB/1-216IAKLLGVPSGTIEARFPKA....TVLN-HDWHNPEAI-VSLGTI---------------EAAEISRLTSGLLQDRDM---
A6TUJ7_ALKMQ/19-224ILDKFG......EDVVKNE....KIVN-HVCGDESSL-VHVGIL---------------P..............SGG---
A0B768_METTP/5-193VRHLLR......GCV.........RLP-HFQHDASRC-VHLGET---------------S..............KGT---
A6TKP7_ALKMQ/8-211HSWLLG......ADITSRC....EIID-HDCLNEENL-VYLGTT---------------S..............FGT---
Q649M8_9ARCH/8-203LNSILG......KH.RSRF....DILI-HNC.DAGDL-VYVGTT---------------S..............RGT---
A6TUX2_ALKMQ/8-211KQAIVG......NEVYNRI....KIHD-HDCFDSKGL-DYVGES---------------S..............FNT---
Q3AFZ6_CARHZ/7-206KISLVG......EEIYHRI....KCID-S...DQRDC-VRLGYT---------------K..............FGT---
A6LWC1_CLOB8/8-213MINKFG......QTIVDNE....EIIN-HISTDENSL-INVGTL---------------P..............SGG---
Q464W1_METBF/12-214CRQLVG......EDIFEKI....RCIQ-H...DRKRC-RHLGET---------------S..............FGT---
Q8CQ57_STAES/7-207LIQMLG......EDIVNSV....KIVH-NHCSEKESL-AKVGHS---------------Q..............YGC---
A7GC44_CLOBL/8-213LINKFG......EEIVKNE....NIVM-HVSTDDSTL-VKVGTL---------------P..............SGG---
Q24SB3_DESHY/7-210MIAKFG......ADVVEQE....NFVI-HKADDYSTL-VHLEDL---------------P..............SGA---
A7ZC16_CAMC1/7-208YNMIFS......KEIYPEIRAKNEVHD-HDS.KHDEM-VFLGES---------------K..............NGT---
A6LSU3_CLOB8/8-211HEILLG......EKLSKRF....EVYD-HDCFDEESM-TYLGET---------------S..............YGT---
A6TKS3_ALKMQ/8-211HKLLLG......EELALRF....QVID-HDCRDESNL-VDLGKT---------------S..............FGT---
Q24QM2_DESHY/9-209KKKIVG......EEVYARI....EVVD-HDC.DHSEM-VYVGTT---------------P..............RGT---
Q12XD0_METBU/7-204FRFIFG.......NLYDEF..KDSIYV-HDARKDEDM-EYLGVS---------------S..............NGT---
Q39QL7_GEOMG/5-203HQKIAG.......PLHGRI....RIVD-HDCDDPGQL-AFIGRT---------------S..............NGI---
A1HLY5_9FIRM/8-211HVATYG......QEVVSRI....RILQ-SYALDEDDF-VYVGVT---------------S..............RGV---
A7H7M7_ANADF/33-231LG..LP......EEVLRRH....RVVN-HDARDDASM-VEMGRT---------------S..............RGT---
A7HGF3_ANADF/7-208LRAMAG......ADVLARH....RVVN-HDAHDPRTL-APVGTT---------------R..............DGL---
Q464V9_METBF/12-211SRKLVG......EEVYKKI....HCIQ-H...DTGRC-RRIGIT---------------S..............RGT---
A5I2T6_CLOBH/8-211HKILIG......ENLYNNY....KVID-HISTKKEDL-VYLGKT---------------S..............YNT---
A5I3E3_CLOBH/8-211YIKILG......ENLFKRF....KIID-HYSKDKDEM-MYIGET---------------S..............FKT---
B9M1P9_GEOSF/5-202HKKILG.......ALHGRI....RVTD-HDCDNPGKL-AYLGNT---------------S..............TGI---
Q18B34_CLOD6/8-213LIYKMG......EEIVDNE....DIVM-HISTDDKSM-CKVGIL---------------P..............SGG---
Q747H1_GEOSL/25-223HQRITG.......PLYGRI....RITD-HECDNPGKL-VLIGRT---------------S..............TGV---
Q0W3S9_UNCMA/8-206HKALMG......QS.YGRV....RCID-Q...DKYDA-KYVGTS---------------S..............FGH---
Q51312_9NOSO/2-192INHLVGVTPKERETTFKKV....RIFN-HLWNEPDTF-ISCGVI---------------SADEIAEISRGMLH.QSV---
A4E8U8_9ACTN/44-249LVNKYG......EEIVANE....EIVM-HVATDDSMM-KKIGTL---------------P..............SGG---
A6P1C6_9FIRM/14-218LVNKFG......PDIVAKE....KIVI-HDC.DDPTQ-VSLGKL---------------P..............SGG---
A1HRB0_9FIRM/10-212MVEAVG......PEVAKRV....RMYN-SDCRDESQF-KYFGTT---------------S..............RGT---
Q97KZ7_CLOAB/10-215LVDKYG......EEIVKRE....NIVM-HVSTDDSAM-VQIGTL---------------P..............SGG---
Q8PUN0_METMA/12-214CRKLLG......NDVSRNI....RFVQ-H...DRNRC-VHIGET---------------S..............FGT---
Q2RH63_MOOTA/18-219FPLIVG......PEVAARV....KVIS-HDAYAPGIL-QQIGVS---------------S..............RGT---
Q67NT5_SYMTH/7-210NRRIFG......ADVVNRY....RFVN-HDC.VADDL-VTVGRL---------------S..............DGT---
A1HLP3_9FIRM/10-213ILAKFG......EETVKRV....AIKN-HDFKNPEAL-IDLGKT---------------P..............NGT---
O30187_ARCFU/10-210FAKKLG......EEIVESY....PVFN-HN..PLGNL-DYLGET---------------S..............AGT---
A1HS76_9FIRM/8-208LISMLG......REVVENY....RVIN-HNAFDDAEL-TFVGVN---------------G..............YGS---
A1SI75_NOCSJ/23-229LQHIVG......ERVFRSFYPQGQLYN-FDAEDRDNL-AHLGTT---------------D..............KGE---
Q2RKJ2_MOOTA/9-212LQQKLG......AEVLAQV....EVIN-HDFRNPMAL-HDFGLT---------------A..............NGT---
A5GC39_GEOUR/5-203HRKILG.......SLYGRI....RVSD-HDCDDPGKL-VYLGKT---------------S..............AGI---

PF04015

B0TDY0_HELMI/37-243YH.......................................................................FRV.QER
C0QEP7_DESAH/76-276YH.............................................................................W
A8ZT10_DESOH/36-245AH.........................................................................SPDAV
A0L9G6_MAGSM/100-298LH..............................................................................
A9GM32_SORC5/179-435MHRELKAYLD......................................................TKSAGQEDRALYLSSL
B8FNM3_DESAA/41-250MH.......................................................................VKA.PAA
B7JVX7_CYAP8/40-240WH.......................................................................MEAGKDA
A8ZYA7_DESOH/40-246CH........................................................................LHGRNP
C4XMM3_DESMR/82-287LH.............................................................................F
D6SMM9_9DELT/85-285MH............................................................................SR
B8FHF3_DESAA/36-244RH.............................................................................D
O26866_METTH/40-238YH........................................................................REHPRP
B0PEP7_9FIRM/37-245LH.......................................................................YRF.PDT
D6SUD8_9DELT/43-249FH..............................................................................
A9KHQ5_CLOPH/41-245IH..............................................................................
A3CX66_METMJ/37-246LH............................................................................SS
A0LHW9_SYNFM/98-298FH..............................................................................
A4J439_DESRM/41-245IH..............................................................................
C0QYI7_BRAHW/40-241YH.......................................................................LKL.PDF
Q6AMI6_DESPS/59-257LH.......................................................................MKHGEGH
A6NZP8_9FIRM/42-251CH.......................................................................TRF.QSK
B5YC98_DICT6/95-296MH............................................................................SS
B4VLW5_9CYAN/97-306LH............................................................................SS
A8ZSZ4_DESOH/71-273IH..............................................................................
B8FL32_DESAA/68-268WH.............................................................................R
Q1Q6F8_9BACT/43-245RH.......................................................................FRSNNDI
B5EFB1_GEOBB/63-262IH..............................................................................
B8F9A9_DESAA/40-249MH.......................................................................MRV.PDQ
A3CSE9_METMJ/46-253FH.......................................................................FRF.QDE
C0CH74_9FIRM/37-232FH.............................................................................S
A8F5L0_THELT/34-232WH.......................................................................IRC.AHN
Q1Q0G5_9BACT/40-248VH.......................................................................LIA.PKP
B0VJW9_CLOAI/40-242YH.......................................................................RLY.PDT
Q02C16_SOLUE/87-301YH..............................................................................
C0BXI3_9CLOT/112-328IHSGG.................................................................TTRSGFGGDQ
A8ZTZ9_DESOH/31-237CH.............................................................................T
Q3A1K2_PELCD/35-241FH..............................................................................
B8J2N6_DESDA/65-275AH.......................................................................AREGRDP
B1H0P1_UNCTG/40-246YH........................................................................KYAFKS
Q01ZF9_SOLUE/69-328VHGGDRQPSK.......................................................SAPAEKDPSTPRIDT
B2A581_NATTJ/44-252LH.......................................................................RKY.PDT
C4XT04_DESMR/38-236AH.......................................................................QTLGKDY
B1I1Q6_DESAP/33-238VH.............................................................................Q
B1C5P9_9FIRM/37-254LHRIGL..............................................................YPPLSDEMEKNG
C7LRB8_DESBD/73-273WH.............................................................................R
D4H7U4_DENA2/37-236YH.......................................................................RDFPVDT
A7AFK1_9PORP/72-273FH.............................................................................Q
C8X3C8_DESRD/68-268LH............................................................................WR
Q2LY82_SYNAS/69-267IH..............................................................................
B1C978_9FIRM/40-242SH.......................................................................VKF.SDG
C8X2E5_DESRD/38-236AH.......................................................................ARYGERG
Q64AT3_9ARCH/48-256LHM....................................................................LPQIEDVGD
Q3A9J0_CARHZ/39-240YH.......................................................................LRM.QKR
A8ZU87_DESOH/51-252VH.......................................................................ADA.PTP
Q3A6X8_PELCD/41-242LH.......................................................................LQAGADK
Q02CN1_SOLUE/65-329VHFGRRQPARIA..................................................PAALLDANVQPGVTNTAG
C0GJS2_9FIRM/39-238MH.......................................................................LRM.EEI
D1C824_SPHTD/94-288AR............................................................................AA
C4XGU5_DESMR/56-256FH..............................................................................
C4XGL5_DESMR/50-253FH.............................................................................R
B2UQQ8_AKKM8/51-249MH.............................................................................K
Q8TQV4_METAC/37-242PH.........................................................................GQGMD
A6DH41_9BACT/37-240LH.......................................................................NLCKNEP
B8FLE0_DESAA/47-254FH..............................................................................
A4XJ40_CALS8/35-230FH.............................................................................T
A5G4H9_GEOUR/41-249IH.......................................................................CRA.PKP
C4FC45_9ACTN/57-345QHAAGKPSVDEAKCIGCRACERICAHGAVSFPTTRERALKNGRVVESPVACIDHDCCVGCGRCIGACNQNAIEPDYGAAA
D0LLI3_HALO1/243-443FH..............................................................................
Q1NX93_9DELT/39-246FH..............................................................................
B8D1J2_HALOH/38-243YH.......................................................................LRM.PEL
B8FFA8_DESAA/37-237YH.............................................................................D
Q1Q6G1_9BACT/104-329VH.........................................................................SPDQR
A6UVE5_META3/35-239LH.......................................................................GIY.SKE
B0AB85_9FIRM/40-246IH.......................................................................YRFQKEE
C0D7U9_9CLOT/37-238FH.............................................................................D
Q026Y6_SOLUE/54-259CHR.....................................................................DD......
A1ATM1_PELPD/98-298WH.......................................................................LRAGTSR
B2A6N3_NATTJ/41-242FH............................................................................NK
B9MLY7_ANATD/37-241MH.......................................................................FRF.QEV
A9G6Q8_SORC5/40-243DH.............................................................................D
A6TU65_ALKMQ/45-250YH.......................................................................VRM.PGN
B8GJS8_METPE/36-236QH..............................................................................
C6C140_DESAD/43-240AH.......................................................................TRFGETP
D2Z7N5_9BACT/38-240WH.......................................................................YRVGLDR
O28048_ARCFU/70-274LH............................................................................TS
A9F071_SORC5/101-299LH..............................................................................
Q46CA4_METBF/38-243AH.......................................................................LL..GKR
D1N489_9BACT/73-273MH.............................................................................R
C8X0Z6_DESRD/32-238FH..............................................................................
O28963_ARCFU/29-221MH..............................................................................
C0GEG7_9FIRM/35-241CH...........................................................................HTE
Q0W4U5_UNCMA/31-238VH.............................................................................V
B5YEQ4_DICT6/36-227IH.............................................................................V
Q0W7R4_UNCMA/39-237MH..............................................................................
D6SKE1_9DELT/40-241LH.......................................................................ASC.PSA
B1ZNQ0_OPITP/79-285FHNG..................................................................SGASSEYGDV
D6SMX5_9DELT/72-277LH............................................................................GS
A3DEM5_CLOTH/40-242FH.......................................................................VRI.PSI
A5GCX4_GEOUR/71-274LH...........................................................................TSF
B0A6W7_9FIRM/42-247IH..............................................................................
Q30WA5_DESDG/52-250AH.......................................................................TRHGDRG
B8DIZ2_DESVM/89-288MH............................................................................SR
B5YB81_DICT6/37-240MH.......................................................................AIA.INP
Q3ABD0_CARHZ/32-236CH...........................................................................GKD
A1VA95_DESVV/57-259AH.......................................................................TTHGADT
B9Y9X4_9FIRM/42-245MH.......................................................................ARF.PQR
B2A5X2_NATTJ/39-234FH.............................................................................I
Q20JY2_9BACT/38-245YH.......................................................................ANL.KEP
A0LEU5_SYNFM/65-266WH.......................................................................LRTGVDR
A2SS29_METLZ/39-246FH.......................................................................SRF.PDA
Q02D98_SOLUE/66-270LH.............................................................................W
B8GKV1_METPE/42-249YH.......................................................................LHTGNNI
B8FX06_DESHD/40-245YH.......................................................................FKM.PEV
C0A4C5_9BACT/77-278YH.............................................................................Q
A7I744_METB6/37-246LH............................................................................TS

PF09861

A6CEC2_9PLAN/11-206-------------------------------------------------------------------------------R
A1HP90_9FIRM/9-212-------------------------------------------------------------------------------E
Q38XJ2_LACSS/8-213-------------------------------------------------------------------------------D
Q8TR70_METAC/61-260-------------------------------------------------------------------------------P
Q7MSU0_WOLSU/7-208-------------------------------------------------------------------------------E
B8FVM0_DESHD/8-210-------------------------------------------------------------------------------P
Q4A0S0_STAS1/7-207-------------------------------------------------------------------------------D
A3ZLC3_9PLAN/7-211-------------------------------------------------------------------------------P
A4QGL8_CORGB/1-216-------------------------------------------------------------------------------D
A6TUJ7_ALKMQ/19-224-------------------------------------------------------------------------------A
A0B768_METTP/5-193-------------------------------------------------------------------------------P
A6TKP7_ALKMQ/8-211-------------------------------------------------------------------------------P
Q649M8_9ARCH/8-203-------------------------------------------------------------------------------P
A6TUX2_ALKMQ/8-211-------------------------------------------------------------------------------P
Q3AFZ6_CARHZ/7-206-------------------------------------------------------------------------------P
A6LWC1_CLOB8/8-213-------------------------------------------------------------------------------E
Q464W1_METBF/12-214-------------------------------------------------------------------------------P
Q8CQ57_STAES/7-207-------------------------------------------------------------------------------D
A7GC44_CLOBL/8-213-------------------------------------------------------------------------------D
Q24SB3_DESHY/7-210-------------------------------------------------------------------------------P
A7ZC16_CAMC1/7-208-------------------------------------------------------------------------------Q
A6LSU3_CLOB8/8-211-------------------------------------------------------------------------------P
A6TKS3_ALKMQ/8-211-------------------------------------------------------------------------------P
Q24QM2_DESHY/9-209-------------------------------------------------------------------------------E
Q12XD0_METBU/7-204-------------------------------------------------------------------------------E
Q39QL7_GEOMG/5-203-------------------------------------------------------------------------------E
A1HLY5_9FIRM/8-211-------------------------------------------------------------------------------R
A7H7M7_ANADF/33-231-------------------------------------------------------------------------------R
A7HGF3_ANADF/7-208-------------------------------------------------------------------------------P
Q464V9_METBF/12-211-------------------------------------------------------------------------------P
A5I2T6_CLOBH/8-211-------------------------------------------------------------------------------P
A5I3E3_CLOBH/8-211-------------------------------------------------------------------------------P
B9M1P9_GEOSF/5-202-------------------------------------------------------------------------------G
Q18B34_CLOD6/8-213-------------------------------------------------------------------------------D
Q747H1_GEOSL/25-223-------------------------------------------------------------------------------D
Q0W3S9_UNCMA/8-206-------------------------------------------------------------------------------R
Q51312_9NOSO/2-192-------------------------------------------------------------------------------E
A4E8U8_9ACTN/44-249-------------------------------------------------------------------------------E
A6P1C6_9FIRM/14-218-------------------------------------------------------------------------------E
A1HRB0_9FIRM/10-212-------------------------------------------------------------------------------P
Q97KZ7_CLOAB/10-215-------------------------------------------------------------------------------P
Q8PUN0_METMA/12-214-------------------------------------------------------------------------------P
Q2RH63_MOOTA/18-219-------------------------------------------------------------------------------P
Q67NT5_SYMTH/7-210-------------------------------------------------------------------------------D
A1HLP3_9FIRM/10-213-------------------------------------------------------------------------------S
O30187_ARCFU/10-210-------------------------------------------------------------------------------P
A1HS76_9FIRM/8-208-------------------------------------------------------------------------------K
A1SI75_NOCSJ/23-229-------------------------------------------------------------------------------D
Q2RKJ2_MOOTA/9-212-------------------------------------------------------------------------------P
A5GC39_GEOUR/5-203-------------------------------------------------------------------------------E

PF04015

B0TDY0_HELMI/37-243KPFGELLVELNLA.L.....RPVL..TVMDGVIG....MEGDGP.T.AGEPK....PF.GY.LLAARCPF--.TLDHY.A
C0QEP7_DESAH/76-276KGLHQCIADFCHA.R.....KPDL..NVMDGYRI....TLRNGP.S.RAGRDD.VVIR.KT.LLLSTDIV--.AIDAA.G
A8ZT10_DESOH/36-245KDLYFSIARLPDK.L.....PPML..TLIDGIYT.....LERGPGF.DGKPR....PS.NI.LVASTDVL--.SADMV.G
A0L9G6_MAGSM/100-298QNIHTSIVDLAAA.V.....KPTL..TVMDATRV....LMRNGP.T.GGNLAD.VSQQ.NT.LLAATDEV--.ALDSY.A
A9GM32_SORC5/179-435RVFAERMVDVLEI.S.....APDA..VLGDGAPA....MGGDGFQVLHPTSE.......MV.AVGGTNPV--.RVDRV.A
B8FNM3_DESAA/41-250DEFSEFLLDLYGC.LLYGFDKPKTFLHLMDGIIV....MEGEGPGA.SGSPA....RM.DA.VLASTDAV--.ALDYA.A
B7JVX7_CYAP8/40-240NRFGEMLVETARA.I.....NPDL..TIIDGIIG....HEGNGP.S.GGEPR....PL.GI.LGAAADVF--.ALDRT.M
A8ZYA7_DESOH/40-246AEFGHVLADNYEAFLA..QGKKRI..VVMDARKL....MEGPGGPA.NGFMR....PV.GL.VLAGYDEA--.AVDMV.M
C4XMM3_DESMR/82-287AGIEPSILDINAT.V.....RPHF..AIIDGIVG....MDGDGP.I.MGDPV....AA.GV.VVMGRSAV--.AVDAT.A
D6SMM9_9DELT/85-285YNLNQAIVDLCTL.L.....KADL..TVVDATRV....LSSHGPQG.PGDVI....EG.EL.VLASRDMV--.AADAK.T
B8FHF3_DESAA/36-244FLLNEKIVDLLTP.G.....YPDF..IAMDAIDV......GVGNEA.FPSPR....KL.GL.ILMGDNPL--.AVDLI.G
O26866_METTH/40-238SEFARRLLEIYLL.T.....EPAL..TLVDGVVG....MEGNGP.S.GGDPR....DL.GI.ILASEDAI--.ALDVY.I
B0PEP7_9FIRM/37-245DAFARMLIDLSLL.V.....RPAL..TIVDAVMA....MEGNGP.T.GGRAR....PL.GFTAAARFDGL--YALDLV.M
D6SUD8_9DELT/43-249SRMQRSIFDLNCY.R.....KPDL..SIVDARVGL.AQYHLGGA.E.CSPPV.......NR.ILAGFDPV--.AVDAA.G
A9KHQ5_CLOPH/41-245NDLHDFIAAMFEK.F.....TIDV..SIVSASPA....MIGTGP.H.KGTAI....HT.GM.VLCGTDPV--.STDVV.G
A3CX66_METMJ/37-246PHQRRMVAEINRF.F.....PCDV..AIMDATEG....FSTGGP.E.RGNRI....AP.NV.ILASTDRV--.ALDAA.G
A0LHW9_SYNFM/98-298QNIHEFIMELAML.V.....KPTL..VILDGITA....MMTNGP.T.GGSLAD.LKQT.NT.LVVGTDQV--.AVDAF.G
A4J439_DESRM/41-245ERLHGFIAAMAEK.I.....PIDL..TILSGNKG....MIGTGP.S.KGKPV....DS.DI.VIAGTDPV--.ATDVV.G
C0QYI7_BRAHW/40-241EDFSTMLIDLNKL.V.....NPKL..YIMDGILA....MEGNGP.R.NGNPR....KV.NA.LIVSSDAV--.ALDYV.A
Q6AMI6_DESPS/59-257ERFSRLILDLQKF.I.....PEQL..VIGDGIEV....MHHTGP.I.KGRKL....SL.GC.LAVAQNSV--.AFDTA.M
A6NZP8_9FIRM/42-251EQFAHMLLDLCAL.A.....APRL..SVMDAVVA....MEGEGPGA.SGTPR....PV.GL.LLASENPL--.ALDVV.A
B5YC98_DICT6/95-296RYLKEMIGELNTA.F.....SPSL..NILDASKV....FVRGGP.A.KGEER....EV.GM.IIASTDRI--.ACDIT.G
B4VLW5_9CYAN/97-306PHQRIMIAEINQA.Y.....KPAL..ILLDGVDA....FVNGGP.A.SGKKV....KA.GV.MLAGTDRV--.AVDAV.A
A8ZSZ4_DESOH/71-273HRIDQNLADLNSV.L.....RPDL..TVVDATRI....LTKNGP.Q.GGSLED.VSIR.HT.VFVSTDPV--.AADAY.G
B8FL32_DESAA/68-268SGLHQCIADFSTV.R.....KPDL..TVVDAYRM....LMKNGP.R.GVSEND.TALR.KA.QIISPDPV--.AADAA.S
Q1Q6F8_9BACT/43-245RWYTEMLLANYHR.V.....KPSF..TIVDAVMA....MEERGP.S.GGVPR....NV.SL.LIGGKDCI--.AIDRV.I
B5EFB1_GEOBB/63-262KNLDQALADVNSY.F.....KPQL..TVIDATRI....LTAHGP.Q.GGNLAD.VKVL.NQ.VIASTDMV--.AADAY.A
B8F9A9_DESAA/40-249MDFADYLLDLYGG.LKYGLGDGRRIFHIVDGVRS....MEGEGPGP.TGSPR....DW.GV.VIAGEDAI--.AVDWV.A
A3CSE9_METMJ/46-253YAFGRMLADLNEC.M.....KPRL..QIVDAVVG....MEGDGP.Q.AGSPR....TI.GV.ILAGSDYA--.VVDTV.L
C0CH74_9FIRM/37-232MGLHAPIAHLNCG.I.....HQDF..IVVDHICGDLDFEDGGNP............VVCDR.ILTARDPV--.LCDAY.V
A8F5L0_THELT/34-232ENFASLLVDIHLL.V.....KPVL..TILDGIIG....MEGNGP.A.NGKLK....QF.NM.LVVGENAF--.AVDHA.V
Q1Q0G5_9BACT/40-248TVFAKALVDIYQM.A.....PPHL..IIMDAIVG....MEGNGP.N.AGNPK....KV.GL.IISSRDSV--.ALDTV.A
B0VJW9_CLOAI/40-242NSFAAMLTALYAV.I.....GNRITYSIIDGITG....MDGNGP.S.AGKPH....HF.GL.LFGSTSIP--.ALDYV.A
Q02C16_SOLUE/87-301VGLRQTHYNMMVTAQ.....RLNWAASVVDGWEG....MEGNGP.N.SGTPV....AS.RI.ALASTDYV--.AADRV.A
C0BXI3_9CLOT/112-328DAFLEAMGDAGKS.VSDYLGKGER..IVYINVMN....RLSVDCDC.DGNPAE..PDMHDIGILASTDPV--.ALDQA.C
A8ZTZ9_DESOH/31-237ARLEDHIAAFNTK.I.....PCHL..TVMDGIYF....LRGGGPMIDSGEPC....RK.NM.IMAGTDRI--.EMDSA.A
Q3A1K2_PELCD/35-241AQMHRSIFELNRY.R.....KPDL..AFIDASVGL.AEYHLGGP.T.CEPPV.......DK.LLAGFDPV--.AVDAA.G
B8J2N6_DESDA/65-275VYFADCLAALWAA.L.....PPVA..ALADGGVA....MHRTGP.S.KGEAF....VL.KL.MGASPSAV--.ALDEA.L
B1H0P1_UNCTG/40-246KDFADLLTNIYLF.F.....KDKIRFTLIDGVLS....MEGNGP.S.AGEVR....KT.NL.IAASSDTA--.VLDAY.L
Q01ZF9_SOLUE/69-328YRVPRTVVDLISA.R.....PIHL..AIVEGVKT...MTGGEGPWV.SGDLQ...AVAPGV.IVAGLNPV--.TTDAV.S
B2A581_NATTJ/44-252DEFSRLLSVLYDT.V.....KPDL..TIMDGIWS....MEGNGP.S.AGTRK....DL.GL.ILASKDGV--.ALDEV.A
C4XT04_DESMR/38-236DRFAAMILDVVAA.L.....PPST..SILDGVTA....MHKAGP.V.GGEPL....DL.GL.LGASANPV--.ALDTA.I
B1I1Q6_DESAP/33-238TDLNRAILDINLY.C.....PINL..AVIDGAVGLRGSHLRGVP...LDPPA.......RM.IVAGTDPV--.AVDAA.G
B1C5P9_9FIRM/37-254SWLDQAICDINSN.T.....NTTL..TVVDGIYG....LHGKGAPL.FGDKI....NT.NL.IMASDDRV--.SIDSV.G
C7LRB8_DESBD/73-273NDLHQCIADFISY.R.....RPTL..TVVDAYNV....MKQNGP.R.GVSTAD.IVQM.QA.LIVSTDPV--.AADAA.A
D4H7U4_DENA2/37-236ELAAQLYKYFGIL.G.....HKTM..NIIDGIIG....MEGDGP.S.KGTPV....EL.GI.AAASSDAV--.GLDIA.V
A7AFK1_9PORP/72-273NDLQQCIADICTWKK.....KPVL..NIVDAYRM....MHQNGP.Q.GKSAAD.VATL.KS.MIVSPNIV--.AVDTA.A
C8X3C8_DESRD/68-268YNLHTAIADLMRL.L.....RADL..TVIDVTRA....LTTNGPSG.PGEVK....QM.DT.VVASTDMV--.AADAQ.V
Q2LY82_SYNAS/69-267QRIDESLVDLATF.I.....KPTL..TILDAVRI....LTDNGP.Q.GGNLAD.VRRL.NM.VIAGTDAV--.AVDAF.G
B1C978_9FIRM/40-242ESFSKMLIDLVKT.I.....KPKL..NIMDGVVA....MEGNGP.G.SGTPT....KM.NV.LLISEDPI--.AIDII.F
C8X2E5_DESRD/38-236TRFEDLLLEVALA.L.....PPTL..HVLDGVQV....LHRWGP.T.HGTPL....DF.GL.LGVAADGF--.ALDAA.A
Q64AT3_9ARCH/48-256KSLNIAIADMSSV.L.....RPHL..AIVDGTTG....MEGLGP.S.AGQAK....KL.DL.VVLGIDPF--.AADAV.A
Q3A9J0_CARHZ/39-240DDFAAMLCDLALL.I.....KPVF..FIIDGVVG....MEGNGP.R.NGNPK....KA.GV.IIGGDSGF--.AVDMV.M
A8ZU87_DESOH/51-252VKFAEALVDIFSI.R.....PPDL..TIMDAVLA....MEGNGP.S.SGAPR....FV.GK.VLAGTNAV--.SLDAA.A
Q3A6X8_PELCD/41-242GLFALMLLELAEH.I.....RPTL..TIVDAIVG....MEGNGP.G.SGDPI....TM.GA.LLAGTNAL--.AVDSV.A
Q02CN1_SOLUE/65-329FRVSRVVADLAVV.R.....PIHL..QIIDGVES...TAGGEGPWV.RGVRV....VKPGL.LIAGLNPV--.CTDAV.S
C0GJS2_9FIRM/39-238DRFSDYLLDVYLA.V.....NPAV..SIVDGILA....MEGSGP.R.TGDPR....KA.GV.LLAGKDAV--.AVDTV.A
D1C824_SPHTD/94-288RDRGRAAAEMNLA.F.....RPDL..LVLDGGSA.............QRYTT....HT.GL.FLASGDRI--.ALDVC.G
C4XGU5_DESMR/56-256QDINGVIAELGQL.L.....RPTL..VVLDGVSA....MMANGP.T.GGSLAD.LKAT.NT.MIFSADPV--.AADTL.G
C4XGL5_DESMR/50-253NDINLKIVDILRA.I.....RPHL..TVVDGLWA....VQGQAP.L.SGSSL....PDMNV.VVAGADVC--.AVDTV.C
B2UQQ8_AKKM8/51-249NDLHQCIADAVYF.R.....KPDL..CVLDAYMP....MVRNGP.V.GKDTND.LVER.KT.LLASRDIV--.AIDAA.G
Q8TQV4_METAC/37-242TLFGHMIAESNLV.Y.....KPDF..YISDATKC....FVTNGP.N.VGTLR....EP.GI.ALASTDVI--.ANDVA.G
A6DH41_9BACT/37-240VKFAEMILANARK.A.....QAIL..HIADGIEA....MHIKGP.R.GGESH....PF.GK.IIISDNPL--.QLDYV.F
B8FLE0_DESAA/47-254ENMHQSIKDLNKY.R.....TPDF..TLVDASVGL.ADYHLGGE.T.CSPPV.......GK.LVAGADAL--.AVDRE.C
A4XJ40_CALS8/35-230LGLHKPIAYLNKA.I.....KTHL..IIVDSLMPDPDFEEGGNP............VEKDF.IALGFDPV--.LIDSF.A
A5G4H9_GEOUR/41-249EDFGKIVASLAHL.I.....KPKL..TIMDAICG....LEGDGPGA.AGLVR....NF.GC.VFATDDPV--.ALDSV.L
C4FC45_9ACTN/57-345DVLNYKIAEYTQAVVQ...DRPSF..HISLAIDV........SPNC.DCHPENDTPIVPDIGMFASFDPV--.AIDQA.C
D0LLI3_HALO1/243-443QDIHGIITDLTRM.M.....RPTF..VVLDASRV....LFRSGP.T.GGSLAD.VKEG.RT.VIASTDGL--.AADAY.G
Q1NX93_9DELT/39-246SGIQEAVADLNRY.R.....TPDF..TLLDATVGL.SQSHLGGP.P.CDPPP.......GL.LAAAFDPV--.ALDAY.G
B8D1J2_HALOH/38-243SHFSQMLIDLAFC.V.....KPAL..NIMDGIIG....MEGDGP.S.GGTPR....KF.GY.ILASASPL--.GLDVA.A
B8FFA8_DESAA/37-237HRIHEKIVDLLEP.G.....YPDL..VVGDAIDI......TYGFES.APYPV....RL.GL.LIFADNPL--.AADVV.A
Q1Q6G1_9BACT/104-329TQIPYNIVDIARA.F.....PIDF..AFIDGISA...IDKGEGPWV.KNISY....ATPGV.LVAGDNAV--.AVDSI.G
A6UVE5_META3/35-239NDFAKFVGELHNV.IT..KNKKTI..SIMDGING....MEGNGP.S.NGKSI....NS.KI.VIASNSAI--.AVDIL.A
B0AB85_9FIRM/40-246LFCENVLLDICDY.V.....KPSL..TIMDGVYA....MEGEGP.T.AGDVR....KV.GV.LIASESPH--.ALDIA.G
C0D7U9_9CLOT/37-238VGVNMAVADLNKA.A.....RTAL..TVMDGTVA....GEGLGP.K.EGRPV....GF.KT.VLAGANVL--.AVDMT.A
Q026Y6_SOLUE/54-259..IYQKIVNLTRA.A.....NPKW..FVMDSLYA....CQGNGP.F.SPYSEDLIKDF.NT.ICGGPDPV--.AVDTV.C
A1ATM1_PELPD/98-298QQFAHLLLEIYLL.K.....KPTL..NVVDAVVA....MEGDGP.G.SGDPV....SL.NA.LIAGVNPL--.AVDAV.A
B2A6N3_NATTJ/41-242YGLAKGVSDILAT.V.....PPVV..SVLDATYA....LEGMGP.V.YGESV....PM.GL.ILASSDPV--.ALDSI.A
B9MLY7_ANATD/37-241RRFMEMLLEILTV.A.....KPML..NIMDGIVA....MEGEGP.S.AGKPK....EL.GI.LLISEDAI--.ALDYV.A
A9G6Q8_SORC5/40-243HRLNEKVADLQYI.V.....QPQF..IAIDAITA......GEGRML.TPSPF....DL.GL.IIMGNNQV--.AFDSV.C
A6TU65_ALKMQ/45-250VDFSNALVDICVA.S.....KPVL..SFMDGIIG....MEGDGP.S.AGDPR....QI.GA.VIASTSPY--.HLDVV.A
B8GJS8_METPE/36-236KYLSRKLTLLTKV.I.....KPKI..VLIDGTYA....LNGHGP.M.YGEPV....KT.DL.LIAANNPV--.VADAF.G
C6C140_DESAD/43-240GLMEKMIIEVVQS.M.....PLAF..NLMDAIYP....MHETGP.I.SGKPY....SM.SL.LAGSTNPY--.ALDTA.I
D2Z7N5_9BACT/38-240EDFARLLLEIWMT.L.....RPCL..TVMDGVVG....MEGRGP.S.NGSPR....RF.GT.VVATDDAL--.AMDLT.T
O28048_ARCFU/70-274PHMRKMIAEINVS.Y.....SPKI..VIMDAIKG....FSHGGP.E.RGTVI....EP.GL.MIASNDRV--.AIDAV.G
A9F071_SORC5/101-299QNIDVSIADLATF.I.....QPTL..TIVDAVRV....LMRNGP.Q.GGNVAD.AKDM.HT.VIATIDQV--.AADAY.G
Q46CA4_METBF/38-243DLFGEAVADLYSV.V.....RPSF..AVMDGVIS....MEGNGP.S.HGNPV....NS.GV.ILASQDCV--.SLDIV.A
D1N489_9BACT/73-273NDLQQCIADAVLY.R.....KPDL..NVVDAYRI....VTSNGP.R.GVTPAD.VKTP.KY.QLLSRDIV--.AVDTM.A
C8X0Z6_DESRD/32-238ARMHTAIAELNRY.R.....AADL..TIMDASRGL.AQFHLGGP.E.CDPPL.......ET.ILAGWDPL--.EVDRQ.G
O28963_ARCFU/29-221PKIHRKLVDLLGF.M.....QPSL..TIVDGIIG......GTNSEM.RPKPV....KH.GV.LVAGDNVV--.AVDLI.A
C0GEG7_9FIRM/35-241LPLEGFVCALGEK.I.....KPAL..TLIDGIYA.....LEKGPVV.NGRAY....RT.DV.LIASTDMF--.AADVA.G
Q0W4U5_UNCMA/31-238LGLDEPLVDLYEF.L.....RPKVALNVLDATCIA.QSVRPSGPYY.GPTAARSVTKL.NM.IAVSRDAV--.ALDAT.A
B5YEQ4_DICT6/36-227SGLEDAIVDLNRF.R.....KSDL..VVTTAIHT....LVGNFP.V.SGYGI....ES.NT.LIVGDNVV--.AVDAI.A
Q0W7R4_UNCMA/39-237DDLAQKIVDLNRA.F.....GPEL..TVIDGILGCQRHELACDP............IASNV.IIAGEDFV--.ATDAI.G
D6SKE1_9DELT/40-241ADFARGLLDIYQV.R.....PPEL..NIMDAVLA....MQGNGP.S.NGTPV....YL.NR.ILASDNAV--.SLDAA.A
B1ZNQ0_OPITP/79-285VFLSQCIADVNLV.R.....KPDL..NVCDATEF....LLTNGPAG.PGELG....HA.RA.VVAGTDPV--.AVDAYCA
D6SMX5_9DELT/72-277EDMRKMIAEINLA.Y.....HPDM..YIIDGIDA....FVSGGP.A.TGEKV....RA.GI.TLCARDPV--.AIDAV.G
A3DEM5_CLOTH/40-242IDFSKMLVDLNVY.L.....KPRL..FVMDGIIA....MEGNGP.R.GGTPR....KI.NA.ILLSEDPI--.ALDAT.V
A5GCX4_GEOUR/71-274LSQRKMIAEVNVS.Y.....RPAL..ILLDGIEA....FVDKGP.M.EGPKK....RA.DV.ILAGTDRI--.AIDAV.G
B0A6W7_9FIRM/42-247DDLHGFIRSFAKK.M.....PIDL..AIISMDKA....MIGTGP.I.FGKAV....DTPGL.IIAGTDPV--.AADCI.G
Q30WA5_DESDG/52-250NRFEALIVELAER.L.....PPSG..VLLDGITA....MHRTGP.S.GGDPY....LL.GL.LGASCSSV--.AMDTA.V
B8DIZ2_DESVM/89-288YDLDTAIVDLNTR.L.....RAAL..TVIDGTYV....LSTGGPGG.PGKVL....QE.NT.VIASADPV--.AADAC.A
B5YB81_DICT6/37-240ENFAKILVEIFNE.V.....NPII..NIVDGIVG....MEGEGP.S.AGNPR....KF.GK.IIIGKDPV--.AVDVI.S
Q3ABD0_CARHZ/32-236WDLEHTFPHLATR.L.....PVAL..TIIDGVFV.....LEKGPGP.TGKAY....RK.NL.IIASTDIL--.AADIA.G
A1VA95_DESVV/57-259QVFGGLVADIFAA.L.....PPVA..ALCDAVTC....MHVTGP.A.GGEPF....DL.GL.MGASVSPA--.ALDAV.C
B9Y9X4_9FIRM/42-245ESFCRFLCQFCAH.V.....KPQL..CVMDAVEG....MQGNGP...SGGDR....YD.GQRLLAALDPF--.ALDYG.A
B2A5X2_NATTJ/39-234QGLDHYIATLNQI.L.....FPDL..TIVDAILGDLTFEEGGNP............VNMGR.ILMGTDPV--.LIDSY.G
Q20JY2_9BACT/38-245ASFAGMCLDLVSF.L.....SPRL..SIMDAVIG....MEGTGP.Q.NGTPR....YI.GW.LLASTNPL--.ALDCV.A
A0LEU5_SYNFM/65-266EMFAALLVTIYRK.L.....MPSV..TILDGILA....MEGNGPGR.GGKPK....EL.GL.LMASTDAI--.AVDMT.V
A2SS29_METLZ/39-246IDFSEMLVDLNEL.I.....EPDF..VVMDAVVG....MEGNGP.M.GGQPR....EV.GY.ILASHSVY--.GLDIS.A
Q02D98_SOLUE/66-270AGIDESVADLHNA.F.....SNHF..AIVDGIVG....MEGNGP.I.QGTPK....PV.GV.LVAGKDPV--.AVDAT.C
B8GKV1_METPE/42-249AQFAELLLDLHQV.V.....PPTL..VIMDAVVG....MEGNGP.S.HGTPR....AI.GL.LFAGTSSP--.AIDFV.A
B8FX06_DESHD/40-245MQFADLLVDIATW.V.....KPAV..SIMDGIVG....MEGDGP.S.AGQPR....AV.GA.LLMSENPF--.ALDVA.A
C0A4C5_9BACT/77-278NNLHQCIADFVRF.K.....RPAL..NVLDAYAP....MMRNGP.R.GKSVDDLIPNI.KS.LLASTDIV--.AIDAA.G
A7I744_METB6/37-246PHQRAMIAEINTF.Y.....STDL..VLMDATEG....FATGGP.D.KGKLI....RP.NV.IIGGRDRV--.AIDAT.G

PF09861

A6CEC2_9PLAN/11-206IYLSRHLLEADFI-L-----PIEK--VGFDPLIG----YAGGGSSIYPGFSS----QE----AIIKSRGQ.......S-H
A1HP90_9FIRM/9-212TYLNKHVVNADKV-I-----LTGG--IVYHLMAG----FGGGRKAIMPGVSG----YA----TIQGNHSY...CL.HD-E
Q38XJ2_LACSS/8-213CIINKIAVEADLL-I-----SEGF--IESHFFAG----FSGGRKSILPGVAS----YK----TIMANHSG..EFINSH-Y
Q8TR70_METAC/61-260VDIFEEVLDSDFV-I-----GTGG--IEFHYYAG----YSGGAKSILPGVSS----EE----AVLTNHKM...MI.EE-N
Q7MSU0_WOLSU/7-208MYLNKIVANAKKV-C-----AIGS--VEPHYFAG----YTGGRKAFLPGVAA----YE----TIQQNHLL...ALHEN-A
B8FVM0_DESHD/8-210VYVNQYFAQADFK-I-----VTGM--VDAHQFMG----FTAGVKGAVIGLGG----RE----TITGNHVR...LF.QP-G
Q4A0S0_STAS1/7-207VYLNKDYVEADFK-I-----VTGF--IEPHFFAG----FSGGPKGIMPGIAG----IE----TIMTFHNA..KMIGDI-R
A3ZLC3_9PLAN/7-211IWIDRRYVEADLK-I-----TVGL--IEPHFMAG----FSGGRKLICPGIAH----ID----TIRAWHSP..RFLEHE-N
A4QGL8_CORGB/1-216VQINKLVAEADVN-L-----VVGP--IFPHEVVG----FSGGNKYFFPGCSV----HD----VIDISHWV..GALITA-S
A6TUJ7_ALKMQ/19-224LWLNKLAMEADLL-V-----SEGF--IEPHFFAG----FSGGRKSVLPGVAG----RT----TVLANHCA..KFIIHD-K
A0B768_METTP/5-193VEIFDLVESSDLI-I-----GTGN--IEYHYYAG----YSGGAKALLPGVSS----ER----SIHHNHMM...MR.EP-R
A6TKP7_ALKMQ/8-211VSVNKRAMECDHI-V-----LTGA--IVFHLLAG----WGGGKKSVLPGICS----YN----TIMTNHAL...SL.SP-N
Q649M8_9ARCH/8-203VSLNRTYVDANIK-I-----LTGD--ITLHYYAG----FGGGRKSILPGISS----RE----SINRNHAL...LV.DE-D
A6TUX2_ALKMQ/8-211IFINKRIVKADRV-I-----LTGG--IAFHLFAG----FGGGAKGMVPGVAG----LE----TIQHNHRL...TF.NE-G
Q3AFZ6_CARHZ/7-206VDVFRPVAEADRR-I-----CLGN--IEYHYFAG----YSGGAKAIMPGVSS----RE----AIQANHSR...MV.EV-E
A6LWC1_CLOB8/8-213LFLNKLAMETELL-I-----AEGF--IEPHFFAG----FSGGRKSILPGIAS----AK----TIMANHCS..EFINSN-H
Q464W1_METBF/12-214VEVFEEVIDSDVI-I-----STGT--LEFHYYAG----YGGGGKSILPGVSS----EK----SILSFHSFYSKLF.EG-D
Q8CQ57_STAES/7-207VYLNKAYVESDFK-I-----VTGF--IEPHFFAG----FSGGPKGIMPGIAG----LE----TIQTFHNA..KMIGDP-R
A7GC44_CLOBL/8-213LILNKLAMETELL-I-----AEGF--IESHFFAG----FSGGRKSILPGIAS----AK----TIMANHCG..EFIASP-N
Q24SB3_DESHY/7-210FWVNRLAVEADLL-I-----AEGF--IEPHFFAG----YSGGRKSIMPGISG----RD----TILVNHSA..DFIVSV-N
A7ZC16_CAMC1/7-208MYLNKIVAEAKKV-I-----VIGS--VEPHYFAG----YTGGRKAFLPGTAS----YE----SITQNHKL...ALSAD-A
A6LSU3_CLOB8/8-211VMLNKKAVESDHI-V-----ITGA--IVYHFLVG----WSGGKKSILPGIAS----FK----TISANHSL...SL.ND-G
A6TKS3_ALKMQ/8-211VQINRIAMDCDHI-I-----ITGA--IVYHDLVG----WGGGKKSILPGIAG----YQ----SIMGNHGL...SL.SH-I
Q24QM2_DESHY/9-209VVVNRLVVD.RKV-I-----LTGG--IVHHLMAG----FGGGRKSIIPGVAS----RK----TIAQNHLH...SL.DP-N
Q12XD0_METBU/7-204IYLNKMVREAGNI-L-----VIGS--VEPHYFAG----YTGGRKAFLPGVAG----FK----TIEMNHKH...ALSNK-A
Q39QL7_GEOMG/5-203VTVNRRVVEADRV-I-----LTGT--IGFHYFAG----FGGGRKSILPGVAS----RA----TCMASHFA...VL.NP-G
A1HLY5_9FIRM/8-211ACLNRHVVGADKV-I-----LTGG--IVYHSMAG----FGGGRKSIVPGIAS----YQ----TIQANHNF...CL.HP-E
A7H7M7_ANADF/33-231IRVNRCVAEADLV-V-----STGK--VKPHYFAG----WGGGAKGIFPGLGH----DV----DIRQNHKL....KADP-A
A7HGF3_ANADF/7-208VSMARAYVEADRR-I-----VLGF--IEPHFMAG----FSGGYKGVFPAVAD----IA----AVMHYHRA..EVIGHP-R
Q464V9_METBF/12-211IEVFEDIMDADVV-I-----GTGS--IEFHYYAG----YSGGAKSVLPGVSS----KE----TVITNHKM...MI.DE-K
A5I2T6_CLOBH/8-211VMINKLALECDHV-I-----LTGA--IIYHFLVG----YSGGKKAILPGISS----FE----TVMANHAL...SL.CG-N
A5I3E3_CLOBH/8-211VVVNKLIKECTKV-I-----ITGG--ITFHDMAG----FGGGRKSILPGISS----YE----TIMANHAL...VLNSD-K
B9M1P9_GEOSF/5-202VEINRSVAEADRV-I-----LTGT--IGFHYFAG----FGGGRKSILPGVAS----RR----ACMASHFT...VL.NP-E
Q18B34_CLOD6/8-213LYINKLAYEAELL-I-----AEGF--IEPHFFAG----FSGGRKSVLPGIAS----AK----TIMYNHCS..DFIDSD-N
Q747H1_GEOSL/25-223VVVNRTVAEADRV-I-----LTGT--IGFHYFAG----FGGGRKSILPGVAG----RA----SCMASHYA...VL.NP-G
Q0W3S9_UNCMA/8-206IHVFREIVDADFV-V-----CTGN--IEYHYFAG----YSGGVKAILPGCAS----HD----TIQNNHEM...MR.SP-K
Q51312_9NOSO/2-192VRVNKLVTQYDLI-M-----ICGP--VFPHEVVG----FSGGNKYFFPGIGG----QE----VIDISHWL........-G
A4E8U8_9ACTN/44-249CIINKIAADCDLL-L-----AEGF--IEPHFFAG----FSGSRKSVLPGIAS----YK----TIMYNHNG..QFVNDS-H
A6P1C6_9FIRM/14-218LIVDRLAVEADLL-V-----AEGF--IEPHFFAG----FSGGRKSVLPGIAS----RK----TVIYNHNA..EFIASD-R
A1HRB0_9FIRM/10-212VYFHKLVAEADHI-V-----CTGS--VVHHFFAG----YGGGRKAMLPGVAL----YE----TIRKNHSM...IF.DP-N
Q97KZ7_CLOAB/10-215CIINKIAAEADLL-I-----AEGF--IESHFFAG----FSGGRKSVLPGIAS----YK----TIMANHCG..EFINSN-K
Q8PUN0_METMA/12-214VEVFEDALNTDLI-I-----SIGT--VEFHYYAG----YGGGGKSILPGVSS----EK----SVLSFHSHYSKLF.EG-D
Q2RH63_MOOTA/18-219IWINRHYLEADGR-I-----LIGM--IDPHQFVG----YTAGSKSLVIGCGG----EA----TIRANHAH...LV.EP-E
Q67NT5_SYMTH/7-210LTVNRHVAEADFL-I-----TTGL--IGLHYFAG----YSGGRKSVLPGVAG----KS----LITHNHRK...MT.DP-R
A1HLP3_9FIRM/10-213VWVNREAYEADFK-I-----GVGS--IVPHHIPG----FAGGAKIVQPGISG----EQ----TTAETHLL...SVRAP-R
O30187_ARCFU/10-210VEINSEVMSYSLK-I-----GLGC--ILPHPQFG----YSGGAKIVLPGIAG----MR----SIAYNHGV....IGGW-S
A1HS76_9FIRM/8-208VYLNKTYVEASFK-I-----VTGF--IEPHFFAG----FSGGPKGISPGVAG----IS----TILDFHNA..QMIGHP-N
A1SI75_NOCSJ/23-229VEISRRAAESDLL-V-----YVN.--VN...LVA----MDGGHKSVGIGLAS----YR----SLRHHHNA..KTMVHS-R
Q2RKJ2_MOOTA/9-212VKVNRVVLEADVV-I-----GIGS--IVPHHIPG----YSGGAKIVQPGICG----ED----TTAATHLL...SVRTR-R
A5GC39_GEOUR/5-203VEINRKVAEADRV-I-----LTGT--IGFHYFAG----FGGGRKAILPGSAS----RK----SCMASHFA...VL.NP-E

PF04015

B0TDY0_HELMI/37-243LSLI
C0QEP7_DESAH/76-276ARIF
A8ZT10_DESOH/36-245AKIL
A0L9G6_MAGSM/100-298LSFL
A9GM32_SORC5/179-435AELL
B8FNM3_DESAA/41-250TTLS
B7JVX7_CYAP8/40-240VDIL
A8ZYA7_DESOH/40-246LAIG
C4XMM3_DESMR/82-287CRVM
D6SMM9_9DELT/85-285VELF
B8FHF3_DESAA/36-244ARLL
O26866_METTH/40-238PWLL
B0PEP7_9FIRM/37-245AHLI
D6SUD8_9DELT/43-249AKLL
A9KHQ5_CLOPH/41-245ARLL
A3CX66_METMJ/37-246IALL
A0LHW9_SYNFM/98-298ATLL
A4J439_DESRM/41-245ARLL
C0QYI7_BRAHW/40-241SQII
Q6AMI6_DESPS/59-257LHVL
A6NZP8_9FIRM/42-251GAIM
B5YC98_DICT6/95-296LSLL
B4VLW5_9CYAN/97-306IAIL
A8ZSZ4_DESOH/71-273TTLF
B8FL32_DESAA/68-268AKLF
Q1Q6F8_9BACT/43-245AEVI
B5EFB1_GEOBB/63-262TTLF
B8F9A9_DESAA/40-249VKTA
A3CSE9_METMJ/46-253ARLI
C0CH74_9FIRM/37-232CEKM
A8F5L0_THELT/34-232CKRI
Q1Q0G5_9BACT/40-248SNII
B0VJW9_CLOAI/40-242SRIM
Q02C16_SOLUE/87-301AETM
C0BXI3_9CLOT/112-328IDLV
A8ZTZ9_DESOH/31-237AWIL
Q3A1K2_PELCD/35-241SELL
B8J2N6_DESDA/65-275YAVF
B1H0P1_UNCTG/40-246LNEL
Q01ZF9_SOLUE/69-328MALM
B2A581_NATTJ/44-252CNII
C4XT04_DESMR/38-236YATL
B1I1Q6_DESAP/33-238ARLL
B1C5P9_9FIRM/37-254SKIL
C7LRB8_DESBD/73-273AKLF
D4H7U4_DENA2/37-236TRMV
A7AFK1_9PORP/72-273LALF
C8X3C8_DESRD/68-268VSMV
Q2LY82_SYNAS/69-267ATLF
B1C978_9FIRM/40-242AKMV
C8X2E5_DESRD/38-236YTAV
Q64AT3_9ARCH/48-256CALM
Q3A9J0_CARHZ/39-240TQMM
A8ZU87_DESOH/51-252VTLV
Q3A6X8_PELCD/41-242INLV
Q02CN1_SOLUE/65-329TAAM
C0GJS2_9FIRM/39-238CHII
D1C824_SPHTD/94-288AAVL
C4XGU5_DESMR/56-256VALL
C4XGL5_DESMR/50-253ADLM
B2UQQ8_AKKM8/51-249AALL
Q8TQV4_METAC/37-242LALL
A6DH41_9BACT/37-240ATMA
B8FLE0_DESAA/47-254AALL
A4XJ40_CALS8/35-230AENL
A5G4H9_GEOUR/41-249AYMI
C4FC45_9ACTN/57-345IDMT
D0LLI3_HALO1/243-443WDMM
Q1NX93_9DELT/39-246CQLL
B8D1J2_HALOH/38-243LFLM
B8FFA8_DESAA/37-237AHIM
Q1Q6G1_9BACT/104-329TAIM
A6UVE5_META3/35-239SQYM
B0AB85_9FIRM/40-246CKLI
C0D7U9_9CLOT/37-238AAVM
Q026Y6_SOLUE/54-259EALM
A1ATM1_PELPD/98-298ARLA
B2A6N3_NATTJ/41-242AGIM
B9MLY7_ANATD/37-241CKII
A9G6Q8_SORC5/40-243CQII
A6TU65_ALKMQ/45-250TSII
B8GJS8_METPE/36-236STLM
C6C140_DESAD/43-240YMLL
D2Z7N5_9BACT/38-240ADLM
O28048_ARCFU/70-274VAIL
A9F071_SORC5/101-299CQLI
Q46CA4_METBF/38-243AEMI
D1N489_9BACT/73-273ARII
C8X0Z6_DESRD/32-238AALL
O28963_ARCFU/29-221ARLM
C0GEG7_9FIRM/35-241ARVL
Q0W4U5_UNCMA/31-238ARMI
B5YEQ4_DICT6/36-227AKIL
Q0W7R4_UNCMA/39-237SFLM
D6SKE1_9DELT/40-241THML
B1ZNQ0_OPITP/79-285STFL
D6SMX5_9DELT/72-277VSIL
A3DEM5_CLOTH/40-242CRMI
A5GCX4_GEOUR/71-274LAVL
B0A6W7_9FIRM/42-247ARLL
Q30WA5_DESDG/52-250GTLL
B8DIZ2_DESVM/89-288VESF
B5YB81_DICT6/37-240SLLL
Q3ABD0_CARHZ/32-236AEIM
A1VA95_DESVV/57-259CSVI
B9Y9X4_9FIRM/42-245LTLL
B2A5X2_NATTJ/39-234AHLL
Q20JY2_9BACT/38-245GEII
A0LEU5_SYNFM/65-266CEML
A2SS29_METLZ/39-246QTLV
Q02D98_SOLUE/66-270CRIM
B8GKV1_METPE/42-249ASVI
B8FX06_DESHD/40-245THLI
C0A4C5_9BACT/77-278ARML
A7I744_METB6/37-246VALL

PF09861

A6CEC2_9PLAN/11-206RELT
A1HP90_9FIRM/9-212VGKG
Q38XJ2_LACSS/8-213SRTG
Q8TR70_METAC/61-260AVSG
Q7MSU0_WOLSU/7-208QALS
B8FVM0_DESHD/8-210AELG
Q4A0S0_STAS1/7-207STWG
A3ZLC3_9PLAN/7-211ATMG
A4QGL8_CORGB/1-216EIIG
A6TUJ7_ALKMQ/19-224ARTG
A0B768_METTP/5-193ARSG
A6TKP7_ALKMQ/8-211VGEG
Q649M8_9ARCH/8-203AKIA
A6TUX2_ALKMQ/8-211INTG
Q3AFZ6_CARHZ/7-206AHAG
A6LWC1_CLOB8/8-213ARTG
Q464W1_METBF/12-214PLSG
Q8CQ57_STAES/7-207STWG
A7GC44_CLOBL/8-213ARTG
Q24SB3_DESHY/7-210SVIT
A7ZC16_CAMC1/7-208QALR
A6LSU3_CLOB8/8-211FGSG
A6TKS3_ALKMQ/8-211EGAG
Q24QM2_DESHY/9-209AEQS
Q12XD0_METBU/7-204QSLA
Q39QL7_GEOMG/5-203EGTG
A1HLY5_9FIRM/8-211IGKG
A7H7M7_ANADF/33-231SALG
A7HGF3_ANADF/7-208STWG
Q464V9_METBF/12-211AVSG
A5I2T6_CLOBH/8-211LGDG
A5I3E3_CLOBH/8-211NGIN
B9M1P9_GEOSF/5-202PASG
Q18B34_CLOD6/8-213SRTG
Q747H1_GEOSL/25-223EGTG
Q0W3S9_UNCMA/8-206AETG
Q51312_9NOSO/2-192ALIT
A4E8U8_9ACTN/44-249SRAG
A6P1C6_9FIRM/14-218ARTG
A1HRB0_9FIRM/10-212AVIG
Q97KZ7_CLOAB/10-215ARTG
Q8PUN0_METMA/12-214PLLG
Q2RH63_MOOTA/18-219ATLG
Q67NT5_SYMTH/7-210AATA
A1HLP3_9FIRM/10-213SYLG
O30187_ARCFU/10-210AAMA
A1HS76_9FIRM/8-208STWG
A1SI75_NOCSJ/23-229SFMD
Q2RKJ2_MOOTA/9-212NMLG
A5GC39_GEOUR/5-203AGSG

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window